F447824

General Info

Members Datasets Scaffolds Average Seq Length
456 270 449 193

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0379967|Ga0373937_0379967_58_699
Length 213
Sequence VGRPALNARPFATTAEERIVAAQIRKLIVQVDETRIEMGRQIEPPTRKALAMAVIANPYAGRYSENLDELIAIGEELGGLLGQRCVQALGIAPGQAQSYGKAAIVGEGGELEHAAAILHPKLGAPLRQAVEKGAALVPSAKKRGGLGTAIDVPLGHKDAAFVRSHFDAMEARVSDAPRADEIVVAVVVTDSGRPLPRIGGLQVAEIKGEDGLR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221609 Acidovorax sp. Root217 Isolate Unclassified
3 2643221611 Acidovorax sp. Root219 Isolate Unclassified
4 2738543012 Acidovorax sp. CF301 Isolate Unclassified
5 2816332133 Acidovorax radicis 2721A Isolate Unclassified
6 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
7 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
182 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
186 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.87
Nodule 0.22
Rhizoplane 1.75
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1009532 3300002774 Bacteria 1841
2 JGI25159J45721_1000497 3300002987 Bacteria 18012
3 JGI25406J46586_10009863 3300003203 Bacteria 4266
4 JGI25153J46596_10001000 3300003215 Bacteria 17177
5 JGI25160J50197_1000228 3300003354 Bacteria 44139
6 JGI25161J50226_1000171 3300003374 Bacteria 44139
7 Ga0055537_1009517 3300003773 Bacteria 2136
8 Ga0055530_10021200 3300003791 Bacteria 1921
9 Ga0055543_1001492 3300004625 Bacteria 9204
10 Ga0070676_10007641 3300005328 Bacteria 5809
11 Ga0070676_10097049 3300005328 Bacteria 1815
12 Ga0070690_100415629 3300005330 Bacteria 991
13 Ga0070670_100067427 3300005331 Bacteria 3070
14 Ga0068869_100040889 3300005334 Bacteria 3317
15 Ga0070680_100113493 3300005336 Bacteria 2257
16 Ga0068868_100494040 3300005338 Bacteria 1071
17 Ga0070689_100064458 3300005340 Bacteria 2852
18 Ga0070668_100527279 3300005347 Bacteria 1025
19 Ga0070668_100606375 3300005347 Bacteria 958
20 Ga0070669_100144254 3300005353 Bacteria 1838
21 Ga0070669_100177880 3300005353 Bacteria 1662
22 Ga0070669_100222260 3300005353 Bacteria 1493
23 Ga0070669_100480865 3300005353 Bacteria 1028
24 Ga0070675_100021795 3300005354 Bacteria 5119
25 Ga0070671_100055325 3300005355 Bacteria 3301
26 Ga0070671_100078110 3300005355 Bacteria 2767
27 Ga0070673_100661918 3300005364 Bacteria 956
28 Ga0070667_100009522 3300005367 Bacteria 8054
29 Ga0070667_100689809 3300005367 Bacteria 944
30 Ga0070700_100167732 3300005441 Bacteria 1518
31 Ga0070708_100031668 3300005445 Bacteria 4579
32 Ga0070708_100037777 3300005445 Bacteria 4216
33 Ga0070708_100105284 3300005445 Bacteria 2588
34 Ga0070708_100250266 3300005445 Bacteria 1665
35 Ga0070663_101189771 3300005455 Bacteria 669
36 Ga0070678_100254496 3300005456 Bacteria 1474
37 Ga0070662_100024120 3300005457 Bacteria 4187
38 Ga0070681_10446038 3300005458 Bacteria 1206
39 Ga0068867_100005799 3300005459 Bacteria 8762
40 Ga0068867_100145065 3300005459 Bacteria 1859
41 Ga0070706_100005279 3300005467 Bacteria 12318
42 Ga0070707_100003943 3300005468 Bacteria 13967
43 Ga0070698_100100067 3300005471 Bacteria 2872
44 Ga0070698_100118715 3300005471 Bacteria 2606
45 Ga0070698_100202900 3300005471 Bacteria 1918
46 Ga0070699_100005060 3300005518 Bacteria 11608
47 Ga0070699_100006362 3300005518 Bacteria 10297
48 Ga0070679_100466501 3300005530 Bacteria 1207
49 Ga0070697_100022595 3300005536 Bacteria 4995
50 Ga0070697_100079789 3300005536 Bacteria 2695
51 Ga0070697_100142345 3300005536 Bacteria 2017
52 Ga0070697_100579040 3300005536 Bacteria 986
53 Ga0068853_100925740 3300005539 Bacteria 838
54 Ga0070672_100019855 3300005543 Bacteria 4889
55 Ga0070672_100029058 3300005543 Bacteria 4142
56 Ga0070695_100171943 3300005545 Bacteria 1529
57 Ga0070696_100149948 3300005546 Bacteria 1711
58 Ga0070665_100244883 3300005548 Bacteria 1793
59 Ga0070704_100059174 3300005549 Bacteria 2732
60 Ga0070704_100064794 3300005549 Bacteria 2628
61 Ga0070704_100135931 3300005549 Bacteria 1912
62 Ga0070704_100518729 3300005549 Bacteria 1037
63 Ga0070664_100445040 3300005564 Bacteria 1189
64 Ga0068857_100118714 3300005577 Bacteria 2380
65 Ga0068857_100271690 3300005577 Bacteria 1558
66 Ga0068854_100729398 3300005578 Bacteria 858
67 Ga0068856_100729836 3300005614 Bacteria 1011
68 Ga0070702_100398223 3300005615 Unclassified 984
69 Ga0068852_100884924 3300005616 Bacteria 910
70 Ga0068859_100387046 3300005617 Bacteria 1494
71 Ga0068859_101793602 3300005617 Bacteria 678
72 Ga0068866_10053962 3300005718 Bacteria 2057
73 Ga0068866_10196228 3300005718 Bacteria 1203
74 Ga0068861_100066776 3300005719 Bacteria 2774
75 Ga0068863_100223029 3300005841 Bacteria 1817
76 Ga0068860_100017160 3300005843 Bacteria 7057
77 Ga0068860_100327849 3300005843 Unclassified 1503
78 Ga0068860_101612521 3300005843 Bacteria 671
79 Ga0068862_100149908 3300005844 Bacteria 2075
80 Ga0068862_100980748 3300005844 Bacteria 835
81 Ga0081539_10000005 3300005985 Bacteria 549026
82 Ga0075368_10123478 3300006042 Bacteria 1073
83 Ga0075364_10234667 3300006051 Bacteria 1246
84 Ga0075364_10236070 3300006051 Bacteria 1242
85 Ga0075362_10163579 3300006177 Bacteria 1072
86 Ga0075362_10289510 3300006177 Bacteria 811
87 Ga0075367_10022998 3300006178 Bacteria 3502
88 Ga0075369_10064737 3300006186 Bacteria 1601
89 Ga0075366_10011581 3300006195 Bacteria 4982
90 Ga0075366_10109104 3300006195 Bacteria 1664
91 Ga0075366_10164140 3300006195 Bacteria 1346
92 Ga0097621_100391543 3300006237 Bacteria 1243
93 Ga0075428_100000743 3300006844 Bacteria 33830
94 Ga0075428_100001258 3300006844 Bacteria 27045
95 Ga0075428_100002238 3300006844 Bacteria 20951
96 Ga0075428_100029673 3300006844 Bacteria 6051
97 Ga0075430_100000742 3300006846 Bacteria 25033
98 Ga0075430_100001698 3300006846 Bacteria 17988
99 Ga0075430_100055309 3300006846 Bacteria 3337
100 Ga0075430_100306832 3300006846 Bacteria 1313
101 Ga0075431_100000276 3300006847 Bacteria 39896
102 Ga0075431_100001975 3300006847 Bacteria 19565
103 Ga0075431_100007996 3300006847 Bacteria 10550
104 Ga0075431_100023844 3300006847 Bacteria 6263
105 Ga0075431_100191886 3300006847 Bacteria 2093
106 Ga0075433_10010220 3300006852 Bacteria 7528
107 Ga0075433_10475697 3300006852 Bacteria 1101
108 Ga0075434_100005629 3300006871 Bacteria 11423
109 Ga0075434_100926848 3300006871 Bacteria 886
110 Ga0075429_100000050 3300006880 Bacteria 56375
111 Ga0075429_100012976 3300006880 Bacteria 7229
112 Ga0075429_100018082 3300006880 Bacteria 6098
113 Ga0075429_100168954 3300006880 Bacteria 1916
114 Ga0068865_100331706 3300006881 Bacteria 1227
115 Ga0068865_100518604 3300006881 Bacteria 996
116 Ga0075436_100007919 3300006914 Bacteria 7274
117 Ga0075436_100031364 3300006914 Bacteria 3660
118 Ga0097620_100387055 3300006931 Bacteria 1494
119 Ga0097620_101793569 3300006931 Bacteria 678
120 Ga0075435_100296754 3300007076 Bacteria 1382
121 Ga0099794_10003358 3300007265 Bacteria 6094
122 Ga0105240_10002864 3300009093 Bacteria 27272
123 Ga0111539_10001746 3300009094 Bacteria 28857
124 Ga0105245_10115013 3300009098 Bacteria 2506
125 Ga0105245_11041535 3300009098 Bacteria 863
126 Ga0114129_10000018 3300009147 Bacteria 125757
127 Ga0114129_10000634 3300009147 Bacteria 43805
128 Ga0114129_10000813 3300009147 Bacteria 40171
129 Ga0114129_10003537 3300009147 Bacteria 21985
130 Ga0114129_10004804 3300009147 Bacteria 19100
131 Ga0114129_10006708 3300009147 Bacteria 16345
132 Ga0114129_10008434 3300009147 Bacteria 14685
133 Ga0114129_10051604 3300009147 Bacteria 5774
134 Ga0114129_10068984 3300009147 Bacteria 4928
135 Ga0114129_10265688 3300009147 Bacteria 2297
136 Ga0114129_11067703 3300009147 Unclassified 1013
137 Ga0105243_10122872 3300009148 Bacteria 2192
138 Ga0105243_10137416 3300009148 Bacteria 2081
139 Ga0105241_10033092 3300009174 Bacteria 3880
140 Ga0105242_10209229 3300009176 Bacteria 1737
141 Ga0105242_10215794 3300009176 Bacteria 1712
142 Ga0105249_10363178 3300009553 Bacteria 1470
143 Ga0105249_10405441 3300009553 Bacteria 1394
144 Ga0105249_10980231 3300009553 Bacteria 914
145 Ga0105239_11425031 3300010375 Bacteria 800
146 Ga0105246_10083383 3300011119 Bacteria 2284
147 Ga0105246_10350951 3300011119 Bacteria 1209
148 Ga0157374_10182567 3300013296 Bacteria 2050
149 Ga0157378_10374908 3300013297 Bacteria 1396
150 Ga0163162_10041285 3300013306 Bacteria 4615
151 Ga0157375_10077393 3300013308 Bacteria 3356
152 Ga0157375_10157288 3300013308 Bacteria 2412
153 Ga0157375_10480098 3300013308 Bacteria 1408
154 Ga0163163_10879244 3300014325 Bacteria 959
155 Ga0163161_10386731 3300017792 Unclassified 1119
156 Ga0209436_114445 3300025208 Bacteria 1257
157 Ga0209565_1000992 3300025263 Bacteria 14592
158 Ga0209130_1000440 3300025284 Bacteria 44209
159 Ga0209675_1002950 3300025291 Bacteria 8390
160 Ga0209025_1033259 3300025294 Bacteria 2387
161 Ga0209758_1000089 3300025297 Bacteria 251523
162 Ga0209050_1002543 3300025298 Bacteria 15245
163 Ga0207426_1000428 3300025302 Bacteria 68777
164 Ga0207653_10087545 3300025885 Bacteria 1087
165 Ga0207642_10154086 3300025899 Bacteria 1227
166 Ga0207645_10018834 3300025907 Bacteria 4535
167 Ga0207645_10094174 3300025907 Bacteria 1928
168 Ga0207705_10337266 3300025909 Bacteria 1160
169 Ga0207684_10000816 3300025910 Bacteria 36028
170 Ga0207654_10035512 3300025911 Bacteria 2778
171 Ga0207707_10054535 3300025912 Bacteria 3480
172 Ga0207660_10083766 3300025917 Bacteria 2349
173 Ga0207662_10260748 3300025918 Bacteria 1141
174 Ga0207652_10363753 3300025921 Bacteria 1306
175 Ga0207646_10002701 3300025922 Bacteria 20801
176 Ga0207646_10281552 3300025922 Bacteria 1503
177 Ga0207681_10043176 3300025923 Bacteria 3016
178 Ga0207681_10400672 3300025923 Bacteria 1108
179 Ga0207694_10350746 3300025924 Bacteria 1221
180 Ga0207650_10117049 3300025925 Bacteria 2070
181 Ga0207659_10028443 3300025926 Bacteria 3799
182 Ga0207687_10111731 3300025927 Bacteria 2029
183 Ga0207687_10181523 3300025927 Bacteria 1631
184 Ga0207687_10671637 3300025927 Bacteria 878
185 Ga0207644_10123819 3300025931 Bacteria 1971
186 Ga0207706_10072698 3300025933 Bacteria 3024
187 Ga0207686_10259923 3300025934 Unclassified 1272
188 Ga0207686_10531757 3300025934 Bacteria 916
189 Ga0207670_10807093 3300025936 Bacteria 782
190 Ga0207669_10918749 3300025937 Bacteria 732
191 Ga0207704_10145739 3300025938 Bacteria 1663
192 Ga0207665_10326849 3300025939 Bacteria 1152
193 Ga0207691_10033120 3300025940 Bacteria 4813
194 Ga0207691_10060400 3300025940 Bacteria 3444
195 Ga0207689_10004418 3300025942 Bacteria 12761
196 Ga0207689_10021325 3300025942 Bacteria 5447
197 Ga0207689_10613782 3300025942 Bacteria 915
198 Ga0207651_10017995 3300025960 Bacteria 4192
199 Ga0207712_10246293 3300025961 Bacteria 1442
200 Ga0207668_10903789 3300025972 Bacteria 786
201 Ga0207640_10641667 3300025981 Bacteria 904
202 Ga0207658_10048906 3300025986 Bacteria 3104
203 Ga0207658_10076468 3300025986 Bacteria 2550
204 Ga0207658_10495410 3300025986 Bacteria 1088
205 Ga0207677_10203066 3300026023 Bacteria 1577
206 Ga0207703_10145720 3300026035 Bacteria 2059
207 Ga0207708_10045381 3300026075 Bacteria 3349
208 Ga0207641_10121034 3300026088 Bacteria 2336
209 Ga0207641_10235039 3300026088 Bacteria 1705
210 Ga0207641_10696347 3300026088 Bacteria 1000
211 Ga0207648_10005351 3300026089 Bacteria 12940
212 Ga0207648_10064254 3300026089 Bacteria 3199
213 Ga0207648_10071921 3300026089 Bacteria 3014
214 Ga0207648_10420569 3300026089 Bacteria 1213
215 Ga0207676_10162302 3300026095 Bacteria 1937
216 Ga0207674_10108501 3300026116 Bacteria 2752
217 Ga0207675_100002943 3300026118 Bacteria 16748
218 Ga0207675_100111112 3300026118 Bacteria 2586
219 Ga0207675_100529648 3300026118 Bacteria 1175
220 Ga0207675_101149702 3300026118 Bacteria 796
221 Ga0207683_10291225 3300026121 Bacteria 1493
222 Ga0207683_10331741 3300026121 Bacteria 1394
223 Ga0207683_10612914 3300026121 Bacteria 1008
224 Ga0207683_10710626 3300026121 Bacteria 932
225 Ga0207683_10762450 3300026121 Bacteria 898
226 Ga0207698_10840113 3300026142 Bacteria 923
227 Ga0207698_11381086 3300026142 Bacteria 719
228 Ga0207428_10012537 3300027907 Bacteria 7442
229 Ga0268265_10134833 3300028380 Bacteria 2058
230 Ga0268265_10197850 3300028380 Bacteria 1741
231 Ga0268265_10649148 3300028380 Bacteria 1014
232 Ga0268264_10025394 3300028381 Bacteria 4841
233 Ga0268264_10921956 3300028381 Bacteria 878
234 Ga0268264_11669435 3300028381 Bacteria 648
235 Ga0307517_10122551 3300028786 Bacteria 1914
236 Ga0307517_10133734 3300028786 Bacteria 1773
237 Ga0307515_10000011 3300028794 Bacteria 633903
238 Ga0307515_10000043 3300028794 Bacteria 304612
239 Ga0307515_10005346 3300028794 Bacteria 26084
240 Ga0307515_10008674 3300028794 Bacteria 19781
241 Ga0307515_10034195 3300028794 Bacteria 8334
242 Ga0307515_10316463 3300028794 Bacteria 1231
243 Ga0307513_10000034 3300031456 Bacteria 185012
244 Ga0307513_10002789 3300031456 Bacteria 23982
245 Ga0307513_10009006 3300031456 Bacteria 12664
246 Ga0307513_10029154 3300031456 Bacteria 6296
247 Ga0307513_10070848 3300031456 Bacteria 3641
248 Ga0307513_10183720 3300031456 Bacteria 1951
249 Ga0307513_10184632 3300031456 Bacteria 1944
250 Ga0307513_10267441 3300031456 Bacteria 1495
251 Ga0307509_10004612 3300031507 Bacteria 19754
252 Ga0307509_10147440 3300031507 Bacteria 2275
253 Ga0307408_100621417 3300031548 Bacteria 962
254 Ga0307508_10000004 3300031616 Bacteria 287547
255 Ga0307514_10008619 3300031649 Bacteria 8651
256 Ga0307516_10000851 3300031730 Bacteria 41827
257 Ga0307516_10003913 3300031730 Bacteria 18775
258 Ga0307516_10021101 3300031730 Bacteria 6715
259 Ga0307410_10112452 3300031852 Bacteria 1972
260 Ga0307412_10142218 3300031911 Bacteria 1759
261 Ga0307416_100003847 3300032002 Bacteria 8930
262 Ga0307416_100192766 3300032002 Bacteria 1924
263 Ga0307416_100226827 3300032002 Bacteria 1797
264 Ga0307414_10151483 3300032004 Bacteria 1830
265 Ga0307411_10027737 3300032005 Bacteria 3432
266 Ga0307507_10076797 3300033179 Bacteria 2976
267 Ga0307507_10134425 3300033179 Bacteria 1922
268 Ga0307510_10000109 3300033180 Bacteria 65353
269 Ga0307510_10010346 3300033180 Bacteria 11079
270 Ga0373940_0019391 3300035088 Bacteria 1718
271 Ga0373940_0070776 3300035088 Bacteria 1015
272 Ga0373932_0014776 3300035112 Bacteria 1969
273 Ga0373932_0131071 3300035112 Bacteria 845
274 Ga0373939_0073088 3300035114 Bacteria 1121
275 Ga0373939_0073529 3300035114 Bacteria 1119
276 Ga0373954_0422397 3300035118 Bacteria 660
277 Ga0316574_0226254 3300035398 Bacteria 1198
278 Ga0373931_0025589 3300035691 Bacteria 2997
279 Ga0373931_0449047 3300035691 Unclassified 824
280 Ga0373935_0063115 3300035692 Unclassified 2374
281 Ga0373927_0351500 3300035695 Bacteria 971
282 Ga0373937_0379967 3300036401 Bacteria 1339
283 Ga0373925_0174917 3300037068 Unclassified 1696
284 Ga0395899_0004125 3300037312 Bacteria 11431
285 Ga0395900_0013121 3300037418 Bacteria 8466
286 Ga0395900_0019948 3300037418 Bacteria 6834
287 Ga0395900_0235851 3300037418 Bacteria 1837
288 Ga0395898_0067642 3300037466 Bacteria 3458
289 Ga0395905_0704106 3300037471 Bacteria 912
290 Ga0395901_0000711 3300038443 Bacteria 38066
291 Ga0395901_0006629 3300038443 Bacteria 11698
292 Ga0395901_0077928 3300038443 Bacteria 3459
293 Ga0395901_0648356 3300038443 Bacteria 1059
294 Ga0436361_0787274 3300039447 Bacteria 6567
295 Ga0436363_1214935 3300039450 Unclassified 2020
296 Ga0436363_1494726 3300039450 Bacteria 775
297 Ga0451791_0793326 3300041451 Bacteria 1050
298 Ga0451807_2656589 3300041486 Bacteria 1515
299 Ga0439433_0042735 3300041999 Bacteria 1057
300 Ga0439437_030649 3300042000 Bacteria 675
301 Ga0439449_0003543 3300042007 Bacteria 6063
302 Ga0439449_0094475 3300042007 Bacteria 1104
303 Ga0439462_0002283 3300042015 Bacteria 4433
304 Ga0450912_006409 3300042116 Bacteria 932
305 Ga0450905_026171 3300042142 Bacteria 881
306 Ga0439434_0071965 3300042435 Bacteria 1089
307 Ga0439464_0046338 3300042439 Bacteria 1249
308 Ga0450893_0006752 3300042532 Bacteria 1859
309 Ga0451577_0123114 3300042876 Bacteria 2323
310 Ga0451577_1526164 3300042876 Bacteria 590
311 Ga0466972_0167941 3300044658 Bacteria 1030
312 Ga0466965_0014791 3300044683 Bacteria 3696
313 Ga0466965_0057247 3300044683 Bacteria 1942
314 Ga0466960_0163272 3300044901 Bacteria 1197
315 Ga0451576_0507446 3300045051 Bacteria 1267
316 Ga0451576_1324445 3300045051 Bacteria 750
317 Ga0495594_0145207 3300046499 Bacteria 1346
318 Ga0495606_0065521 3300046507 Bacteria 2308
319 Ga0495630_0094357 3300046517 Bacteria 2262
320 Ga0495663_0254243 3300046525 Bacteria 624
321 Ga0495642_0086488 3300046528 Bacteria 1324
322 Ga0495642_0091481 3300046528 Bacteria 1288
323 Ga0495654_0000847 3300046530 Bacteria 23171
324 Ga0495622_0111372 3300046557 Bacteria 1253
325 Ga0495656_0061508 3300046615 Bacteria 1640
326 Ga0495656_0085185 3300046615 Bacteria 1435
327 Ga0495668_0062656 3300046616 Bacteria 2049
328 Ga0495659_0046799 3300046664 Bacteria 1562
329 Ga0495588_0043495 3300046674 Bacteria 2299
330 Ga0495669_0019087 3300046684 Bacteria 2957
331 Ga0495669_0057241 3300046684 Bacteria 1759
332 Ga0495613_0573313 3300046689 Bacteria 753
333 Ga0495613_0853624 3300046689 Bacteria 592
334 Ga0495624_0108650 3300046690 Bacteria 1706
335 Ga0495660_0074019 3300046810 Bacteria 1800
336 Ga0495676_0033347 3300047321 Bacteria 4339
337 Ga0495687_022383 3300047443 Bacteria 3034
338 Ga0495677_0075715 3300047445 Bacteria 1258
339 Ga0495686_0171493 3300047472 Bacteria 1261
340 Ga0495593_0157048 3300047673 Bacteria 1149
341 Ga0496101_1037709 3300048904 Bacteria 644
342 Ga0496102_0007001 3300048905 Bacteria 9627
343 Ga0496102_0733119 3300048905 Bacteria 911
344 Ga0496106_0227850 3300048909 Bacteria 1487
345 Ga0496108_0144871 3300048911 Bacteria 2048
346 Ga0496110_0475161 3300048913 Bacteria 1139
347 Ga0496119_0089975 3300048922 Bacteria 1747
348 Ga0496121_0132058 3300048924 Bacteria 1867
349 Ga0496124_0307057 3300048927 Bacteria 1143
350 Ga0501031_0036342 3300049568 Bacteria 3213
351 Ga0501032_0067102 3300049569 Bacteria 2397
352 Ga0501033_0088844 3300049570 Bacteria 2261
353 Ga0501034_0000088 3300049571 Bacteria 166615
354 Ga0501040_0091440 3300049576 Bacteria 2115
355 Ga0501040_0174622 3300049576 Bacteria 1522
356 Ga0501040_0250788 3300049576 Bacteria 1262
357 Ga0501041_0142387 3300049577 Bacteria 1495
358 Ga0501042_0265637 3300049578 Bacteria 1239
359 Ga0501042_0454541 3300049578 Unclassified 929
360 Ga0501042_0710573 3300049578 Bacteria 731
361 Ga0501046_0264161 3300049580 Bacteria 1264
362 Ga0501046_0350878 3300049580 Bacteria 1071
363 Ga0501048_0283714 3300049582 Bacteria 1177
364 Ga0501068_0243922 3300049584 Bacteria 1144
365 Ga0501069_0170976 3300049585 Bacteria 1254
366 Ga0501071_0078179 3300049587 Bacteria 2418
367 Ga0501071_0163414 3300049587 Bacteria 1665
368 Ga0501072_0091813 3300049588 Bacteria 2411
369 Ga0501072_0158617 3300049588 Bacteria 1805
370 Ga0501072_0470454 3300049588 Bacteria 995
371 Ga0501074_0340249 3300049590 Bacteria 1065
372 Ga0501075_0047072 3300049591 Bacteria 3241
373 Ga0501075_0334068 3300049591 Bacteria 1155
374 Ga0501076_0019382 3300049592 Bacteria 5201
375 Ga0501076_0023154 3300049592 Bacteria 4784
376 Ga0501076_0230789 3300049592 Bacteria 1513
377 Ga0501077_0280466 3300049593 Bacteria 1061
378 Ga0501079_0058459 3300049741 Bacteria 2975
379 Ga0501079_0389060 3300049741 Bacteria 1093
380 Ga0501079_0488683 3300049741 Bacteria 968
381 Ga0501081_0110536 3300049743 Bacteria 1950
382 Ga0501081_0341156 3300049743 Bacteria 1103
383 Ga0501035_0238404 3300049822 Bacteria 1548
384 Ga0501044_0096832 3300049823 Bacteria 2972
385 Ga0501045_0116185 3300049824 Bacteria 1985
386 Ga0501045_0141953 3300049824 Bacteria 1786
387 Ga0501045_0301775 3300049824 Bacteria 1192
388 Ga0501045_0729294 3300049824 Bacteria 731
389 nmdc:mga0k408_137367_c1 3300050493 Bacteria 1453
390 nmdc:mga0k408_2566_c1 3300050493 Bacteria 9648
391 nmdc:mga0k408_9812_c1 3300050493 Bacteria 5171
392 nmdc:mga07m45_107920_c1 3300050496 Bacteria 1602
393 nmdc:mga07m45_112949_c1 3300050496 Bacteria 1566
394 nmdc:mga07m45_577_c1 3300050496 Bacteria 15597
395 nmdc:mga05p37_110334_c1 3300050507 Bacteria 3384
396 nmdc:mga05p37_117472_c1 3300050507 Bacteria 3269
397 nmdc:mga05p37_160660_c1 3300050507 Bacteria 2745
398 nmdc:mga05p37_205_c1 3300050507 Bacteria 59326
399 nmdc:mga05p37_2398_c1 3300050507 Bacteria 21799
400 nmdc:mga05p37_335337_c1 3300050507 Bacteria 1785
401 nmdc:mga05p37_409087_c1 3300050507 Bacteria 1582
402 nmdc:mga05p37_6963_c1 3300050507 Bacteria 13324
403 nmdc:mga05p37_722_c1 3300050507 Bacteria 36579
404 nmdc:mga09592_163988_c1 3300050508 Bacteria 1920
405 nmdc:mga09592_17043_c1 3300050508 Bacteria 5947
406 nmdc:mga09592_44972_c1 3300050508 Bacteria 3718
407 nmdc:mga09592_512_c1 3300050508 Bacteria 29354
408 nmdc:mga09592_69593_c1 3300050508 Bacteria 2985
409 nmdc:mga09592_8936_c1 3300050508 Bacteria 8145
410 nmdc:mga0qj67_1217_c1 3300050509 Bacteria 17909
411 nmdc:mga0qj67_180_c1 3300050509 Bacteria 43053
412 nmdc:mga0qj67_218992_c1 3300050509 Bacteria 1545
413 nmdc:mga06r32_103929_c1 3300050510 Bacteria 2789
414 nmdc:mga06r32_14912_c1 3300050510 Bacteria 7053
415 nmdc:mga06r32_17456_c1 3300050510 Bacteria 6551
416 nmdc:mga06r32_244898_c1 3300050510 Bacteria 1780
417 nmdc:mga06r32_27872_c1 3300050510 Bacteria 5282
418 nmdc:mga06r32_6691_c1 3300050510 Bacteria 10361
419 nmdc:mga06r32_762_c1 3300050510 Bacteria 22466
420 nmdc:mga08y16_1244_c2 3300050511 Bacteria 10222
421 nmdc:mga0n895_114_c1 3300050512 Bacteria 47357
422 nmdc:mga0n895_74326_c1 3300050512 Bacteria 3376
423 nmdc:mga0rr50_233039_c1 3300050513 Bacteria 1524
424 nmdc:mga0rr50_309_c1 3300050513 Bacteria 26470
425 nmdc:mga08x19_1981_c1 3300050514 Bacteria 12546
426 nmdc:mga08x19_33577_c1 3300050514 Bacteria 3238
427 nmdc:mga0a205_650_c1 3300050515 Bacteria 27612
428 nmdc:mga0a205_76724_c1 3300050515 Bacteria 1405
429 nmdc:mga0a205_787242_c1 3300050515 Bacteria 799
430 Ga0500644_0105466 3300053088 Bacteria 1077
431 Ga0500644_0134928 3300053088 Bacteria 975
432 Ga0500651_0292998 3300053093 Bacteria 935
433 Ga0500660_125280 3300053100 Bacteria 1059
434 Ga0500593_070173 3300053117 Bacteria 1521
435 Ga0500652_044257 3300053131 Bacteria 1802
436 Ga0500658_0038284 3300053134 Bacteria 1910
437 Ga0500559_0000864 3300053136 Bacteria 19467
438 Ga0500604_0248789 3300053151 Bacteria 615
439 Ga0500622_0013090 3300053156 Bacteria 4480
440 Ga0500634_0035345 3300053161 Bacteria 2722
441 Ga0500645_053447 3300053730 Bacteria 1175
442 Ga0501084_0096365 3300054114 Bacteria 2485
443 Ga0501084_0112809 3300054114 Bacteria 2284
444 Ga0500661_004312 3300055283 Bacteria 2661
445 Ga0501082_0231728 3300060353 Bacteria 1607
446 Ga0501082_0278073 3300060353 Bacteria 1457
447 Ga0530510_0030315 3300061734 Bacteria 3885
448 Ga0530510_0182598 3300061734 Bacteria 1556
449 Ga0530510_1302320 3300061734 Bacteria 557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0340249 Ga0501074_0340249_28_525 165
2 3300061734 Ga0530510_1302320 Ga0530510_1302320_12_509 165
3 3300048922 Ga0496119_0089975 Ga0496119_0089975_680_1195 171
4 3300042876 Ga0451577_1526164 Ga0451577_1526164_12_542 176
5 3300046689 Ga0495613_0853624 Ga0495613_0853624_14_544 176
6 3300053151 Ga0500604_0248789 Ga0500604_0248789_14_544 176
7 3300035398 Ga0316574_0226254 Ga0316574_0226254_83_628 178
8 3300039450 Ga0436363_1214935 Ga0436363_1214935_799_1341 178
9 3300035692 Ga0373935_0063115 Ga0373935_0063115_821_1363 179
10 3300037068 Ga0373925_0174917 Ga0373925_0174917_697_1239 179
11 3300009176 Ga0105242_10209229 Ga0105242_102092292 183
12 3300035112 Ga0373932_0131071 Ga0373932_0131071_123_674 183
13 3300035691 Ga0373931_0449047 Ga0373931_0449047_233_784 183
14 3300045051 Ga0451576_0507446 Ga0451576_0507446_654_1205 183
15 3300049824 Ga0501045_0729294 Ga0501045_0729294_167_718 183
16 3300050512 nmdc:mga0n895_74326_c1 nmdc:mga0n895_74326_c1_2815_3366 183
17 3300048911 Ga0496108_0144871 Ga0496108_0144871_965_1606 187
18 3300005336 Ga0070680_100113493 Ga0070680_1001134932 189
19 3300005445 Ga0070708_100105284 Ga0070708_1001052843 189
20 3300005458 Ga0070681_10446038 Ga0070681_104460382 189
21 3300005518 Ga0070699_100006362 Ga0070699_1000063625 189
22 3300005530 Ga0070679_100466501 Ga0070679_1004665012 189
23 3300005536 Ga0070697_100079789 Ga0070697_1000797893 189
24 3300005545 Ga0070695_100171943 Ga0070695_1001719432 189
25 3300005549 Ga0070704_100059174 Ga0070704_1000591743 189
26 3300005844 Ga0068862_100149908 Ga0068862_1001499083 189
27 3300025912 Ga0207707_10054535 Ga0207707_100545352 189
28 3300025917 Ga0207660_10083766 Ga0207660_100837662 189
29 3300025921 Ga0207652_10363753 Ga0207652_103637532 189
30 3300028380 Ga0268265_10134833 Ga0268265_101348332 189
31 3300035088 Ga0373940_0070776 Ga0373940_0070776_83_652 189
32 3300035112 Ga0373932_0014776 Ga0373932_0014776_552_1121 189
33 3300035114 Ga0373939_0073088 Ga0373939_0073088_97_666 189
34 3300048905 Ga0496102_0007001 Ga0496102_0007001_3894_4463 189
35 3300049578 Ga0501042_0710573 Ga0501042_0710573_89_658 189
36 3300049593 Ga0501077_0280466 Ga0501077_0280466_256_825 189
37 3300061734 Ga0530510_0182598 Ga0530510_0182598_481_1050 189
38 3300003203 JGI25406J46586_10009863 JGI25406J46586_100098635 190
39 3300005347 Ga0070668_100606375 Ga0070668_1006063752 190
40 3300005353 Ga0070669_100144254 Ga0070669_1001442541 190
41 3300005445 Ga0070708_100031668 Ga0070708_1000316683 190
42 3300005445 Ga0070708_100037777 Ga0070708_1000377774 190
43 3300005445 Ga0070708_100250266 Ga0070708_1002502662 190
44 3300005457 Ga0070662_100024120 Ga0070662_1000241202 190
45 3300005468 Ga0070707_100003943 Ga0070707_1000039433 190
46 3300005471 Ga0070698_100202900 Ga0070698_1002029003 190
47 3300005518 Ga0070699_100005060 Ga0070699_10000506011 190
48 3300005536 Ga0070697_100022595 Ga0070697_1000225952 190
49 3300005536 Ga0070697_100142345 Ga0070697_1001423453 190
50 3300005536 Ga0070697_100579040 Ga0070697_1005790402 190
51 3300005543 Ga0070672_100019855 Ga0070672_1000198553 190
52 3300005546 Ga0070696_100149948 Ga0070696_1001499482 190
53 3300005549 Ga0070704_100518729 Ga0070704_1005187292 190
54 3300005577 Ga0068857_100271690 Ga0068857_1002716902 190
55 3300005615 Ga0070702_100398223 Ga0070702_1003982231 190
56 3300005719 Ga0068861_100066776 Ga0068861_1000667762 190
57 3300005843 Ga0068860_100017160 Ga0068860_1000171602 190
58 3300005844 Ga0068862_100980748 Ga0068862_1009807481 190
59 3300005985 Ga0081539_10000005 Ga0081539_10000005116 190
60 3300006844 Ga0075428_100000743 Ga0075428_10000074315 190
61 3300006844 Ga0075428_100002238 Ga0075428_1000022383 190
62 3300006844 Ga0075428_100029673 Ga0075428_1000296735 190
63 3300006846 Ga0075430_100055309 Ga0075430_1000553093 190
64 3300006846 Ga0075430_100306832 Ga0075430_1003068322 190
65 3300006847 Ga0075431_100000276 Ga0075431_10000027623 190
66 3300006847 Ga0075431_100023844 Ga0075431_1000238446 190
67 3300006847 Ga0075431_100191886 Ga0075431_1001918862 190
68 3300006852 Ga0075433_10010220 Ga0075433_100102206 190
69 3300006852 Ga0075433_10475697 Ga0075433_104756972 190
70 3300006871 Ga0075434_100005629 Ga0075434_1000056294 190
71 3300006871 Ga0075434_100926848 Ga0075434_1009268482 190
72 3300006880 Ga0075429_100012976 Ga0075429_1000129765 190
73 3300006880 Ga0075429_100018082 Ga0075429_1000180823 190
74 3300006880 Ga0075429_100168954 Ga0075429_1001689542 190
75 3300006881 Ga0068865_100518604 Ga0068865_1005186041 190
76 3300006914 Ga0075436_100007919 Ga0075436_1000079194 190
77 3300006914 Ga0075436_100031364 Ga0075436_1000313642 190
78 3300007076 Ga0075435_100296754 Ga0075435_1002967542 190
79 3300007265 Ga0099794_10003358 Ga0099794_100033582 190
80 3300009094 Ga0111539_10001746 Ga0111539_100017463 190
81 3300009147 Ga0114129_10000018 Ga0114129_1000001887 190
82 3300009147 Ga0114129_10000634 Ga0114129_1000063440 190
83 3300009147 Ga0114129_10000813 Ga0114129_1000081323 190
84 3300009147 Ga0114129_10004804 Ga0114129_100048047 190
85 3300009147 Ga0114129_10008434 Ga0114129_1000843411 190
86 3300009147 Ga0114129_10068984 Ga0114129_100689844 190
87 3300009147 Ga0114129_10265688 Ga0114129_102656882 190
88 3300009147 Ga0114129_11067703 Ga0114129_110677032 190
89 3300009148 Ga0105243_10122872 Ga0105243_101228723 190
90 3300009174 Ga0105241_10033092 Ga0105241_100330923 190
91 3300009176 Ga0105242_10215794 Ga0105242_102157942 190
92 3300009553 Ga0105249_10363178 Ga0105249_103631782 190
93 3300009553 Ga0105249_10405441 Ga0105249_104054412 190
94 3300013297 Ga0157378_10374908 Ga0157378_103749081 190
95 3300013306 Ga0163162_10041285 Ga0163162_100412852 190
96 3300017792 Ga0163161_10386731 Ga0163161_103867312 190
97 3300025899 Ga0207642_10154086 Ga0207642_101540862 190
98 3300025910 Ga0207684_10000816 Ga0207684_1000081643 190
99 3300025911 Ga0207654_10035512 Ga0207654_100355123 190
100 3300025922 Ga0207646_10002701 Ga0207646_1000270123 190
101 3300025923 Ga0207681_10043176 Ga0207681_100431763 190
102 3300025933 Ga0207706_10072698 Ga0207706_100726982 190
103 3300025934 Ga0207686_10259923 Ga0207686_102599232 190
104 3300025939 Ga0207665_10326849 Ga0207665_103268491 190
105 3300025940 Ga0207691_10033120 Ga0207691_100331204 190
106 3300025961 Ga0207712_10246293 Ga0207712_102462932 190
107 3300026088 Ga0207641_10696347 Ga0207641_106963472 190
108 3300026089 Ga0207648_10071921 Ga0207648_100719212 190
109 3300026118 Ga0207675_101149702 Ga0207675_1011497022 190
110 3300027907 Ga0207428_10012537 Ga0207428_100125373 190
111 3300028380 Ga0268265_10649148 Ga0268265_106491482 190
112 3300031548 Ga0307408_100621417 Ga0307408_1006214172 190
113 3300031852 Ga0307410_10112452 Ga0307410_101124522 190
114 3300031911 Ga0307412_10142218 Ga0307412_101422182 190
115 3300032002 Ga0307416_100003847 Ga0307416_1000038476 190
116 3300032002 Ga0307416_100192766 Ga0307416_1001927662 190
117 3300032005 Ga0307411_10027737 Ga0307411_100277373 190
118 3300035088 Ga0373940_0019391 Ga0373940_0019391_286_858 190
119 3300037418 Ga0395900_0013121 Ga0395900_0013121_3262_3834 190
120 3300037418 Ga0395900_0019948 Ga0395900_0019948_1244_1816 190
121 3300037466 Ga0395898_0067642 Ga0395898_0067642_1886_2458 190
122 3300037471 Ga0395905_0704106 Ga0395905_0704106_204_776 190
123 3300038443 Ga0395901_0000711 Ga0395901_0000711_10933_11505 190
124 3300046499 Ga0495594_0145207 Ga0495594_0145207_389_961 190
125 3300046525 Ga0495663_0254243 Ga0495663_0254243_13_585 190
126 3300046528 Ga0495642_0091481 Ga0495642_0091481_172_744 190
127 3300046615 Ga0495656_0085185 Ga0495656_0085185_482_1054 190
128 3300046664 Ga0495659_0046799 Ga0495659_0046799_640_1212 190
129 3300046684 Ga0495669_0019087 Ga0495669_0019087_2184_2756 190
130 3300046684 Ga0495669_0057241 Ga0495669_0057241_546_1118 190
131 3300048905 Ga0496102_0733119 Ga0496102_0733119_255_827 190
132 3300048909 Ga0496106_0227850 Ga0496106_0227850_388_960 190
133 3300049576 Ga0501040_0174622 Ga0501040_0174622_387_959 190
134 3300049576 Ga0501040_0250788 Ga0501040_0250788_62_634 190
135 3300049578 Ga0501042_0265637 Ga0501042_0265637_203_775 190
136 3300049578 Ga0501042_0454541 Ga0501042_0454541_215_787 190
137 3300049580 Ga0501046_0350878 Ga0501046_0350878_71_643 190
138 3300049585 Ga0501069_0170976 Ga0501069_0170976_383_976 190
139 3300049587 Ga0501071_0078179 Ga0501071_0078179_19_591 190
140 3300049588 Ga0501072_0091813 Ga0501072_0091813_950_1522 190
141 3300049588 Ga0501072_0158617 Ga0501072_0158617_526_1098 190
142 3300049588 Ga0501072_0470454 Ga0501072_0470454_107_679 190
143 3300049591 Ga0501075_0334068 Ga0501075_0334068_412_984 190
144 3300049592 Ga0501076_0019382 Ga0501076_0019382_1521_2093 190
145 3300049741 Ga0501079_0058459 Ga0501079_0058459_1808_2380 190
146 3300049741 Ga0501079_0488683 Ga0501079_0488683_244_816 190
147 3300049743 Ga0501081_0110536 Ga0501081_0110536_954_1526 190
148 3300049743 Ga0501081_0341156 Ga0501081_0341156_484_1056 190
149 3300049824 Ga0501045_0141953 Ga0501045_0141953_629_1201 190
150 3300050507 nmdc:mga05p37_117472_c1 nmdc:mga05p37_117472_c1_254_826 190
151 3300050507 nmdc:mga05p37_160660_c1 nmdc:mga05p37_160660_c1_909_1481 190
152 3300050507 nmdc:mga05p37_205_c1 nmdc:mga05p37_205_c1_58122_58694 190
153 3300050507 nmdc:mga05p37_335337_c1 nmdc:mga05p37_335337_c1_99_671 190
154 3300050507 nmdc:mga05p37_6963_c1 nmdc:mga05p37_6963_c1_6047_6619 190
155 3300050507 nmdc:mga05p37_722_c1 nmdc:mga05p37_722_c1_8238_8810 190
156 3300050508 nmdc:mga09592_163988_c1 nmdc:mga09592_163988_c1_460_1032 190
157 3300050508 nmdc:mga09592_17043_c1 nmdc:mga09592_17043_c1_3056_3628 190
158 3300050508 nmdc:mga09592_44972_c1 nmdc:mga09592_44972_c1_1331_1903 190
159 3300050508 nmdc:mga09592_69593_c1 nmdc:mga09592_69593_c1_1156_1728 190
160 3300050508 nmdc:mga09592_8936_c1 nmdc:mga09592_8936_c1_2244_2816 190
161 3300050509 nmdc:mga0qj67_218992_c1 nmdc:mga0qj67_218992_c1_438_1010 190
162 3300050510 nmdc:mga06r32_103929_c1 nmdc:mga06r32_103929_c1_1273_1845 190
163 3300050510 nmdc:mga06r32_14912_c1 nmdc:mga06r32_14912_c1_4281_4853 190
164 3300050510 nmdc:mga06r32_244898_c1 nmdc:mga06r32_244898_c1_394_966 190
165 3300050510 nmdc:mga06r32_27872_c1 nmdc:mga06r32_27872_c1_2137_2709 190
166 3300050510 nmdc:mga06r32_6691_c1 nmdc:mga06r32_6691_c1_8541_9113 190
167 3300050511 nmdc:mga08y16_1244_c2 nmdc:mga08y16_1244_c2_8580_9152 190
168 3300050512 nmdc:mga0n895_114_c1 nmdc:mga0n895_114_c1_20087_20659 190
169 3300050513 nmdc:mga0rr50_233039_c1 nmdc:mga0rr50_233039_c1_393_965 190
170 3300050513 nmdc:mga0rr50_309_c1 nmdc:mga0rr50_309_c1_18581_19153 190
171 3300050514 nmdc:mga08x19_1981_c1 nmdc:mga08x19_1981_c1_2841_3413 190
172 3300050514 nmdc:mga08x19_33577_c1 nmdc:mga08x19_33577_c1_1158_1730 190
173 3300050515 nmdc:mga0a205_650_c1 nmdc:mga0a205_650_c1_8460_9032 190
174 3300050515 nmdc:mga0a205_76724_c1 nmdc:mga0a205_76724_c1_662_1234 190
175 3300050515 nmdc:mga0a205_787242_c1 nmdc:mga0a205_787242_c1_155_727 190
176 3300054114 Ga0501084_0096365 Ga0501084_0096365_711_1283 190
177 3300060353 Ga0501082_0231728 Ga0501082_0231728_1008_1580 190
178 iso_pu_bacteria 2511231002 2511243326 190
179 iso_pu_bacteria 2643221609 2644060180 190
180 iso_pu_bacteria 2643221611 2644072830 190
181 iso_pu_bacteria 2738543012 2739245768 190
182 iso_pu_bacteria 2816332133 2816470328 190
183 iso_pu_bacteria 2894023352 2894026757 190
184 iso_pu_bacteria 2919704043 2919705876 190
185 3300005549 Ga0070704_100135931 Ga0070704_1001359312 191
186 3300005614 Ga0068856_100729836 Ga0068856_1007298362 191
187 3300005718 Ga0068866_10053962 Ga0068866_100539623 191
188 3300006844 Ga0075428_100001258 Ga0075428_10000125814 191
189 3300006846 Ga0075430_100000742 Ga0075430_10000074211 191
190 3300006846 Ga0075430_100001698 Ga0075430_1000016983 191
191 3300006847 Ga0075431_100001975 Ga0075431_10000197515 191
192 3300006847 Ga0075431_100007996 Ga0075431_1000079965 191
193 3300006880 Ga0075429_100000050 Ga0075429_10000005015 191
194 3300009147 Ga0114129_10003537 Ga0114129_100035379 191
195 3300009147 Ga0114129_10006708 Ga0114129_1000670810 191
196 3300014325 Ga0163163_10879244 Ga0163163_108792442 191
197 3300025918 Ga0207662_10260748 Ga0207662_102607481 191
198 3300025934 Ga0207686_10531757 Ga0207686_105317572 191
199 3300025942 Ga0207689_10613782 Ga0207689_106137821 191
200 3300026075 Ga0207708_10045381 Ga0207708_100453813 191
201 3300042876 Ga0451577_0123114 Ga0451577_0123114_762_1340 191
202 3300045051 Ga0451576_1324445 Ga0451576_1324445_117_695 191
203 3300050507 nmdc:mga05p37_110334_c1 nmdc:mga05p37_110334_c1_143_718 191
204 3300050507 nmdc:mga05p37_2398_c1 nmdc:mga05p37_2398_c1_5933_6511 191
205 3300050508 nmdc:mga09592_512_c1 nmdc:mga09592_512_c1_7150_7728 191
206 3300050509 nmdc:mga0qj67_1217_c1 nmdc:mga0qj67_1217_c1_12904_13479 191
207 3300050509 nmdc:mga0qj67_180_c1 nmdc:mga0qj67_180_c1_32737_33315 191
208 3300050510 nmdc:mga06r32_17456_c1 nmdc:mga06r32_17456_c1_3192_3767 191
209 3300050510 nmdc:mga06r32_762_c1 nmdc:mga06r32_762_c1_11670_12248 191
210 3300005347 Ga0070668_100527279 Ga0070668_1005272792 192
211 3300005353 Ga0070669_100480865 Ga0070669_1004808652 192
212 3300005367 Ga0070667_100689809 Ga0070667_1006898092 192
213 3300005441 Ga0070700_100167732 Ga0070700_1001677322 192
214 3300005455 Ga0070663_101189771 Ga0070663_1011897711 192
215 3300005471 Ga0070698_100100067 Ga0070698_1001000671 192
216 3300005549 Ga0070704_100064794 Ga0070704_1000647943 192
217 3300005843 Ga0068860_100327849 Ga0068860_1003278492 192
218 3300006186 Ga0075369_10064737 Ga0075369_100647372 192
219 3300009093 Ga0105240_10002864 Ga0105240_1000286413 192
220 3300009147 Ga0114129_10051604 Ga0114129_100516044 192
221 3300025885 Ga0207653_10087545 Ga0207653_100875451 192
222 3300025942 Ga0207689_10004418 Ga0207689_100044183 192
223 3300025986 Ga0207658_10048906 Ga0207658_100489061 192
224 3300026118 Ga0207675_100002943 Ga0207675_1000029437 192
225 3300026121 Ga0207683_10762450 Ga0207683_107624502 192
226 3300028381 Ga0268264_10025394 Ga0268264_100253942 192
227 3300028794 Ga0307515_10000043 Ga0307515_1000004312 192
228 3300049592 Ga0501076_0230789 Ga0501076_0230789_229_858 192
229 3300050507 nmdc:mga05p37_409087_c1 nmdc:mga05p37_409087_c1_702_1280 192
230 3300002774 JGI25150J39212_1009532 JGI25150J39212_10095322 194
231 3300002987 JGI25159J45721_1000497 JGI25159J45721_10004978 194
232 3300003215 JGI25153J46596_10001000 JGI25153J46596_1000100010 194
233 3300003354 JGI25160J50197_1000228 JGI25160J50197_10002289 194
234 3300003374 JGI25161J50226_1000171 JGI25161J50226_10001719 194
235 3300003773 Ga0055537_1009517 Ga0055537_10095172 194
236 3300003791 Ga0055530_10021200 Ga0055530_100212002 194
237 3300004625 Ga0055543_1001492 Ga0055543_10014922 194
238 3300005328 Ga0070676_10007641 Ga0070676_100076414 194
239 3300005328 Ga0070676_10097049 Ga0070676_100970492 194
240 3300005330 Ga0070690_100415629 Ga0070690_1004156291 194
241 3300005331 Ga0070670_100067427 Ga0070670_1000674273 194
242 3300005334 Ga0068869_100040889 Ga0068869_1000408894 194
243 3300005338 Ga0068868_100494040 Ga0068868_1004940402 194
244 3300005340 Ga0070689_100064458 Ga0070689_1000644584 194
245 3300005353 Ga0070669_100177880 Ga0070669_1001778803 194
246 3300005353 Ga0070669_100222260 Ga0070669_1002222601 194
247 3300005354 Ga0070675_100021795 Ga0070675_1000217955 194
248 3300005355 Ga0070671_100055325 Ga0070671_1000553253 194
249 3300005355 Ga0070671_100078110 Ga0070671_1000781103 194
250 3300005364 Ga0070673_100661918 Ga0070673_1006619182 194
251 3300005367 Ga0070667_100009522 Ga0070667_1000095223 194
252 3300005456 Ga0070678_100254496 Ga0070678_1002544962 194
253 3300005459 Ga0068867_100005799 Ga0068867_1000057992 194
254 3300005459 Ga0068867_100145065 Ga0068867_1001450652 194
255 3300005467 Ga0070706_100005279 Ga0070706_1000052796 194
256 3300005471 Ga0070698_100118715 Ga0070698_1001187152 194
257 3300005539 Ga0068853_100925740 Ga0068853_1009257401 194
258 3300005543 Ga0070672_100029058 Ga0070672_1000290584 194
259 3300005548 Ga0070665_100244883 Ga0070665_1002448832 194
260 3300005564 Ga0070664_100445040 Ga0070664_1004450401 194
261 3300005577 Ga0068857_100118714 Ga0068857_1001187142 194
262 3300005578 Ga0068854_100729398 Ga0068854_1007293982 194
263 3300005616 Ga0068852_100884924 Ga0068852_1008849241 194
264 3300005617 Ga0068859_100387046 Ga0068859_1003870462 194
265 3300005617 Ga0068859_101793602 Ga0068859_1017936021 194
266 3300005718 Ga0068866_10196228 Ga0068866_101962282 194
267 3300005841 Ga0068863_100223029 Ga0068863_1002230292 194
268 3300005843 Ga0068860_101612521 Ga0068860_1016125211 194
269 3300006042 Ga0075368_10123478 Ga0075368_101234782 194
270 3300006051 Ga0075364_10234667 Ga0075364_102346671 194
271 3300006051 Ga0075364_10236070 Ga0075364_102360702 194
272 3300006177 Ga0075362_10163579 Ga0075362_101635792 194
273 3300006177 Ga0075362_10289510 Ga0075362_102895102 194
274 3300006178 Ga0075367_10022998 Ga0075367_100229983 194
275 3300006195 Ga0075366_10011581 Ga0075366_100115812 194
276 3300006195 Ga0075366_10109104 Ga0075366_101091043 194
277 3300006195 Ga0075366_10164140 Ga0075366_101641402 194
278 3300006237 Ga0097621_100391543 Ga0097621_1003915431 194
279 3300006881 Ga0068865_100331706 Ga0068865_1003317062 194
280 3300006931 Ga0097620_100387055 Ga0097620_1003870552 194
281 3300006931 Ga0097620_101793569 Ga0097620_1017935691 194
282 3300009098 Ga0105245_10115013 Ga0105245_101150133 194
283 3300009098 Ga0105245_11041535 Ga0105245_110415351 194
284 3300009148 Ga0105243_10137416 Ga0105243_101374162 194
285 3300009553 Ga0105249_10980231 Ga0105249_109802311 194
286 3300010375 Ga0105239_11425031 Ga0105239_114250312 194
287 3300011119 Ga0105246_10083383 Ga0105246_100833833 194
288 3300011119 Ga0105246_10350951 Ga0105246_103509512 194
289 3300013296 Ga0157374_10182567 Ga0157374_101825672 194
290 3300013308 Ga0157375_10077393 Ga0157375_100773934 194
291 3300013308 Ga0157375_10157288 Ga0157375_101572883 194
292 3300013308 Ga0157375_10480098 Ga0157375_104800982 194
293 3300025208 Ga0209436_114445 Ga0209436_1144451 194
294 3300025263 Ga0209565_1000992 Ga0209565_10009929 194
295 3300025284 Ga0209130_1000440 Ga0209130_10004409 194
296 3300025291 Ga0209675_1002950 Ga0209675_10029502 194
297 3300025294 Ga0209025_1033259 Ga0209025_10332593 194
298 3300025297 Ga0209758_1000089 Ga0209758_10000899 194
299 3300025298 Ga0209050_1002543 Ga0209050_10025438 194
300 3300025302 Ga0207426_1000428 Ga0207426_10004289 194
301 3300025907 Ga0207645_10018834 Ga0207645_100188344 194
302 3300025907 Ga0207645_10094174 Ga0207645_100941742 194
303 3300025909 Ga0207705_10337266 Ga0207705_103372662 194
304 3300025922 Ga0207646_10281552 Ga0207646_102815522 194
305 3300025923 Ga0207681_10400672 Ga0207681_104006722 194
306 3300025924 Ga0207694_10350746 Ga0207694_103507461 194
307 3300025925 Ga0207650_10117049 Ga0207650_101170492 194
308 3300025926 Ga0207659_10028443 Ga0207659_100284432 194
309 3300025927 Ga0207687_10111731 Ga0207687_101117313 194
310 3300025927 Ga0207687_10181523 Ga0207687_101815232 194
311 3300025927 Ga0207687_10671637 Ga0207687_106716372 194
312 3300025931 Ga0207644_10123819 Ga0207644_101238192 194
313 3300025936 Ga0207670_10807093 Ga0207670_108070932 194
314 3300025937 Ga0207669_10918749 Ga0207669_109187491 194
315 3300025938 Ga0207704_10145739 Ga0207704_101457392 194
316 3300025940 Ga0207691_10060400 Ga0207691_100604005 194
317 3300025942 Ga0207689_10021325 Ga0207689_100213253 194
318 3300025960 Ga0207651_10017995 Ga0207651_100179953 194
319 3300025972 Ga0207668_10903789 Ga0207668_109037891 194
320 3300025981 Ga0207640_10641667 Ga0207640_106416671 194
321 3300025986 Ga0207658_10076468 Ga0207658_100764682 194
322 3300025986 Ga0207658_10495410 Ga0207658_104954102 194
323 3300026023 Ga0207677_10203066 Ga0207677_102030662 194
324 3300026035 Ga0207703_10145720 Ga0207703_101457203 194
325 3300026088 Ga0207641_10121034 Ga0207641_101210341 194
326 3300026088 Ga0207641_10235039 Ga0207641_102350392 194
327 3300026089 Ga0207648_10005351 Ga0207648_100053512 194
328 3300026089 Ga0207648_10064254 Ga0207648_100642542 194
329 3300026089 Ga0207648_10420569 Ga0207648_104205692 194
330 3300026095 Ga0207676_10162302 Ga0207676_101623022 194
331 3300026116 Ga0207674_10108501 Ga0207674_101085013 194
332 3300026118 Ga0207675_100111112 Ga0207675_1001111123 194
333 3300026118 Ga0207675_100529648 Ga0207675_1005296482 194
334 3300026121 Ga0207683_10291225 Ga0207683_102912252 194
335 3300026121 Ga0207683_10331741 Ga0207683_103317412 194
336 3300026121 Ga0207683_10612914 Ga0207683_106129141 194
337 3300026121 Ga0207683_10710626 Ga0207683_107106262 194
338 3300026142 Ga0207698_10840113 Ga0207698_108401131 194
339 3300026142 Ga0207698_11381086 Ga0207698_113810861 194
340 3300028380 Ga0268265_10197850 Ga0268265_101978502 194
341 3300028381 Ga0268264_10921956 Ga0268264_109219562 194
342 3300028381 Ga0268264_11669435 Ga0268264_116694351 194
343 3300028786 Ga0307517_10122551 Ga0307517_101225513 194
344 3300028786 Ga0307517_10133734 Ga0307517_101337341 194
345 3300028794 Ga0307515_10000011 Ga0307515_10000011573 194
346 3300028794 Ga0307515_10005346 Ga0307515_1000534618 194
347 3300028794 Ga0307515_10008674 Ga0307515_1000867416 194
348 3300028794 Ga0307515_10034195 Ga0307515_100341959 194
349 3300028794 Ga0307515_10316463 Ga0307515_103164632 194
350 3300031456 Ga0307513_10000034 Ga0307513_10000034114 194
351 3300031456 Ga0307513_10002789 Ga0307513_1000278913 194
352 3300031456 Ga0307513_10009006 Ga0307513_100090064 194
353 3300031456 Ga0307513_10029154 Ga0307513_100291545 194
354 3300031456 Ga0307513_10070848 Ga0307513_100708484 194
355 3300031456 Ga0307513_10183720 Ga0307513_101837203 194
356 3300031456 Ga0307513_10184632 Ga0307513_101846323 194
357 3300031456 Ga0307513_10267441 Ga0307513_102674412 194
358 3300031507 Ga0307509_10004612 Ga0307509_1000461214 194
359 3300031507 Ga0307509_10147440 Ga0307509_101474402 194
360 3300031616 Ga0307508_10000004 Ga0307508_10000004168 194
361 3300031649 Ga0307514_10008619 Ga0307514_100086199 194
362 3300031730 Ga0307516_10000851 Ga0307516_100008514 194
363 3300031730 Ga0307516_10003913 Ga0307516_1000391315 194
364 3300031730 Ga0307516_10021101 Ga0307516_100211013 194
365 3300032002 Ga0307416_100226827 Ga0307416_1002268272 194
366 3300032004 Ga0307414_10151483 Ga0307414_101514832 194
367 3300033179 Ga0307507_10076797 Ga0307507_100767972 194
368 3300033179 Ga0307507_10134425 Ga0307507_101344252 194
369 3300033180 Ga0307510_10000109 Ga0307510_1000010948 194
370 3300033180 Ga0307510_10010346 Ga0307510_100103467 194
371 3300035114 Ga0373939_0073529 Ga0373939_0073529_339_923 194
372 3300035118 Ga0373954_0422397 Ga0373954_0422397_50_634 194
373 3300035691 Ga0373931_0025589 Ga0373931_0025589_1692_2276 194
374 3300035695 Ga0373927_0351500 Ga0373927_0351500_227_811 194
375 3300036401 Ga0373937_0379967 Ga0373937_0379967_58_699 194
376 3300037312 Ga0395899_0004125 Ga0395899_0004125_6188_6772 194
377 3300037418 Ga0395900_0235851 Ga0395900_0235851_118_702 194
378 3300038443 Ga0395901_0006629 Ga0395901_0006629_1196_1780 194
379 3300038443 Ga0395901_0077928 Ga0395901_0077928_1317_1901 194
380 3300038443 Ga0395901_0648356 Ga0395901_0648356_326_910 194
381 3300039447 Ga0436361_0787274 Ga0436361_0787274_278_862 194
382 3300039450 Ga0436363_1494726 Ga0436363_1494726_155_739 194
383 3300041451 Ga0451791_0793326 Ga0451791_0793326_160_744 194
384 3300041486 Ga0451807_2656589 Ga0451807_2656589_875_1459 194
385 3300041999 Ga0439433_0042735 Ga0439433_0042735_173_757 194
386 3300042000 Ga0439437_030649 Ga0439437_030649_59_643 194
387 3300042007 Ga0439449_0003543 Ga0439449_0003543_4741_5325 194
388 3300042007 Ga0439449_0094475 Ga0439449_0094475_251_835 194
389 3300042015 Ga0439462_0002283 Ga0439462_0002283_3355_3939 194
390 3300042116 Ga0450912_006409 Ga0450912_006409_90_674 194
391 3300042142 Ga0450905_026171 Ga0450905_026171_113_697 194
392 3300042435 Ga0439434_0071965 Ga0439434_0071965_459_1043 194
393 3300042439 Ga0439464_0046338 Ga0439464_0046338_144_740 194
394 3300042532 Ga0450893_0006752 Ga0450893_0006752_378_962 194
395 3300044658 Ga0466972_0167941 Ga0466972_0167941_206_790 194
396 3300044683 Ga0466965_0014791 Ga0466965_0014791_1208_1792 194
397 3300044683 Ga0466965_0057247 Ga0466965_0057247_278_862 194
398 3300044901 Ga0466960_0163272 Ga0466960_0163272_113_697 194
399 3300046507 Ga0495606_0065521 Ga0495606_0065521_1168_1752 194
400 3300046517 Ga0495630_0094357 Ga0495630_0094357_646_1266 194
401 3300046528 Ga0495642_0086488 Ga0495642_0086488_483_1067 194
402 3300046530 Ga0495654_0000847 Ga0495654_0000847_22047_22631 194
403 3300046557 Ga0495622_0111372 Ga0495622_0111372_502_1122 194
404 3300046615 Ga0495656_0061508 Ga0495656_0061508_423_1007 194
405 3300046616 Ga0495668_0062656 Ga0495668_0062656_915_1499 194
406 3300046674 Ga0495588_0043495 Ga0495588_0043495_134_718 194
407 3300046689 Ga0495613_0573313 Ga0495613_0573313_125_709 194
408 3300046690 Ga0495624_0108650 Ga0495624_0108650_461_1081 194
409 3300046810 Ga0495660_0074019 Ga0495660_0074019_886_1497 194
410 3300047321 Ga0495676_0033347 Ga0495676_0033347_2203_2823 194
411 3300047443 Ga0495687_022383 Ga0495687_022383_1513_2124 194
412 3300047445 Ga0495677_0075715 Ga0495677_0075715_610_1194 194
413 3300047472 Ga0495686_0171493 Ga0495686_0171493_658_1242 194
414 3300047673 Ga0495593_0157048 Ga0495593_0157048_200_820 194
415 3300048904 Ga0496101_1037709 Ga0496101_1037709_49_633 194
416 3300048913 Ga0496110_0475161 Ga0496110_0475161_542_1126 194
417 3300048924 Ga0496121_0132058 Ga0496121_0132058_1101_1685 194
418 3300048927 Ga0496124_0307057 Ga0496124_0307057_544_1128 194
419 3300049568 Ga0501031_0036342 Ga0501031_0036342_1195_1779 194
420 3300049569 Ga0501032_0067102 Ga0501032_0067102_1435_2022 194
421 3300049570 Ga0501033_0088844 Ga0501033_0088844_460_1044 194
422 3300049571 Ga0501034_0000088 Ga0501034_0000088_136511_137098 194
423 3300049576 Ga0501040_0091440 Ga0501040_0091440_1434_2018 194
424 3300049577 Ga0501041_0142387 Ga0501041_0142387_736_1320 194
425 3300049580 Ga0501046_0264161 Ga0501046_0264161_273_857 194
426 3300049582 Ga0501048_0283714 Ga0501048_0283714_152_736 194
427 3300049584 Ga0501068_0243922 Ga0501068_0243922_161_745 194
428 3300049587 Ga0501071_0163414 Ga0501071_0163414_461_1045 194
429 3300049591 Ga0501075_0047072 Ga0501075_0047072_481_1065 194
430 3300049592 Ga0501076_0023154 Ga0501076_0023154_3480_4064 194
431 3300049741 Ga0501079_0389060 Ga0501079_0389060_47_631 194
432 3300049822 Ga0501035_0238404 Ga0501035_0238404_929_1513 194
433 3300049823 Ga0501044_0096832 Ga0501044_0096832_111_695 194
434 3300049824 Ga0501045_0116185 Ga0501045_0116185_938_1522 194
435 3300049824 Ga0501045_0301775 Ga0501045_0301775_301_885 194
436 3300050493 nmdc:mga0k408_137367_c1 nmdc:mga0k408_137367_c1_844_1428 194
437 3300050493 nmdc:mga0k408_2566_c1 nmdc:mga0k408_2566_c1_814_1398 194
438 3300050493 nmdc:mga0k408_9812_c1 nmdc:mga0k408_9812_c1_1644_2249 194
439 3300050496 nmdc:mga07m45_107920_c1 nmdc:mga07m45_107920_c1_518_1102 194
440 3300050496 nmdc:mga07m45_112949_c1 nmdc:mga07m45_112949_c1_414_1019 194
441 3300050496 nmdc:mga07m45_577_c1 nmdc:mga07m45_577_c1_4679_5263 194
442 3300053088 Ga0500644_0105466 Ga0500644_0105466_254_838 194
443 3300053088 Ga0500644_0134928 Ga0500644_0134928_49_633 194
444 3300053093 Ga0500651_0292998 Ga0500651_0292998_143_727 194
445 3300053100 Ga0500660_125280 Ga0500660_125280_290_874 194
446 3300053117 Ga0500593_070173 Ga0500593_070173_712_1296 194
447 3300053131 Ga0500652_044257 Ga0500652_044257_576_1160 194
448 3300053134 Ga0500658_0038284 Ga0500658_0038284_190_801 194
449 3300053136 Ga0500559_0000864 Ga0500559_0000864_16292_16876 194
450 3300053156 Ga0500622_0013090 Ga0500622_0013090_2581_3165 194
451 3300053161 Ga0500634_0035345 Ga0500634_0035345_1988_2572 194
452 3300053730 Ga0500645_053447 Ga0500645_053447_486_1070 194
453 3300054114 Ga0501084_0112809 Ga0501084_0112809_758_1342 194
454 3300055283 Ga0500661_004312 Ga0500661_004312_1576_2160 194
455 3300060353 Ga0501082_0278073 Ga0501082_0278073_855_1439 194
456 3300061734 Ga0530510_0030315 Ga0530510_0030315_1614_2198 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06684

AA_synth

Amino acid synthesis

24

199

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.9635 4 170
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.9571 4 170
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.9238 1 192
4rh8-assembly3.cif.gz_C crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form 0.7487 3 37
4rh8-assembly4.cif.gz_D crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form 0.7441 3 37
ID Description Score Start End Superfamily
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9629 4 170 3.30.1330.110
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9563 4 170 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9291 3 192 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9147 3 192 3.30.1330.110
4rh8C00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.7487 3 37 3.30.160.150
ID Description Score Start End GO Terms
AF-A0A4Q5W4Q5-F1-model_v4 deleted 0.9856 1 165
AF-A0A661IP74-F1-model_v4 Amino acid synthesis family protein 0.9854 4 152
AF-A0A2V8XH66-F1-model_v4 Peptide synthetase 0.9834 1 144
AF-A0A355HAV3-F1-model_v4 Peptide synthetase 0.9808 1 178
AF-A0A5C7PMX1-F1-model_v4 Amino acid synthesis family protein 0.9747 1 181

Feature Viewer

pLDDT pTM Quality
90.54 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map