F447850

General Info

Members Datasets Scaffolds Average Seq Length
456 313 912 232

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0001001|Ga0495580_0001001_5330_6124
Length 264
Sequence VLAEVAEGTGREVDPSNVLCRHARKRGEAVSRHVLVVEDEDDIAQLVKMQLTRLSCEVTVRNDGKAGLSEALAQPYDLLVLDLMLPGVDGLEICRRLRSEQRYTPILMLTARSTELDRVLGLEMGADDYLTKPFSVLEFVARVKALFRLVDVLVNPAADAPKAIEAKDLRIDIQKREVTVRREAVCLTAKEFQLLLHFAQNPGRVYSRSQLLDQVWGYSHSGYEHTVNSHINRLRAKIEINPNEPEYIQTVWGVGYKFRNDSIG

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
156 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
255 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
256 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
257 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
258 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
259 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
260 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
261 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
262 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
263 2643221729 Bacillus sp. Root11 Isolate Unclassified
264 2643221730 Bacillus sp. Root131 Isolate Unclassified
265 2671180694 Paenibacillus sp. A3 Isolate Unclassified
266 2684622632 Bacillus cereus 905 Isolate Unclassified
267 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
268 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
269 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
270 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
271 2738541358 Bacillus sp. OV752 Isolate Unclassified
272 2738543006 Bacillus sp. OK077 Isolate Unclassified
273 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
274 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
275 2808606448 Streptomyces sp. 193411 Isolate Unclassified
276 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
277 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
278 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
279 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
280 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
281 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
282 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
283 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
284 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
285 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
286 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
287 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
288 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
289 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
290 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
291 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
292 2938917290 Bacillus sp. CR71 Isolate Unclassified
293 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
294 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
295 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
296 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
297 2965761152 Bacillus sp. COPE52 Isolate Unclassified
298 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
299 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
300 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
301 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
302 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
303 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
304 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
305 8022653035 Bacillus sp. Rc4 Isolate Unclassified
306 8022792930 Bacillus sp. Xin Isolate Rhizosphere
307 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
308 8023438354 Bacillus sp. BH2 Isolate Unclassified
309 8023444577 Bacillus sp. BH32 Isolate Unclassified
310 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
311 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
312 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
313 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.43
Metatranscriptomes 1.97
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.96
Nodule 0.44
Rhizoplane 3.51
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0001001 3300046472 Bacteria 24861
2 JGI25162J39368_1006397 3300002737 Bacteria 2044
3 JGI25159J45721_1000919 3300002987 Bacteria 12794
4 JGI25151J46595_10013082 3300003187 Bacteria 3744
5 JGI25151J46595_10025921 3300003187 Bacteria 2376
6 JGI25151J46595_10028612 3300003187 Bacteria 2217
7 JGI25151J46595_10036938 3300003187 Bacteria 1837
8 JGI25151J46595_10037210 3300003187 Bacteria 1827
9 JGI25151J46595_10081576 3300003187 Bacteria 934
10 JGI25406J46586_10025530 3300003203 Bacteria 2293
11 Ga0055536_1020083 3300003781 Bacteria 2076
12 Ga0055541_1002008 3300003841 Bacteria 4176
13 Ga0070658_10015400 3300005327 Bacteria 6120
14 Ga0070683_100052127 3300005329 Bacteria 3790
15 Ga0070690_100106358 3300005330 Bacteria 1866
16 Ga0070670_100093619 3300005331 Bacteria 2584
17 Ga0070660_100013125 3300005339 Bacteria 5933
18 Ga0070669_100010864 3300005353 Bacteria 6463
19 Ga0070671_100456422 3300005355 Bacteria 1097
20 Ga0070673_100410271 3300005364 Bacteria 1213
21 Ga0070667_100002151 3300005367 Bacteria 17357
22 Ga0070714_100271850 3300005435 Unclassified 1572
23 Ga0070713_100000009 3300005436 Bacteria 153056
24 Ga0070678_100003004 3300005456 Bacteria 9349
25 Ga0070678_100003185 3300005456 Bacteria 9099
26 Ga0070678_100097047 3300005456 Bacteria 2275
27 Ga0068867_100002093 3300005459 Bacteria 13986
28 Ga0068867_100037488 3300005459 Bacteria 3524
29 Ga0070679_100197235 3300005530 Bacteria 1980
30 Ga0070684_100106924 3300005535 Bacteria 2505
31 Ga0070697_100035551 3300005536 Bacteria 4019
32 Ga0068853_100224756 3300005539 Bacteria 1716
33 Ga0070672_100032427 3300005543 Bacteria 3942
34 Ga0070672_100036319 3300005543 Bacteria 3754
35 Ga0070672_100595286 3300005543 Bacteria 963
36 Ga0070665_100000411 3300005548 Bacteria 62752
37 Ga0070665_100007920 3300005548 Bacteria 10773
38 Ga0070665_100019523 3300005548 Bacteria 6805
39 Ga0070664_100132210 3300005564 Bacteria 2192
40 Ga0070664_100539873 3300005564 Bacteria 1078
41 Ga0068857_100521757 3300005577 Bacteria 1116
42 Ga0068854_100100127 3300005578 Bacteria 2171
43 Ga0068859_100022457 3300005617 Bacteria 6326
44 Ga0068859_100166964 3300005617 Bacteria 2281
45 Ga0068859_100168367 3300005617 Bacteria 2271
46 Ga0068859_100258530 3300005617 Bacteria 1832
47 Ga0068866_10006882 3300005718 Bacteria 4749
48 Ga0068861_100000750 3300005719 Bacteria 19469
49 Ga0068863_100025926 3300005841 Bacteria 5594
50 Ga0068863_100058854 3300005841 Bacteria 3636
51 Ga0068858_100002886 3300005842 Bacteria 17285
52 Ga0068858_100025383 3300005842 Bacteria 5514
53 Ga0068860_100001666 3300005843 Bacteria 23760
54 Ga0068860_100004020 3300005843 Bacteria 15104
55 Ga0068860_100517403 3300005843 Bacteria 1193
56 Ga0068862_100003929 3300005844 Bacteria 12643
57 Ga0081455_10019049 3300005937 Bacteria 6510
58 Ga0081455_10019804 3300005937 Bacteria 6354
59 Ga0081538_10005102 3300005981 Bacteria 11924
60 Ga0081539_10006443 3300005985 Bacteria 11252
61 Ga0081539_10066291 3300005985 Bacteria 1957
62 Ga0075364_10489577 3300006051 Bacteria 841
63 Ga0070716_100034999 3300006173 Bacteria 2758
64 Ga0075362_10091179 3300006177 Bacteria 1415
65 Ga0075367_10002689 3300006178 Bacteria 8195
66 Ga0075367_10219693 3300006178 Bacteria 1189
67 Ga0075366_10044027 3300006195 Bacteria 2645
68 Ga0075366_10066218 3300006195 Bacteria 2149
69 Ga0075370_10000041 3300006353 Bacteria 40659
70 Ga0075370_10001640 3300006353 Bacteria 9874
71 Ga0075429_100117901 3300006880 Bacteria 2320
72 Ga0068865_100007036 3300006881 Bacteria 6904
73 Ga0068865_100315935 3300006881 Bacteria 1255
74 Ga0097620_100022456 3300006931 Bacteria 6326
75 Ga0097620_100166968 3300006931 Bacteria 2281
76 Ga0097620_100168369 3300006931 Bacteria 2271
77 Ga0097620_100258534 3300006931 Bacteria 1832
78 Ga0105251_10007990 3300009011 Bacteria 6417
79 Ga0105244_10004280 3300009036 Bacteria 9890
80 Ga0105244_10013326 3300009036 Bacteria 4812
81 Ga0105244_10026448 3300009036 Bacteria 3140
82 Ga0105244_10035651 3300009036 Bacteria 2612
83 Ga0105244_10057471 3300009036 Bacteria 1966
84 Ga0105244_10060790 3300009036 Bacteria 1903
85 Ga0105244_10073606 3300009036 Bacteria 1701
86 Ga0105244_10165554 3300009036 Bacteria 1054
87 Ga0105250_10001293 3300009092 Bacteria 13737
88 Ga0105250_10014743 3300009092 Bacteria 3206
89 Ga0105240_10003651 3300009093 Bacteria 23827
90 Ga0111539_10066941 3300009094 Bacteria 4243
91 Ga0105245_10014301 3300009098 Bacteria 6917
92 Ga0114129_10000122 3300009147 Bacteria 78726
93 Ga0105248_10044253 3300009177 Bacteria 4993
94 Ga0105248_10211801 3300009177 Bacteria 2183
95 Ga0105237_10001331 3300009545 Bacteria 32775
96 Ga0105238_10009167 3300009551 Bacteria 9905
97 Ga0105249_10014547 3300009553 Bacteria 6956
98 Ga0105239_10000563 3300010375 Bacteria 53173
99 Ga0105239_10241861 3300010375 Bacteria 2026
100 Ga0157371_10005233 3300013102 Bacteria 11025
101 Ga0157378_10000700 3300013297 Bacteria 31401
102 Ga0157378_10006332 3300013297 Bacteria 10364
103 Ga0163162_10006017 3300013306 Bacteria 11743
104 Ga0163162_10275321 3300013306 Bacteria 1815
105 Ga0163162_10609379 3300013306 Bacteria 1218
106 Ga0157375_10005482 3300013308 Bacteria 11035
107 Ga0157375_10023409 3300013308 Bacteria 5700
108 Ga0157375_10045398 3300013308 Bacteria 4276
109 Ga0157380_10167816 3300014326 Bacteria 1914
110 Ga0157379_10004130 3300014968 Bacteria 12388
111 Ga0157379_10004520 3300014968 Bacteria 11932
112 Ga0157379_10675030 3300014968 Bacteria 969
113 Ga0157376_10745689 3300014969 Bacteria 988
114 Ga0163161_10043727 3300017792 Bacteria 3226
115 Ga0197907_10959962 3300020069 Bacteria 1044
116 Ga0206349_1168105 3300020075 Unclassified 1158
117 Ga0206349_1189327 3300020075 Unclassified 3750
118 Ga0206352_10798414 3300020078 Unclassified 3066
119 Ga0206350_10166879 3300020080 Unclassified 3546
120 Ga0209566_100052 3300025225 Bacteria 231848
121 Ga0209147_103664 3300025229 Bacteria 2872
122 Ga0209437_100389 3300025233 Bacteria 42897
123 Ga0209258_106890 3300025242 Bacteria 1732
124 Ga0209130_1000643 3300025284 Bacteria 32629
125 Ga0209130_1004413 3300025284 Bacteria 5348
126 Ga0209130_1010806 3300025284 Bacteria 2487
127 Ga0209675_1015104 3300025291 Bacteria 2312
128 Ga0209676_1000987 3300025292 Bacteria 33852
129 Ga0209676_1007753 3300025292 Bacteria 4947
130 Ga0209676_1014143 3300025292 Bacteria 3019
131 Ga0209676_1054035 3300025292 Bacteria 1037
132 Ga0209676_1069240 3300025292 Bacteria 845
133 Ga0209025_1000457 3300025294 Bacteria 79829
134 Ga0209025_1000722 3300025294 Bacteria 56052
135 Ga0209025_1001182 3300025294 Bacteria 36937
136 Ga0209025_1009163 3300025294 Bacteria 6954
137 Ga0209025_1010131 3300025294 Bacteria 6435
138 Ga0209025_1010222 3300025294 Bacteria 6393
139 Ga0209025_1011072 3300025294 Bacteria 6010
140 Ga0209025_1011636 3300025294 Bacteria 5766
141 Ga0209025_1019687 3300025294 Bacteria 3739
142 Ga0209025_1025561 3300025294 Bacteria 3000
143 Ga0209257_1012448 3300025304 Bacteria 3929
144 Ga0207696_1000822 3300025711 Bacteria 19918
145 Ga0207696_1023811 3300025711 Bacteria 1927
146 Ga0207655_1009022 3300025728 Bacteria 6246
147 Ga0207655_1077830 3300025728 Bacteria 1208
148 Ga0207713_1008925 3300025735 Bacteria 5705
149 Ga0207642_10005520 3300025899 Bacteria 4131
150 Ga0207688_10010592 3300025901 Bacteria 5014
151 Ga0207680_10029303 3300025903 Bacteria 3090
152 Ga0207705_10038721 3300025909 Bacteria 3415
153 Ga0207705_10134388 3300025909 Bacteria 1843
154 Ga0207684_10003219 3300025910 Bacteria 16025
155 Ga0207695_10003089 3300025913 Bacteria 23836
156 Ga0207671_10008218 3300025914 Bacteria 8888
157 Ga0207657_10017089 3300025919 Bacteria 6975
158 Ga0207652_10462197 3300025921 Bacteria 1144
159 Ga0207681_10098407 3300025923 Bacteria 2104
160 Ga0207694_10020041 3300025924 Bacteria 5058
161 Ga0207650_10303916 3300025925 Bacteria 1303
162 Ga0207659_10194180 3300025926 Bacteria 1617
163 Ga0207700_10000025 3300025928 Bacteria 147429
164 Ga0207644_10223610 3300025931 Bacteria 1493
165 Ga0207704_10050295 3300025938 Bacteria 2513
166 Ga0207665_10355144 3300025939 Bacteria 1107
167 Ga0207691_10018222 3300025940 Bacteria 6650
168 Ga0207691_10018768 3300025940 Bacteria 6550
169 Ga0207691_10076669 3300025940 Bacteria 3012
170 Ga0207711_10227979 3300025941 Bacteria 1706
171 Ga0207711_10280260 3300025941 Bacteria 1535
172 Ga0207689_10078374 3300025942 Bacteria 2715
173 Ga0207651_10411004 3300025960 Bacteria 1153
174 Ga0207640_10661532 3300025981 Bacteria 891
175 Ga0207658_10029138 3300025986 Bacteria 3895
176 Ga0207658_10539582 3300025986 Bacteria 1043
177 Ga0207703_10003290 3300026035 Bacteria 13563
178 Ga0207703_10014850 3300026035 Bacteria 6078
179 Ga0207703_10106930 3300026035 Bacteria 2381
180 Ga0207703_10248248 3300026035 Bacteria 1603
181 Ga0207678_10102318 3300026067 Bacteria 2446
182 Ga0207641_10010116 3300026088 Bacteria 7757
183 Ga0207648_10000579 3300026089 Bacteria 41056
184 Ga0207648_10005341 3300026089 Bacteria 12952
185 Ga0207675_100001492 3300026118 Bacteria 23463
186 Ga0207683_10011707 3300026121 Bacteria 7488
187 Ga0207683_10114030 3300026121 Bacteria 2421
188 Ga0207683_10123571 3300026121 Bacteria 2325
189 Ga0207698_10043155 3300026142 Bacteria 3376
190 Ga0209974_10065791 3300027876 Bacteria 1231
191 Ga0268266_10000564 3300028379 Bacteria 51534
192 Ga0268266_10031948 3300028379 Bacteria 4473
193 Ga0268266_10045624 3300028379 Bacteria 3749
194 Ga0268265_10006593 3300028380 Bacteria 7858
195 Ga0268264_10066061 3300028381 Bacteria 3049
196 Ga0268264_10067496 3300028381 Bacteria 3019
197 Ga0268264_10069186 3300028381 Bacteria 2985
198 Ga0268264_10240401 3300028381 Bacteria 1677
199 Ga0307515_10061625 3300028794 Bacteria 5316
200 Ga0265338_10039992 3300028800 Bacteria 4412
201 Ga0237817_10021 3300030083 Bacteria 63280
202 Ga0237817_10040 3300030083 Bacteria 44341
203 Ga0307509_10102770 3300031507 Bacteria 2888
204 Ga0307509_10234046 3300031507 Bacteria 1637
205 Ga0307408_100013066 3300031548 Bacteria 5510
206 Ga0307408_100521099 3300031548 Bacteria 1044
207 Ga0316576_10093452 3300031727 Bacteria 2242
208 Ga0316578_10393928 3300031728 Bacteria 821
209 Ga0307405_10002178 3300031731 Bacteria 8556
210 Ga0307405_10002423 3300031731 Bacteria 8215
211 Ga0307405_10004737 3300031731 Bacteria 6476
212 Ga0307413_10003028 3300031824 Bacteria 6983
213 Ga0307413_10004441 3300031824 Bacteria 6105
214 Ga0307413_10148318 3300031824 Bacteria 1631
215 Ga0307410_10002277 3300031852 Bacteria 9204
216 Ga0307410_10019989 3300031852 Bacteria 4087
217 Ga0307410_10388226 3300031852 Bacteria 1125
218 Ga0307406_10031111 3300031901 Bacteria 3247
219 Ga0307406_10623455 3300031901 Bacteria 892
220 Ga0307407_10323210 3300031903 Bacteria 1083
221 Ga0307412_10014864 3300031911 Bacteria 4601
222 Ga0307412_10022323 3300031911 Bacteria 3878
223 Ga0307412_10336734 3300031911 Bacteria 1206
224 Ga0307409_100002787 3300031995 Bacteria 9233
225 Ga0307409_100025450 3300031995 Bacteria 4151
226 Ga0307416_100001565 3300032002 Bacteria 12537
227 Ga0307414_10002534 3300032004 Bacteria 9592
228 Ga0307411_10023625 3300032005 Bacteria 3646
229 Ga0307411_10024924 3300032005 Bacteria 3574
230 Ga0307415_100001638 3300032126 Bacteria 10836
231 Ga0307415_100008103 3300032126 Bacteria 5804
232 Ga0373923_0148185 3300035111 Bacteria 1064
233 Ga0373954_0041558 3300035118 Bacteria 2144
234 Ga0373956_0005282 3300035119 Bacteria 5170
235 Ga0373956_0078986 3300035119 Bacteria 1508
236 Ga0373943_0123849 3300035170 Bacteria 1376
237 Ga0373946_0070127 3300035171 Bacteria 1512
238 Ga0373927_0000030 3300035695 Bacteria 107610
239 Ga0373927_0215837 3300035695 Bacteria 1260
240 Ga0373933_0099214 3300035724 Bacteria 1805
241 Ga0373937_0034378 3300036401 Bacteria 4611
242 Ga0310109_001648 3300036534 Unclassified 2325
243 Ga0316584_0190503 3300036712 Bacteria 1516
244 Ga0395899_0007092 3300037312 Bacteria 8673
245 Ga0395899_0043485 3300037312 Bacteria 3351
246 Ga0395899_0148853 3300037312 Bacteria 1660
247 Ga0395900_0021630 3300037418 Bacteria 6575
248 Ga0395900_0041433 3300037418 Bacteria 4747
249 Ga0395898_0002309 3300037466 Bacteria 22851
250 Ga0395898_0002985 3300037466 Bacteria 19216
251 Ga0395898_0032291 3300037466 Bacteria 5225
252 Ga0395905_0003158 3300037471 Bacteria 17749
253 Ga0395905_0003445 3300037471 Bacteria 16925
254 Ga0395905_0011436 3300037471 Bacteria 8576
255 Ga0395905_0062624 3300037471 Bacteria 3479
256 Ga0436364_0363292 3300037853 Bacteria 1765
257 Ga0395901_0004338 3300038443 Bacteria 14312
258 Ga0395901_0006962 3300038443 Bacteria 11423
259 Ga0395901_0018072 3300038443 Bacteria 7196
260 Ga0395901_0163358 3300038443 Bacteria 2338
261 Ga0395901_0285826 3300038443 Bacteria 1713
262 Ga0237819_00938 3300038705 Bacteria 8917
263 Ga0400483_229187 3300039062 Bacteria 1136
264 Ga0400489_05826 3300039093 Bacteria 1056
265 Ga0400489_16543 3300039093 Bacteria 4626
266 Ga0439463_066347 3300042016 Bacteria 923
267 Ga0451577_0170858 3300042876 Bacteria 1959
268 Ga0451577_0419415 3300042876 Bacteria 1215
269 Ga0466969_0015693 3300044656 Bacteria 3969
270 Ga0466969_0061804 3300044656 Bacteria 1819
271 Ga0466966_0249781 3300044684 Bacteria 1069
272 Ga0466961_0276315 3300044693 Bacteria 1028
273 Ga0453684_0008438 3300044712 Bacteria 18451
274 Ga0453684_0015288 3300044712 Bacteria 12164
275 Ga0453684_0043885 3300044712 Bacteria 5998
276 Ga0453684_0059730 3300044712 Bacteria 4912
277 Ga0453684_0508320 3300044712 Bacteria 1333
278 Ga0453684_0681923 3300044712 Bacteria 1118
279 Ga0466968_0017446 3300044735 Bacteria 2869
280 Ga0466957_0053019 3300044842 Bacteria 2472
281 Ga0466957_0226254 3300044842 Bacteria 1237
282 Ga0466959_0075003 3300045049 Bacteria 2445
283 Ga0451576_0036813 3300045051 Bacteria 5185
284 Ga0451576_0133687 3300045051 Bacteria 2586
285 Ga0466958_0082057 3300045836 Bacteria 1985
286 Ga0466967_0003627 3300045976 Bacteria 10143
287 Ga0466967_0499210 3300045976 Bacteria 1194
288 Ga0495592_0113136 3300046454 Bacteria 1918
289 Ga0495603_0130440 3300046455 Bacteria 1464
290 Ga0495629_0000025 3300046459 Bacteria 135624
291 Ga0495629_0025542 3300046459 Bacteria 4197
292 Ga0495629_0137300 3300046459 Bacteria 1702
293 Ga0495638_0003869 3300046460 Bacteria 11612
294 Ga0495641_0019898 3300046461 Bacteria 3420
295 Ga0495650_0159696 3300046471 Bacteria 805
296 Ga0495580_0207724 3300046472 Bacteria 1348
297 Ga0495580_0321062 3300046472 Bacteria 1052
298 Ga0495639_0332207 3300046475 Bacteria 761
299 Ga0495664_0047767 3300046477 Bacteria 2541
300 Ga0495583_0051501 3300046506 Bacteria 1877
301 Ga0495606_0000017 3300046507 Bacteria 284549
302 Ga0495628_0333146 3300046516 Bacteria 1118
303 Ga0495630_0000034 3300046517 Bacteria 126055
304 Ga0495631_0133147 3300046518 Bacteria 1068
305 Ga0495632_0006866 3300046519 Bacteria 7249
306 Ga0495642_0161639 3300046528 Bacteria 971
307 Ga0495640_0014065 3300046533 Bacteria 6069
308 Ga0495621_0004587 3300046539 Bacteria 3902
309 Ga0495597_0012419 3300046542 Bacteria 4109
310 Ga0495597_0146801 3300046542 Bacteria 970
311 Ga0495667_0229716 3300046559 Bacteria 1183
312 Ga0495668_0236258 3300046616 Bacteria 1001
313 Ga0495611_0074725 3300046648 Bacteria 1552
314 Ga0495611_0091178 3300046648 Bacteria 1409
315 Ga0495635_0372695 3300046663 Bacteria 951
316 Ga0495647_0000086 3300046681 Bacteria 22895
317 Ga0495658_0025677 3300046683 Bacteria 3151
318 Ga0495669_0117846 3300046684 Bacteria 1243
319 Ga0495613_0000073 3300046689 Bacteria 98688
320 Ga0495613_0010884 3300046689 Bacteria 6751
321 Ga0495624_0001329 3300046690 Bacteria 19343
322 Ga0495671_0022484 3300046692 Bacteria 3304
323 Ga0495649_0005975 3300046694 Bacteria 7628
324 Ga0495589_0004024 3300046794 Bacteria 7878
325 Ga0495660_0021042 3300046810 Bacteria 3738
326 Ga0495660_0176465 3300046810 Bacteria 1037
327 Ga0495604_0000073 3300047317 Bacteria 86844
328 Ga0495674_0000042 3300047319 Bacteria 94820
329 Ga0495683_0051781 3300047323 Bacteria 2051
330 Ga0495683_0062057 3300047323 Bacteria 1850
331 Ga0495683_0076900 3300047323 Bacteria 1632
332 Ga0495687_000070 3300047443 Bacteria 159227
333 Ga0495687_000125 3300047443 Bacteria 118053
334 Ga0495687_003499 3300047443 Bacteria 11330
335 Ga0495685_080444 3300047447 Bacteria 1085
336 Ga0495684_0094077 3300047471 Bacteria 2270
337 Ga0495626_0019414 3300048091 Bacteria 3402
338 Ga0496101_0386254 3300048904 Bacteria 1102
339 Ga0496102_0017377 3300048905 Bacteria 6301
340 Ga0496103_0037108 3300048906 Bacteria 2986
341 Ga0496104_0010527 3300048907 Bacteria 8262
342 Ga0496104_0013760 3300048907 Bacteria 7297
343 Ga0496105_0093779 3300048908 Bacteria 2479
344 Ga0496107_0049279 3300048910 Bacteria 3035
345 Ga0496107_0314743 3300048910 Bacteria 1165
346 Ga0496107_0352779 3300048910 Bacteria 1095
347 Ga0496109_0002107 3300048912 Bacteria 16540
348 Ga0496109_0025179 3300048912 Bacteria 5300
349 Ga0496109_0748185 3300048912 Bacteria 915
350 Ga0496111_0010230 3300048914 Bacteria 6286
351 Ga0496112_0259052 3300048915 Bacteria 1689
352 Ga0496116_0017153 3300048919 Bacteria 5635
353 Ga0496121_0022415 3300048924 Bacteria 6131
354 Ga0496124_0000079 3300048927 Bacteria 212057
355 Ga0496125_0005397 3300048928 Bacteria 14250
356 Ga0496125_0108706 3300048928 Bacteria 2016
357 Ga0496126_0351313 3300048929 Bacteria 1206
358 Ga0495682_0011333 3300049460 Bacteria 3432
359 Ga0501034_0072453 3300049571 Bacteria 3454
360 Ga0501034_0209258 3300049571 Bacteria 1906
361 Ga0501037_0017367 3300049573 Bacteria 5299
362 Ga0501038_0059515 3300049574 Bacteria 3272
363 Ga0501039_0057206 3300049575 Bacteria 3020
364 Ga0501041_0201890 3300049577 Bacteria 1246
365 Ga0501046_0274886 3300049580 Bacteria 1235
366 Ga0501047_0054719 3300049581 Bacteria 3860
367 Ga0501048_0089076 3300049582 Bacteria 2177
368 Ga0501071_0054714 3300049587 Bacteria 2880
369 Ga0501071_0695748 3300049587 Bacteria 783
370 Ga0501073_0398466 3300049589 Bacteria 951
371 Ga0501074_0248002 3300049590 Bacteria 1266
372 Ga0501076_0021980 3300049592 Bacteria 4900
373 Ga0501077_0038218 3300049593 Bacteria 3056
374 Ga0501079_0212458 3300049741 Bacteria 1511
375 Ga0501080_0502752 3300049742 Bacteria 1083
376 Ga0501044_0036739 3300049823 Bacteria 5123
377 nmdc:mga00v17_430807_c1 3300050491 Bacteria 856
378 nmdc:mga0k408_17533_c1 3300050493 Bacteria 3991
379 nmdc:mga06z11_10959_c1 3300050494 Bacteria 3888
380 nmdc:mga07m45_4238_c1 3300050496 Bacteria 7019
381 nmdc:mga07m45_865_c1 3300050496 Bacteria 12668
382 nmdc:mga05p37_5772_c1 3300050507 Bacteria 14559
383 nmdc:mga09592_113185_c1 3300050508 Bacteria 2328
384 nmdc:mga0n895_423141_c1 3300050512 Bacteria 1346
385 nmdc:mga0sz30_41770_c1 3300050516 Bacteria 1928
386 Ga0495612_0029367 3300053078 Bacteria 2214
387 Ga0495619_0048841 3300053085 Bacteria 2789
388 Ga0500578_0164075 3300053086 Bacteria 1377
389 Ga0500637_0003968 3300053178 Bacteria 6928
390 Ga0501084_0012235 3300054114 Bacteria 7104
391 Ga0587090_000557 3300059510 Bacteria 3204
392 Ga0587072_011889 3300059643 Bacteria 1430
393 Ga0587111_0004665 3300060346 Bacteria 2060
394 Ga0530510_0210819 3300061734 Bacteria 1443
395 2512732104 2512564039 Bacteria 8739048
396 2514047605 2513237166 Bacteria 10373764
397 2553393991 2551306519 Bacteria 5465154
398 2595321033 2593339198 Bacteria 7267884
399 2599500789 2599185188 Bacteria 6164180
400 2599932455 2599185300 Bacteria 6062622
401 2601445377 2600255229 Bacteria 1988965
402 2631984235 2630968484 Bacteria 3876276
403 2643736511 2643221543 Bacteria 6628015
404 2644703794 2643221729 Bacteria 6621700
405 2644708486 2643221730 Bacteria 6523787
406 2673822914 2671180694 Bacteria 7506943
407 2685149219 2684622632 Bacteria 5380049
408 2698323960 2695420987 Bacteria 6152737
409 2705993263 2703719227 Bacteria 5631989
410 2717917538 2716884898 Bacteria 3928789
411 2721504601 2718218445 Bacteria 5113413
412 2739156438 2738541358 Bacteria 5932299
413 2739210050 2738543006 Bacteria 5904091
414 2791212584 2788500588 Bacteria 4584915
415 2792840565 2791355137 Bacteria 9654227
416 2809232797 2808606448 Bacteria 8656184
417 2811843740 2808606982 Bacteria 7791042
418 2819579629 2818991443 Bacteria 6598732
419 2864737875 2864733723 Bacteria 6770668
420 2864997993 2864997549 Bacteria 5139696
421 2889043431 2889042446 Bacteria 7618936
422 2889297389 2889295896 Bacteria 4704906
423 2904495378 2904490793 Bacteria 7046938
424 2904606850 2904606771 Bacteria 4684500
425 2904616914 2904615490 Bacteria 10047340
426 2904624889 2904615490 Bacteria 10047340
427 2916974366 2916971899 Bacteria 4250608
428 2916976345 2916971899 Bacteria 4250608
429 2919163420 2919160200 Bacteria 6929020
430 2921649125 2921643360 Bacteria 11448031
431 2925331980 2925326138 Bacteria 9652120
432 2929209295 2929206907 Bacteria 5918291
433 2929234489 2929233124 Bacteria 5948380
434 2931386889 2931384279 Bacteria 7299545
435 2938918670 2938917290 Bacteria 5914775
436 2939682192 2939679117 Bacteria 6921672
437 2945994517 2945991243 Bacteria 7008369
438 2946057312 2946053406 Bacteria 6978655
439 2947428038 2947426588 Bacteria 5357194
440 2965762520 2965761152 Bacteria 5806513
441 2971894204 2971893375 Bacteria 3929648
442 2979084950 2979083700 Bacteria 5894929
443 2981285870 2981284811 Bacteria 4641497
444 2981290822 2981289755 Bacteria 4641509
445 2981980564 2981980479 Bacteria 4641628
446 2981985437 2981985349 Bacteria 4641497
447 8022622453 8022621104 Bacteria 5241040
448 8022656070 8022653035 Bacteria 4035078
449 8022798340 8022792930 Bacteria 5693794
450 8022948684 8022948649 Bacteria 5366783
451 8023442657 8023438354 Bacteria 5779374
452 8023449510 8023444577 Bacteria 5661597
453 8055533277 8055531788 Bacteria 5249694
454 8055633663 8055632911 Bacteria 5283357
455 8057733936 8057733483 Bacteria 6578323
456 8057981886 8057977335 Bacteria 5694872
457 Ga0495580_0001001
458 JGI25162J39368_1006397
459 JGI25159J45721_1000919
460 JGI25151J46595_10013082
461 JGI25151J46595_10025921
462 JGI25151J46595_10028612
463 JGI25151J46595_10036938
464 JGI25151J46595_10037210
465 JGI25151J46595_10081576
466 JGI25406J46586_10025530
467 Ga0055536_1020083
468 Ga0055541_1002008
469 Ga0070658_10015400
470 Ga0070683_100052127
471 Ga0070690_100106358
472 Ga0070670_100093619
473 Ga0070660_100013125
474 Ga0070669_100010864
475 Ga0070671_100456422
476 Ga0070673_100410271
477 Ga0070667_100002151
478 Ga0070714_100271850
479 Ga0070713_100000009
480 Ga0070678_100003004
481 Ga0070678_100003185
482 Ga0070678_100097047
483 Ga0068867_100002093
484 Ga0068867_100037488
485 Ga0070679_100197235
486 Ga0070684_100106924
487 Ga0070697_100035551
488 Ga0068853_100224756
489 Ga0070672_100032427
490 Ga0070672_100036319
491 Ga0070672_100595286
492 Ga0070665_100000411
493 Ga0070665_100007920
494 Ga0070665_100019523
495 Ga0070664_100132210
496 Ga0070664_100539873
497 Ga0068857_100521757
498 Ga0068854_100100127
499 Ga0068859_100022457
500 Ga0068859_100166964
501 Ga0068859_100168367
502 Ga0068859_100258530
503 Ga0068866_10006882
504 Ga0068861_100000750
505 Ga0068863_100025926
506 Ga0068863_100058854
507 Ga0068858_100002886
508 Ga0068858_100025383
509 Ga0068860_100001666
510 Ga0068860_100004020
511 Ga0068860_100517403
512 Ga0068862_100003929
513 Ga0081455_10019049
514 Ga0081455_10019804
515 Ga0081538_10005102
516 Ga0081539_10006443
517 Ga0081539_10066291
518 Ga0075364_10489577
519 Ga0070716_100034999
520 Ga0075362_10091179
521 Ga0075367_10002689
522 Ga0075367_10219693
523 Ga0075366_10044027
524 Ga0075366_10066218
525 Ga0075370_10000041
526 Ga0075370_10001640
527 Ga0075429_100117901
528 Ga0068865_100007036
529 Ga0068865_100315935
530 Ga0097620_100022456
531 Ga0097620_100166968
532 Ga0097620_100168369
533 Ga0097620_100258534
534 Ga0105251_10007990
535 Ga0105244_10004280
536 Ga0105244_10013326
537 Ga0105244_10026448
538 Ga0105244_10035651
539 Ga0105244_10057471
540 Ga0105244_10060790
541 Ga0105244_10073606
542 Ga0105244_10165554
543 Ga0105250_10001293
544 Ga0105250_10014743
545 Ga0105240_10003651
546 Ga0111539_10066941
547 Ga0105245_10014301
548 Ga0114129_10000122
549 Ga0105248_10044253
550 Ga0105248_10211801
551 Ga0105237_10001331
552 Ga0105238_10009167
553 Ga0105249_10014547
554 Ga0105239_10000563
555 Ga0105239_10241861
556 Ga0157371_10005233
557 Ga0157378_10000700
558 Ga0157378_10006332
559 Ga0163162_10006017
560 Ga0163162_10275321
561 Ga0163162_10609379
562 Ga0157375_10005482
563 Ga0157375_10023409
564 Ga0157375_10045398
565 Ga0157380_10167816
566 Ga0157379_10004130
567 Ga0157379_10004520
568 Ga0157379_10675030
569 Ga0157376_10745689
570 Ga0163161_10043727
571 Ga0197907_10959962
572 Ga0206349_1168105
573 Ga0206349_1189327
574 Ga0206352_10798414
575 Ga0206350_10166879
576 Ga0209566_100052
577 Ga0209147_103664
578 Ga0209437_100389
579 Ga0209258_106890
580 Ga0209130_1000643
581 Ga0209130_1004413
582 Ga0209130_1010806
583 Ga0209675_1015104
584 Ga0209676_1000987
585 Ga0209676_1007753
586 Ga0209676_1014143
587 Ga0209676_1054035
588 Ga0209676_1069240
589 Ga0209025_1000457
590 Ga0209025_1000722
591 Ga0209025_1001182
592 Ga0209025_1009163
593 Ga0209025_1010131
594 Ga0209025_1010222
595 Ga0209025_1011072
596 Ga0209025_1011636
597 Ga0209025_1019687
598 Ga0209025_1025561
599 Ga0209257_1012448
600 Ga0207696_1000822
601 Ga0207696_1023811
602 Ga0207655_1009022
603 Ga0207655_1077830
604 Ga0207713_1008925
605 Ga0207642_10005520
606 Ga0207688_10010592
607 Ga0207680_10029303
608 Ga0207705_10038721
609 Ga0207705_10134388
610 Ga0207684_10003219
611 Ga0207695_10003089
612 Ga0207671_10008218
613 Ga0207657_10017089
614 Ga0207652_10462197
615 Ga0207681_10098407
616 Ga0207694_10020041
617 Ga0207650_10303916
618 Ga0207659_10194180
619 Ga0207700_10000025
620 Ga0207644_10223610
621 Ga0207704_10050295
622 Ga0207665_10355144
623 Ga0207691_10018222
624 Ga0207691_10018768
625 Ga0207691_10076669
626 Ga0207711_10227979
627 Ga0207711_10280260
628 Ga0207689_10078374
629 Ga0207651_10411004
630 Ga0207640_10661532
631 Ga0207658_10029138
632 Ga0207658_10539582
633 Ga0207703_10003290
634 Ga0207703_10014850
635 Ga0207703_10106930
636 Ga0207703_10248248
637 Ga0207678_10102318
638 Ga0207641_10010116
639 Ga0207648_10000579
640 Ga0207648_10005341
641 Ga0207675_100001492
642 Ga0207683_10011707
643 Ga0207683_10114030
644 Ga0207683_10123571
645 Ga0207698_10043155
646 Ga0209974_10065791
647 Ga0268266_10000564
648 Ga0268266_10031948
649 Ga0268266_10045624
650 Ga0268265_10006593
651 Ga0268264_10066061
652 Ga0268264_10067496
653 Ga0268264_10069186
654 Ga0268264_10240401
655 Ga0307515_10061625
656 Ga0265338_10039992
657 Ga0237817_10021
658 Ga0237817_10040
659 Ga0307509_10102770
660 Ga0307509_10234046
661 Ga0307408_100013066
662 Ga0307408_100521099
663 Ga0316576_10093452
664 Ga0316578_10393928
665 Ga0307405_10002178
666 Ga0307405_10002423
667 Ga0307405_10004737
668 Ga0307413_10003028
669 Ga0307413_10004441
670 Ga0307413_10148318
671 Ga0307410_10002277
672 Ga0307410_10019989
673 Ga0307410_10388226
674 Ga0307406_10031111
675 Ga0307406_10623455
676 Ga0307407_10323210
677 Ga0307412_10014864
678 Ga0307412_10022323
679 Ga0307412_10336734
680 Ga0307409_100002787
681 Ga0307409_100025450
682 Ga0307416_100001565
683 Ga0307414_10002534
684 Ga0307411_10023625
685 Ga0307411_10024924
686 Ga0307415_100001638
687 Ga0307415_100008103
688 Ga0373923_0148185
689 Ga0373954_0041558
690 Ga0373956_0005282
691 Ga0373956_0078986
692 Ga0373943_0123849
693 Ga0373946_0070127
694 Ga0373927_0000030
695 Ga0373927_0215837
696 Ga0373933_0099214
697 Ga0373937_0034378
698 Ga0310109_001648
699 Ga0316584_0190503
700 Ga0395899_0007092
701 Ga0395899_0043485
702 Ga0395899_0148853
703 Ga0395900_0021630
704 Ga0395900_0041433
705 Ga0395898_0002309
706 Ga0395898_0002985
707 Ga0395898_0032291
708 Ga0395905_0003158
709 Ga0395905_0003445
710 Ga0395905_0011436
711 Ga0395905_0062624
712 Ga0436364_0363292
713 Ga0395901_0004338
714 Ga0395901_0006962
715 Ga0395901_0018072
716 Ga0395901_0163358
717 Ga0395901_0285826
718 Ga0237819_00938
719 Ga0400483_229187
720 Ga0400489_05826
721 Ga0400489_16543
722 Ga0439463_066347
723 Ga0451577_0170858
724 Ga0451577_0419415
725 Ga0466969_0015693
726 Ga0466969_0061804
727 Ga0466966_0249781
728 Ga0466961_0276315
729 Ga0453684_0008438
730 Ga0453684_0015288
731 Ga0453684_0043885
732 Ga0453684_0059730
733 Ga0453684_0508320
734 Ga0453684_0681923
735 Ga0466968_0017446
736 Ga0466957_0053019
737 Ga0466957_0226254
738 Ga0466959_0075003
739 Ga0451576_0036813
740 Ga0451576_0133687
741 Ga0466958_0082057
742 Ga0466967_0003627
743 Ga0466967_0499210
744 Ga0495592_0113136
745 Ga0495603_0130440
746 Ga0495629_0000025
747 Ga0495629_0025542
748 Ga0495629_0137300
749 Ga0495638_0003869
750 Ga0495641_0019898
751 Ga0495650_0159696
752 Ga0495580_0207724
753 Ga0495580_0321062
754 Ga0495639_0332207
755 Ga0495664_0047767
756 Ga0495583_0051501
757 Ga0495606_0000017
758 Ga0495628_0333146
759 Ga0495630_0000034
760 Ga0495631_0133147
761 Ga0495632_0006866
762 Ga0495642_0161639
763 Ga0495640_0014065
764 Ga0495621_0004587
765 Ga0495597_0012419
766 Ga0495597_0146801
767 Ga0495667_0229716
768 Ga0495668_0236258
769 Ga0495611_0074725
770 Ga0495611_0091178
771 Ga0495635_0372695
772 Ga0495647_0000086
773 Ga0495658_0025677
774 Ga0495669_0117846
775 Ga0495613_0000073
776 Ga0495613_0010884
777 Ga0495624_0001329
778 Ga0495671_0022484
779 Ga0495649_0005975
780 Ga0495589_0004024
781 Ga0495660_0021042
782 Ga0495660_0176465
783 Ga0495604_0000073
784 Ga0495674_0000042
785 Ga0495683_0051781
786 Ga0495683_0062057
787 Ga0495683_0076900
788 Ga0495687_000070
789 Ga0495687_000125
790 Ga0495687_003499
791 Ga0495685_080444
792 Ga0495684_0094077
793 Ga0495626_0019414
794 Ga0496101_0386254
795 Ga0496102_0017377
796 Ga0496103_0037108
797 Ga0496104_0010527
798 Ga0496104_0013760
799 Ga0496105_0093779
800 Ga0496107_0049279
801 Ga0496107_0314743
802 Ga0496107_0352779
803 Ga0496109_0002107
804 Ga0496109_0025179
805 Ga0496109_0748185
806 Ga0496111_0010230
807 Ga0496112_0259052
808 Ga0496116_0017153
809 Ga0496121_0022415
810 Ga0496124_0000079
811 Ga0496125_0005397
812 Ga0496125_0108706
813 Ga0496126_0351313
814 Ga0495682_0011333
815 Ga0501034_0072453
816 Ga0501034_0209258
817 Ga0501037_0017367
818 Ga0501038_0059515
819 Ga0501039_0057206
820 Ga0501041_0201890
821 Ga0501046_0274886
822 Ga0501047_0054719
823 Ga0501048_0089076
824 Ga0501071_0054714
825 Ga0501071_0695748
826 Ga0501073_0398466
827 Ga0501074_0248002
828 Ga0501076_0021980
829 Ga0501077_0038218
830 Ga0501079_0212458
831 Ga0501080_0502752
832 Ga0501044_0036739
833 nmdc:mga00v17_430807_c1
834 nmdc:mga0k408_17533_c1
835 nmdc:mga06z11_10959_c1
836 nmdc:mga07m45_4238_c1
837 nmdc:mga07m45_865_c1
838 nmdc:mga05p37_5772_c1
839 nmdc:mga09592_113185_c1
840 nmdc:mga0n895_423141_c1
841 nmdc:mga0sz30_41770_c1
842 Ga0495612_0029367
843 Ga0495619_0048841
844 Ga0500578_0164075
845 Ga0500637_0003968
846 Ga0501084_0012235
847 Ga0587090_000557
848 Ga0587072_011889
849 Ga0587111_0004665
850 Ga0530510_0210819
851 2512732104
852 2514047605
853 2553393991
854 2595321033
855 2599500789
856 2599932455
857 2601445377
858 2631984235
859 2643736511
860 2644703794
861 2644708486
862 2673822914
863 2685149219
864 2698323960
865 2705993263
866 2717917538
867 2721504601
868 2739156438
869 2739210050
870 2791212584
871 2792840565
872 2809232797
873 2811843740
874 2819579629
875 2864737875
876 2864997993
877 2889043431
878 2889297389
879 2904495378
880 2904606850
881 2904616914
882 2904624889
883 2916974366
884 2916976345
885 2919163420
886 2921649125
887 2925331980
888 2929209295
889 2929234489
890 2931386889
891 2938918670
892 2939682192
893 2945994517
894 2946057312
895 2947428038
896 2965762520
897 2971894204
898 2979084950
899 2981285870
900 2981290822
901 2981980564
902 2981985437
903 8022622453
904 8022656070
905 8022798340
906 8022948684
907 8023442657
908 8023449510
909 8055533277
910 8055633663
911 8057733936
912 8057981886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

34

144

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

182

258

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uhk-assembly2.cif.gz_A crystal structure of the receiver domain of cpxr from e. coli (phosphorylated) 0.9431 2 120
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9412 2 119
4uhj-assembly1.cif.gz_A crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form) 0.9411 2 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.938 2 117
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9351 2 117
ID Description Score Start End Superfamily
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9399 1 117 3.40.50.2300
5za3A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9326 133 223 1.10.10.10
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9297 1 120 3.40.50.2300
4uhjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9262 2 120 3.40.50.2300
4s04F01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9254 2 118 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0S7XBY6-F1-model_v4 Response regulatory domain-containing protein 0.9104 2 117 GO:0000160
AF-B0N8W1-F1-model_v4 Response regulator receiver domain protein 0.8317 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-B0N8W1-F1-model_v4 Response regulator receiver domain protein 0.8218 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7S9C8K4-F1-model_v4 Response regulator transcription factor 0.8059 2 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7S9C8K4-F1-model_v4 Response regulator transcription factor 0.7996 2 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map