F447742

General Info

Members Datasets Scaffolds Average Seq Length
456 236 912 126

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100180139|Ga0070712_1001801392
Length 153
Sequence MQRSFGRIRRPDGGQQVRQREPRKGFTFFIMPTEFPYATHLDIRYPPLEVVDVPALIDAVRDKWYNQTLCKVNDSVVRLGVVQGEYHWHKHDDLDEFFYVVEGKFVIDLENRSVELGERQGFVVPKGIVHRTRAPERAVILMVEGAGIVPTGD

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.44
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 26.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100180139 3300006175 Bacteria 1646
2 Ga0065712_10078256 3300005290 Bacteria 3373
3 Ga0065715_10091256 3300005293 Bacteria 5953
4 Ga0065715_10579649 3300005293 Unclassified 721
5 Ga0065707_10284416 3300005295 Bacteria 1040
6 Ga0070676_10010155 3300005328 Bacteria 5103
7 Ga0070676_11042768 3300005328 Bacteria 616
8 Ga0070683_100087375 3300005329 Bacteria 2924
9 Ga0070683_100156441 3300005329 Bacteria 2162
10 Ga0070683_100214036 3300005329 Bacteria 1831
11 Ga0070690_101495459 3300005330 Unclassified 545
12 Ga0070670_100007962 3300005331 Bacteria 9014
13 Ga0070670_100776500 3300005331 Bacteria 864
14 Ga0070677_10395932 3300005333 Unclassified 727
15 Ga0068869_100000612 3300005334 Bacteria 20160
16 Ga0068869_100613761 3300005334 Unclassified 920
17 Ga0070666_10037880 3300005335 Bacteria 3208
18 Ga0070680_100044481 3300005336 Bacteria 3608
19 Ga0070680_100115965 3300005336 Unclassified 2232
20 Ga0070682_100001372 3300005337 Bacteria 13759
21 Ga0070682_100004771 3300005337 Bacteria 7537
22 Ga0070682_100009628 3300005337 Bacteria 5470
23 Ga0070682_100376569 3300005337 Bacteria 1066
24 Ga0070682_101374300 3300005337 Bacteria 603
25 Ga0068868_100009268 3300005338 Bacteria 7074
26 Ga0070689_101718626 3300005340 Unclassified 571
27 Ga0070687_100730909 3300005343 Archaea 694
28 Ga0070661_100218715 3300005344 Bacteria 1460
29 Ga0070692_10300395 3300005345 Unclassified 980
30 Ga0070668_100132704 3300005347 Unclassified 2000
31 Ga0070668_100189908 3300005347 Unclassified 1682
32 Ga0070668_100305070 3300005347 Bacteria 1336
33 Ga0070669_100006830 3300005353 Bacteria 8212
34 Ga0070669_100556634 3300005353 Bacteria 957
35 Ga0070671_100365430 3300005355 Bacteria 1232
36 Ga0070671_100851149 3300005355 Bacteria 795
37 Ga0070671_100916476 3300005355 Unclassified 766
38 Ga0070674_100000248 3300005356 Bacteria 26777
39 Ga0070674_100447106 3300005356 Unclassified 1066
40 Ga0070673_100089002 3300005364 Bacteria 2519
41 Ga0070673_100170588 3300005364 Unclassified 1857
42 Ga0070673_101722838 3300005364 Unclassified 593
43 Ga0070688_100054455 3300005365 Bacteria 2505
44 Ga0070688_100198884 3300005365 Unclassified 1401
45 Ga0070703_10069414 3300005406 Unclassified 1173
46 Ga0070703_10399389 3300005406 Bacteria 598
47 Ga0070709_11777901 3300005434 Bacteria 504
48 Ga0070713_100023490 3300005436 Bacteria 4785
49 Ga0070710_10040054 3300005437 Bacteria 2581
50 Ga0070701_10121962 3300005438 Bacteria 1470
51 Ga0070701_10239131 3300005438 Bacteria 1091
52 Ga0070711_100548130 3300005439 Bacteria 959
53 Ga0070705_100000334 3300005440 Bacteria 27607
54 Ga0070705_100037925 3300005440 Bacteria 2722
55 Ga0070705_100059306 3300005440 Bacteria 2266
56 Ga0070700_100039248 3300005441 Bacteria 2891
57 Ga0070700_100609366 3300005441 Bacteria 857
58 Ga0070700_101009021 3300005441 Unclassified 685
59 Ga0070694_100015829 3300005444 Bacteria 4745
60 Ga0070694_100256960 3300005444 Unclassified 1324
61 Ga0070694_100800229 3300005444 Bacteria 773
62 Ga0070694_101132106 3300005444 Bacteria 654
63 Ga0070708_100000138 3300005445 Bacteria 49981
64 Ga0070708_100007869 3300005445 Bacteria 8533
65 Ga0070708_100072812 3300005445 Bacteria 3096
66 Ga0070708_100382341 3300005445 Bacteria 1327
67 Ga0070708_100622932 3300005445 Bacteria 1017
68 Ga0070708_101993906 3300005445 Bacteria 537
69 Ga0070663_100104031 3300005455 Unclassified 2123
70 Ga0070678_100006191 3300005456 Bacteria 6996
71 Ga0070678_100180203 3300005456 Unclassified 1729
72 Ga0070662_100000325 3300005457 Bacteria 28539
73 Ga0070662_100691978 3300005457 Bacteria 862
74 Ga0070681_10041945 3300005458 Bacteria 4587
75 Ga0070681_10048662 3300005458 Bacteria 4236
76 Ga0070681_11004812 3300005458 Bacteria 754
77 Ga0070681_11060501 3300005458 Unclassified 731
78 Ga0070681_11257731 3300005458 Bacteria 662
79 Ga0068867_100000848 3300005459 Bacteria 20597
80 Ga0068867_100233217 3300005459 Bacteria 1489
81 Ga0070685_10020913 3300005466 Bacteria 3548
82 Ga0070706_100011380 3300005467 Bacteria 8267
83 Ga0070706_100102627 3300005467 Unclassified 2659
84 Ga0070706_100206304 3300005467 Bacteria 1835
85 Ga0070706_100278281 3300005467 Unclassified 1562
86 Ga0070706_100677874 3300005467 Bacteria 957
87 Ga0070706_101986329 3300005467 Unclassified 527
88 Ga0070707_100022864 3300005468 Bacteria 5911
89 Ga0070707_100027212 3300005468 Bacteria 5439
90 Ga0070707_100060322 3300005468 Bacteria 3638
91 Ga0070707_100362674 3300005468 Unclassified 1408
92 Ga0070707_100420703 3300005468 Bacteria 1296
93 Ga0070707_100996390 3300005468 Unclassified 803
94 Ga0070707_102115376 3300005468 Unclassified 530
95 Ga0070698_100163566 3300005471 Bacteria 2168
96 Ga0070698_100749462 3300005471 Bacteria 920
97 Ga0070699_100043957 3300005518 Bacteria 3866
98 Ga0070699_100045468 3300005518 Bacteria 3799
99 Ga0070699_100105727 3300005518 Bacteria 2469
100 Ga0070699_100194780 3300005518 Unclassified 1801
101 Ga0070699_100307215 3300005518 Bacteria 1423
102 Ga0070699_100384370 3300005518 Unclassified 1268
103 Ga0070699_100739304 3300005518 Unclassified 900
104 Ga0070699_100765472 3300005518 Unclassified 883
105 Ga0070699_100860113 3300005518 Unclassified 830
106 Ga0070679_100208772 3300005530 Bacteria 1917
107 Ga0070679_100410656 3300005530 Bacteria 1299
108 Ga0070679_101727373 3300005530 Unclassified 574
109 Ga0070684_100005835 3300005535 Bacteria 9473
110 Ga0070697_100011782 3300005536 Bacteria 6842
111 Ga0070697_100022558 3300005536 Bacteria 4999
112 Ga0070697_100035257 3300005536 Bacteria 4035
113 Ga0070697_100149335 3300005536 Bacteria 1969
114 Ga0070697_100185395 3300005536 Unclassified 1765
115 Ga0070697_100196984 3300005536 Unclassified 1711
116 Ga0070697_100216124 3300005536 Unclassified 1633
117 Ga0070697_100253135 3300005536 Unclassified 1506
118 Ga0070697_100312877 3300005536 Bacteria 1351
119 Ga0070697_100414830 3300005536 Bacteria 1170
120 Ga0070697_100505511 3300005536 Bacteria 1057
121 Ga0070697_100937852 3300005536 Bacteria 768
122 Ga0068853_100024022 3300005539 Bacteria 5108
123 Ga0070672_100628562 3300005543 Bacteria 937
124 Ga0070672_101525249 3300005543 Bacteria 599
125 Ga0070686_100125299 3300005544 Unclassified 1769
126 Ga0070686_100178061 3300005544 Unclassified 1509
127 Ga0070695_100007426 3300005545 Bacteria 6501
128 Ga0070695_100025984 3300005545 Bacteria 3620
129 Ga0070695_100164618 3300005545 Bacteria 1560
130 Ga0070695_100482941 3300005545 Bacteria 955
131 Ga0070696_100041903 3300005546 Unclassified 3165
132 Ga0070696_100305963 3300005546 Bacteria 1219
133 Ga0070696_100363375 3300005546 Bacteria 1124
134 Ga0070696_100884249 3300005546 Bacteria 740
135 Ga0070693_100023624 3300005547 Unclassified 3288
136 Ga0070693_100112174 3300005547 Bacteria 1679
137 Ga0070704_100215247 3300005549 Unclassified 1559
138 Ga0070704_100423459 3300005549 Bacteria 1141
139 Ga0070704_100876812 3300005549 Viruses 806
140 Ga0068855_100009784 3300005563 Bacteria 11565
141 Ga0068855_100012613 3300005563 Bacteria 10199
142 Ga0068855_100027578 3300005563 Bacteria 6793
143 Ga0068855_100056196 3300005563 Bacteria 4619
144 Ga0068855_100149960 3300005563 Bacteria 2651
145 Ga0070664_100005795 3300005564 Bacteria 9969
146 Ga0070664_100549090 3300005564 Bacteria 1068
147 Ga0070664_101654429 3300005564 Bacteria 607
148 Ga0068857_100048399 3300005577 Bacteria 3774
149 Ga0068857_100054643 3300005577 Bacteria 3544
150 Ga0068854_100000421 3300005578 Bacteria 26467
151 Ga0068854_100332661 3300005578 Bacteria 1238
152 Ga0068856_100346059 3300005614 Bacteria 1505
153 Ga0068856_100431970 3300005614 Bacteria 1337
154 Ga0068856_100737588 3300005614 Unclassified 1005
155 Ga0068856_101558060 3300005614 Unclassified 674
156 Ga0070702_100013531 3300005615 Bacteria 4120
157 Ga0070702_100365001 3300005615 Unclassified 1022
158 Ga0068852_100033530 3300005616 Unclassified 4265
159 Ga0068852_101492799 3300005616 Bacteria 698
160 Ga0068859_100131449 3300005617 Bacteria 2575
161 Ga0068864_100003563 3300005618 Bacteria 12869
162 Ga0068866_10000212 3300005718 Bacteria 27530
163 Ga0068866_10067019 3300005718 Unclassified 1883
164 Ga0068861_100027312 3300005719 Unclassified 4156
165 Ga0068861_100507848 3300005719 Bacteria 1091
166 Ga0068870_10005200 3300005840 Bacteria 5668
167 Ga0068870_10124848 3300005840 Unclassified 1487
168 Ga0068870_10201720 3300005840 Unclassified 1206
169 Ga0068863_100994648 3300005841 Bacteria 841
170 Ga0068858_100089233 3300005842 Bacteria 2869
171 Ga0068860_100011032 3300005843 Bacteria 8909
172 Ga0068860_100103413 3300005843 Bacteria 2719
173 Ga0068860_100295136 3300005843 Bacteria 1587
174 Ga0068860_101141971 3300005843 Unclassified 799
175 Ga0068862_100164832 3300005844 Bacteria 1980
176 Ga0068862_100188197 3300005844 Unclassified 1856
177 Ga0068862_100228509 3300005844 Bacteria 1687
178 Ga0068862_100555011 3300005844 Bacteria 1097
179 Ga0081455_10235401 3300005937 Bacteria 1349
180 Ga0075432_10510480 3300006058 Bacteria 537
181 Ga0070716_100266098 3300006173 Bacteria 1175
182 Ga0097621_100031743 3300006237 Unclassified 4192
183 Ga0068871_100048645 3300006358 Unclassified 3424
184 Ga0068871_100542049 3300006358 Bacteria 1053
185 Ga0075428_100090627 3300006844 Bacteria 3336
186 Ga0075430_101121118 3300006846 Unclassified 648
187 Ga0075431_100377684 3300006847 Bacteria 1422
188 Ga0075431_100660688 3300006847 Bacteria 1025
189 Ga0075433_10020632 3300006852 Bacteria 5514
190 Ga0075433_10065338 3300006852 Bacteria 3191
191 Ga0075434_100079885 3300006871 Unclassified 3267
192 Ga0075434_100083532 3300006871 Bacteria 3191
193 Ga0075434_101734054 3300006871 Bacteria 632
194 Ga0075429_100191414 3300006880 Bacteria 1792
195 Ga0075429_100360189 3300006880 Bacteria 1273
196 Ga0068865_100000819 3300006881 Bacteria 17531
197 Ga0068865_100122089 3300006881 Bacteria 1939
198 Ga0075436_100001641 3300006914 Bacteria 15283
199 Ga0075436_100003375 3300006914 Bacteria 10933
200 Ga0075436_100013331 3300006914 Bacteria 5631
201 Ga0075436_100434441 3300006914 Bacteria 954
202 Ga0097620_100131437 3300006931 Bacteria 2575
203 Ga0075435_100023370 3300007076 Bacteria 4781
204 Ga0075435_100056012 3300007076 Bacteria 3186
205 Ga0075435_100070340 3300007076 Bacteria 2856
206 Ga0075435_100178745 3300007076 Bacteria 1793
207 Ga0075435_100433344 3300007076 Unclassified 1133
208 Ga0075435_100600451 3300007076 Bacteria 954
209 Ga0099794_10007296 3300007265 Bacteria 4532
210 Ga0099794_10400803 3300007265 Bacteria 717
211 Ga0105240_10012060 3300009093 Bacteria 11976
212 Ga0105240_10574658 3300009093 Unclassified 1244
213 Ga0105240_11461579 3300009093 Bacteria 717
214 Ga0105245_10017257 3300009098 Bacteria 6299
215 Ga0105245_10139056 3300009098 Bacteria 2285
216 Ga0105245_11481558 3300009098 Unclassified 729
217 Ga0105247_10336913 3300009101 Unclassified 1057
218 Ga0114129_10004146 3300009147 Bacteria 20485
219 Ga0114129_10018464 3300009147 Bacteria 9934
220 Ga0114129_10358411 3300009147 Unclassified 1930
221 Ga0114129_10378001 3300009147 Bacteria 1871
222 Ga0114129_11792273 3300009147 Unclassified 747
223 Ga0105243_10000488 3300009148 Bacteria 40416
224 Ga0105243_12669287 3300009148 Bacteria 540
225 Ga0105241_10000040 3300009174 Bacteria 111228
226 Ga0105241_10002467 3300009174 Bacteria 13902
227 Ga0105241_10790786 3300009174 Unclassified 873
228 Ga0105242_10000445 3300009176 Bacteria 32941
229 Ga0105242_10277361 3300009176 Unclassified 1521
230 Ga0105242_10666036 3300009176 Unclassified 1014
231 Ga0105242_11108875 3300009176 Unclassified 806
232 Ga0105248_10006674 3300009177 Bacteria 12666
233 Ga0105248_10106760 3300009177 Bacteria 3157
234 Ga0105248_10692052 3300009177 Bacteria 1150
235 Ga0105249_10004027 3300009553 Bacteria 12680
236 Ga0105249_10012910 3300009553 Bacteria 7370
237 Ga0105249_10296237 3300009553 Bacteria 1621
238 Ga0099796_10038362 3300010159 Bacteria 1607
239 Ga0105239_10004845 3300010375 Bacteria 15921
240 Ga0105246_10020057 3300011119 Bacteria 4285
241 Ga0157373_10624552 3300013100 Unclassified 785
242 Ga0157370_10377886 3300013104 Bacteria 1305
243 Ga0157369_10807281 3300013105 Bacteria 964
244 Ga0157374_10048571 3300013296 Bacteria 3937
245 Ga0157374_10462298 3300013296 Bacteria 1271
246 Ga0157378_10004705 3300013297 Bacteria 11965
247 Ga0157378_10008240 3300013297 Bacteria 9088
248 Ga0157378_10034392 3300013297 Bacteria 4482
249 Ga0157378_10064899 3300013297 Bacteria 3267
250 Ga0157378_11117820 3300013297 Bacteria 825
251 Ga0163162_10005365 3300013306 Bacteria 12375
252 Ga0163162_10213418 3300013306 Bacteria 2060
253 Ga0163162_11160604 3300013306 Unclassified 876
254 Ga0157372_10009197 3300013307 Bacteria 10504
255 Ga0157372_10276277 3300013307 Unclassified 1953
256 Ga0157375_10026061 3300013308 Bacteria 5443
257 Ga0157375_10202252 3300013308 Bacteria 2142
258 Ga0157375_10514694 3300013308 Bacteria 1360
259 Ga0157375_13028934 3300013308 Bacteria 561
260 Ga0157380_10101131 3300014326 Unclassified 2401
261 Ga0157380_10307416 3300014326 Bacteria 1463
262 Ga0157377_10213780 3300014745 Unclassified 1231
263 Ga0157379_10006100 3300014968 Bacteria 10379
264 Ga0157379_10163433 3300014968 Bacteria 2010
265 Ga0157376_10135696 3300014969 Unclassified 2202
266 Ga0157376_12416230 3300014969 Unclassified 565
267 Ga0163161_11167485 3300017792 Bacteria 664
268 Ga0209051_1024441 3300025303 Bacteria 2484
269 Ga0207697_10189189 3300025315 Unclassified 904
270 Ga0207642_10000214 3300025899 Bacteria 17101
271 Ga0207680_10010842 3300025903 Bacteria 4578
272 Ga0207699_10562051 3300025906 Bacteria 828
273 Ga0207699_10984097 3300025906 Bacteria 623
274 Ga0207645_10002435 3300025907 Bacteria 14639
275 Ga0207645_10941568 3300025907 Bacteria 586
276 Ga0207643_10191201 3300025908 Unclassified 1243
277 Ga0207684_10012264 3300025910 Bacteria 7462
278 Ga0207684_10091860 3300025910 Unclassified 2587
279 Ga0207684_10134875 3300025910 Bacteria 2119
280 Ga0207684_10432690 3300025910 Unclassified 1130
281 Ga0207684_10465533 3300025910 Unclassified 1085
282 Ga0207654_10000060 3300025911 Bacteria 74426
283 Ga0207654_10020508 3300025911 Unclassified 3504
284 Ga0207707_10761647 3300025912 Bacteria 809
285 Ga0207695_10605967 3300025913 Unclassified 976
286 Ga0207693_10000519 3300025915 Bacteria 34790
287 Ga0207693_10292850 3300025915 Bacteria 1276
288 Ga0207660_10029273 3300025917 Bacteria 3775
289 Ga0207660_10091514 3300025917 Unclassified 2256
290 Ga0207652_10049926 3300025921 Bacteria 3583
291 Ga0207646_10026359 3300025922 Bacteria 5305
292 Ga0207646_10040663 3300025922 Bacteria 4180
293 Ga0207646_10095931 3300025922 Bacteria 2657
294 Ga0207646_10152195 3300025922 Bacteria 2086
295 Ga0207681_10009857 3300025923 Bacteria 5843
296 Ga0207681_10357241 3300025923 Unclassified 1171
297 Ga0207681_10407607 3300025923 Bacteria 1099
298 Ga0207650_10016771 3300025925 Bacteria 5122
299 Ga0207650_10608201 3300025925 Bacteria 919
300 Ga0207659_10252904 3300025926 Unclassified 1430
301 Ga0207687_10032228 3300025927 Unclassified 3548
302 Ga0207700_10000183 3300025928 Bacteria 37732
303 Ga0207644_10524467 3300025931 Bacteria 979
304 Ga0207690_11017497 3300025932 Bacteria 689
305 Ga0207706_10000116 3300025933 Bacteria 85356
306 Ga0207686_10000245 3300025934 Bacteria 41614
307 Ga0207686_10167915 3300025934 Bacteria 1545
308 Ga0207709_10004711 3300025935 Bacteria 7843
309 Ga0207669_10000414 3300025937 Bacteria 18670
310 Ga0207704_10002203 3300025938 Bacteria 8737
311 Ga0207665_10107556 3300025939 Bacteria 1956
312 Ga0207691_10473427 3300025940 Bacteria 1065
313 Ga0207711_10061675 3300025941 Bacteria 3233
314 Ga0207689_10001745 3300025942 Bacteria 20517
315 Ga0207689_10548939 3300025942 Unclassified 970
316 Ga0207689_10934291 3300025942 Bacteria 732
317 Ga0207661_10053361 3300025944 Bacteria 3235
318 Ga0207661_10128653 3300025944 Bacteria 2166
319 Ga0207667_10002390 3300025949 Bacteria 23495
320 Ga0207667_10079954 3300025949 Unclassified 3388
321 Ga0207667_10118893 3300025949 Unclassified 2724
322 Ga0207651_10182781 3300025960 Unclassified 1665
323 Ga0207712_10034145 3300025961 Bacteria 3444
324 Ga0207712_10133251 3300025961 Bacteria 1897
325 Ga0207668_10017598 3300025972 Bacteria 4482
326 Ga0207668_10421777 3300025972 Bacteria 1133
327 Ga0207640_10001361 3300025981 Bacteria 13219
328 Ga0207640_10278807 3300025981 Bacteria 1312
329 Ga0207658_11467142 3300025986 Bacteria 624
330 Ga0207703_10057550 3300026035 Bacteria 3171
331 Ga0207639_10017061 3300026041 Bacteria 5144
332 Ga0207639_10871201 3300026041 Bacteria 841
333 Ga0207678_10126973 3300026067 Unclassified 2175
334 Ga0207708_10439053 3300026075 Bacteria 1085
335 Ga0207708_10727734 3300026075 Bacteria 850
336 Ga0207708_10951353 3300026075 Unclassified 745
337 Ga0207702_10924052 3300026078 Unclassified 865
338 Ga0207648_10000030 3300026089 Bacteria 129654
339 Ga0207648_10457877 3300026089 Bacteria 1162
340 Ga0207648_10771068 3300026089 Bacteria 894
341 Ga0207648_10953152 3300026089 Bacteria 803
342 Ga0207676_10229834 3300026095 Bacteria 1657
343 Ga0207674_10007183 3300026116 Bacteria 13001
344 Ga0207675_100055858 3300026118 Unclassified 3684
345 Ga0207683_10009145 3300026121 Bacteria 8443
346 Ga0207683_11483458 3300026121 Bacteria 626
347 Ga0207698_10864015 3300026142 Unclassified 910
348 Ga0209995_1010237 3300027471 Unclassified 1519
349 Ga0209995_1018463 3300027471 Bacteria 1150
350 Ga0209968_1015536 3300027526 Bacteria 1205
351 Ga0209999_1007315 3300027543 Bacteria 1986
352 Ga0209999_1011857 3300027543 Bacteria 1578
353 Ga0209970_1035304 3300027614 Unclassified 878
354 Ga0209588_1004204 3300027671 Bacteria 4046
355 Ga0209998_10002758 3300027717 Unclassified 3965
356 Ga0207428_10529716 3300027907 Bacteria 853
357 Ga0268266_12033806 3300028379 Bacteria 548
358 Ga0268265_10155746 3300028380 Bacteria 1933
359 Ga0268265_10317411 3300028380 Bacteria 1410
360 Ga0268264_10009141 3300028381 Bacteria 8215
361 Ga0307408_100186583 3300031548 Unclassified 1668
362 Ga0307405_10791331 3300031731 Unclassified 794
363 Ga0307413_10105110 3300031824 Unclassified 1876
364 Ga0307410_10479171 3300031852 Unclassified 1020
365 Ga0307410_11058871 3300031852 Unclassified 701
366 Ga0307407_10172363 3300031903 Bacteria 1426
367 Ga0307407_10269765 3300031903 Bacteria 1174
368 Ga0307409_100097220 3300031995 Unclassified 2431
369 Ga0307416_100104358 3300032002 Bacteria 2478
370 Ga0307416_100145769 3300032002 Unclassified 2161
371 Ga0307416_100263593 3300032002 Bacteria 1686
372 Ga0307414_10202711 3300032004 Unclassified 1615
373 Ga0307411_10378581 3300032005 Bacteria 1163
374 Ga0307411_10381858 3300032005 Bacteria 1159
375 Ga0307411_11195717 3300032005 Unclassified 689
376 Ga0307415_100117890 3300032126 Bacteria 1984
377 Ga0307415_100243774 3300032126 Bacteria 1455
378 Ga0307415_100403497 3300032126 Bacteria 1168
379 Ga0307415_100669700 3300032126 Bacteria 933
380 Ga0307415_100753551 3300032126 Unclassified 884
381 Ga0373958_0023183 3300034819 Unclassified 1166
382 Ga0373941_0131373 3300035115 Unclassified 902
383 Ga0373931_0579577 3300035691 Unclassified 732
384 Ga0373927_0135566 3300035695 Bacteria 1609
385 Ga0373925_0128284 3300037068 Bacteria 1975
386 Ga0395905_0035972 3300037471 Bacteria 4650
387 Ga0242420_006967 3300038996 Bacteria 1803
388 Ga0436361_0323284 3300039447 Unclassified 681
389 Ga0439438_107092 3300041405 Bacteria 676
390 Ga0439439_0005467 3300041406 Bacteria 2901
391 Ga0439439_0039629 3300041406 Bacteria 1218
392 Ga0439433_0043155 3300041999 Bacteria 1052
393 Ga0451577_0069497 3300042876 Bacteria 3141
394 Ga0451577_0648608 3300042876 Bacteria 957
395 Ga0453683_0115100 3300044673 Bacteria 1692
396 Ga0453684_0674547 3300044712 Bacteria 1126
397 Ga0453684_1971353 3300044712 Bacteria 589
398 Ga0466957_0534977 3300044842 Bacteria 815
399 Ga0451576_0443478 3300045051 Bacteria 1362
400 Ga0451576_0628604 3300045051 Bacteria 1128
401 Ga0495603_0009766 3300046455 Bacteria 5808
402 Ga0495580_0582071 3300046472 Bacteria 741
403 Ga0495639_0273420 3300046475 Bacteria 838
404 Ga0495662_0038425 3300046476 Bacteria 2313
405 Ga0495594_0022729 3300046499 Bacteria 3355
406 Ga0495594_0846129 3300046499 Bacteria 515
407 Ga0495628_0248934 3300046516 Bacteria 1327
408 Ga0495630_0131815 3300046517 Bacteria 1898
409 Ga0495630_0316000 3300046517 Bacteria 1194
410 Ga0495652_0523471 3300046529 Unclassified 819
411 Ga0495665_0537426 3300046531 Bacteria 587
412 Ga0495640_0367770 3300046533 Unclassified 886
413 Ga0495586_0223186 3300046535 Bacteria 1071
414 Ga0495587_0341638 3300046536 Bacteria 835
415 Ga0495645_0077102 3300046543 Bacteria 2397
416 Ga0495634_0689875 3300046642 Bacteria 588
417 Ga0495611_0258221 3300046648 Unclassified 807
418 Ga0495635_0410815 3300046663 Bacteria 898
419 Ga0495659_0001505 3300046664 Bacteria 7897
420 Ga0495613_0146006 3300046689 Bacteria 1688
421 Ga0495670_0584523 3300046691 Bacteria 608
422 Ga0495636_0158410 3300047318 Unclassified 1019
423 Ga0495674_0614746 3300047319 Unclassified 860
424 Ga0495684_0262404 3300047471 Bacteria 1253
425 Ga0495602_0984835 3300048088 Unclassified 557
426 Ga0496106_0239600 3300048909 Unclassified 1449
427 Ga0496109_1662116 3300048912 Unclassified 573
428 Ga0501034_0184090 3300049571 Bacteria 2053
429 Ga0501047_0157784 3300049581 Bacteria 2142
430 Ga0501069_0608390 3300049585 Unclassified 656
431 Ga0501072_0551775 3300049588 Bacteria 910
432 Ga0501075_1220810 3300049591 Unclassified 570
433 Ga0501083_0074283 3300049744 Bacteria 2259
434 nmdc:mga05p37_2701_c1 3300050507 Bacteria 20621
435 nmdc:mga05p37_64669_c1 3300050507 Bacteria 4501
436 nmdc:mga05p37_925951_c1 3300050507 Bacteria 936
437 nmdc:mga09592_749551_c1 3300050508 Bacteria 829
438 nmdc:mga0qj67_114980_c1 3300050509 Bacteria 2173
439 nmdc:mga06r32_754223_c1 3300050510 Bacteria 936
440 nmdc:mga06r32_797453_c1 3300050510 Bacteria 905
441 nmdc:mga0n895_10417_c1 3300050512 Bacteria 8210
442 nmdc:mga0n895_1839648_c1 3300050512 Bacteria 565
443 nmdc:mga0n895_324_c1 3300050512 Bacteria 31802
444 nmdc:mga0rr50_132629_c1 3300050513 Bacteria 1996
445 nmdc:mga0rr50_468739_c1 3300050513 Bacteria 1069
446 nmdc:mga0rr50_524979_c1 3300050513 Unclassified 1007
447 nmdc:mga0rr50_565_c1 3300050513 Bacteria 19848
448 nmdc:mga0rr50_58768_c1 3300050513 Bacteria 2883
449 nmdc:mga0rr50_754318_c1 3300050513 Bacteria 830
450 nmdc:mga08x19_11944_c1 3300050514 Bacteria 5227
451 nmdc:mga08x19_537_c1 3300050514 Bacteria 25062
452 nmdc:mga08x19_6557_c1 3300050514 Bacteria 6896
453 nmdc:mga0a205_1221248_c1 3300050515 Bacteria 599
454 nmdc:mga0a205_145_c1 3300050515 Bacteria 45664
455 nmdc:mga0a205_516766_c1 3300050515 Bacteria 1051
456 Ga0495619_0434869 3300053085 Unclassified 905
457 Ga0070712_100180139
458 Ga0065712_10078256
459 Ga0065715_10091256
460 Ga0065715_10579649
461 Ga0065707_10284416
462 Ga0070676_10010155
463 Ga0070676_11042768
464 Ga0070683_100087375
465 Ga0070683_100156441
466 Ga0070683_100214036
467 Ga0070690_101495459
468 Ga0070670_100007962
469 Ga0070670_100776500
470 Ga0070677_10395932
471 Ga0068869_100000612
472 Ga0068869_100613761
473 Ga0070666_10037880
474 Ga0070680_100044481
475 Ga0070680_100115965
476 Ga0070682_100001372
477 Ga0070682_100004771
478 Ga0070682_100009628
479 Ga0070682_100376569
480 Ga0070682_101374300
481 Ga0068868_100009268
482 Ga0070689_101718626
483 Ga0070687_100730909
484 Ga0070661_100218715
485 Ga0070692_10300395
486 Ga0070668_100132704
487 Ga0070668_100189908
488 Ga0070668_100305070
489 Ga0070669_100006830
490 Ga0070669_100556634
491 Ga0070671_100365430
492 Ga0070671_100851149
493 Ga0070671_100916476
494 Ga0070674_100000248
495 Ga0070674_100447106
496 Ga0070673_100089002
497 Ga0070673_100170588
498 Ga0070673_101722838
499 Ga0070688_100054455
500 Ga0070688_100198884
501 Ga0070703_10069414
502 Ga0070703_10399389
503 Ga0070709_11777901
504 Ga0070713_100023490
505 Ga0070710_10040054
506 Ga0070701_10121962
507 Ga0070701_10239131
508 Ga0070711_100548130
509 Ga0070705_100000334
510 Ga0070705_100037925
511 Ga0070705_100059306
512 Ga0070700_100039248
513 Ga0070700_100609366
514 Ga0070700_101009021
515 Ga0070694_100015829
516 Ga0070694_100256960
517 Ga0070694_100800229
518 Ga0070694_101132106
519 Ga0070708_100000138
520 Ga0070708_100007869
521 Ga0070708_100072812
522 Ga0070708_100382341
523 Ga0070708_100622932
524 Ga0070708_101993906
525 Ga0070663_100104031
526 Ga0070678_100006191
527 Ga0070678_100180203
528 Ga0070662_100000325
529 Ga0070662_100691978
530 Ga0070681_10041945
531 Ga0070681_10048662
532 Ga0070681_11004812
533 Ga0070681_11060501
534 Ga0070681_11257731
535 Ga0068867_100000848
536 Ga0068867_100233217
537 Ga0070685_10020913
538 Ga0070706_100011380
539 Ga0070706_100102627
540 Ga0070706_100206304
541 Ga0070706_100278281
542 Ga0070706_100677874
543 Ga0070706_101986329
544 Ga0070707_100022864
545 Ga0070707_100027212
546 Ga0070707_100060322
547 Ga0070707_100362674
548 Ga0070707_100420703
549 Ga0070707_100996390
550 Ga0070707_102115376
551 Ga0070698_100163566
552 Ga0070698_100749462
553 Ga0070699_100043957
554 Ga0070699_100045468
555 Ga0070699_100105727
556 Ga0070699_100194780
557 Ga0070699_100307215
558 Ga0070699_100384370
559 Ga0070699_100739304
560 Ga0070699_100765472
561 Ga0070699_100860113
562 Ga0070679_100208772
563 Ga0070679_100410656
564 Ga0070679_101727373
565 Ga0070684_100005835
566 Ga0070697_100011782
567 Ga0070697_100022558
568 Ga0070697_100035257
569 Ga0070697_100149335
570 Ga0070697_100185395
571 Ga0070697_100196984
572 Ga0070697_100216124
573 Ga0070697_100253135
574 Ga0070697_100312877
575 Ga0070697_100414830
576 Ga0070697_100505511
577 Ga0070697_100937852
578 Ga0068853_100024022
579 Ga0070672_100628562
580 Ga0070672_101525249
581 Ga0070686_100125299
582 Ga0070686_100178061
583 Ga0070695_100007426
584 Ga0070695_100025984
585 Ga0070695_100164618
586 Ga0070695_100482941
587 Ga0070696_100041903
588 Ga0070696_100305963
589 Ga0070696_100363375
590 Ga0070696_100884249
591 Ga0070693_100023624
592 Ga0070693_100112174
593 Ga0070704_100215247
594 Ga0070704_100423459
595 Ga0070704_100876812
596 Ga0068855_100009784
597 Ga0068855_100012613
598 Ga0068855_100027578
599 Ga0068855_100056196
600 Ga0068855_100149960
601 Ga0070664_100005795
602 Ga0070664_100549090
603 Ga0070664_101654429
604 Ga0068857_100048399
605 Ga0068857_100054643
606 Ga0068854_100000421
607 Ga0068854_100332661
608 Ga0068856_100346059
609 Ga0068856_100431970
610 Ga0068856_100737588
611 Ga0068856_101558060
612 Ga0070702_100013531
613 Ga0070702_100365001
614 Ga0068852_100033530
615 Ga0068852_101492799
616 Ga0068859_100131449
617 Ga0068864_100003563
618 Ga0068866_10000212
619 Ga0068866_10067019
620 Ga0068861_100027312
621 Ga0068861_100507848
622 Ga0068870_10005200
623 Ga0068870_10124848
624 Ga0068870_10201720
625 Ga0068863_100994648
626 Ga0068858_100089233
627 Ga0068860_100011032
628 Ga0068860_100103413
629 Ga0068860_100295136
630 Ga0068860_101141971
631 Ga0068862_100164832
632 Ga0068862_100188197
633 Ga0068862_100228509
634 Ga0068862_100555011
635 Ga0081455_10235401
636 Ga0075432_10510480
637 Ga0070716_100266098
638 Ga0097621_100031743
639 Ga0068871_100048645
640 Ga0068871_100542049
641 Ga0075428_100090627
642 Ga0075430_101121118
643 Ga0075431_100377684
644 Ga0075431_100660688
645 Ga0075433_10020632
646 Ga0075433_10065338
647 Ga0075434_100079885
648 Ga0075434_100083532
649 Ga0075434_101734054
650 Ga0075429_100191414
651 Ga0075429_100360189
652 Ga0068865_100000819
653 Ga0068865_100122089
654 Ga0075436_100001641
655 Ga0075436_100003375
656 Ga0075436_100013331
657 Ga0075436_100434441
658 Ga0097620_100131437
659 Ga0075435_100023370
660 Ga0075435_100056012
661 Ga0075435_100070340
662 Ga0075435_100178745
663 Ga0075435_100433344
664 Ga0075435_100600451
665 Ga0099794_10007296
666 Ga0099794_10400803
667 Ga0105240_10012060
668 Ga0105240_10574658
669 Ga0105240_11461579
670 Ga0105245_10017257
671 Ga0105245_10139056
672 Ga0105245_11481558
673 Ga0105247_10336913
674 Ga0114129_10004146
675 Ga0114129_10018464
676 Ga0114129_10358411
677 Ga0114129_10378001
678 Ga0114129_11792273
679 Ga0105243_10000488
680 Ga0105243_12669287
681 Ga0105241_10000040
682 Ga0105241_10002467
683 Ga0105241_10790786
684 Ga0105242_10000445
685 Ga0105242_10277361
686 Ga0105242_10666036
687 Ga0105242_11108875
688 Ga0105248_10006674
689 Ga0105248_10106760
690 Ga0105248_10692052
691 Ga0105249_10004027
692 Ga0105249_10012910
693 Ga0105249_10296237
694 Ga0099796_10038362
695 Ga0105239_10004845
696 Ga0105246_10020057
697 Ga0157373_10624552
698 Ga0157370_10377886
699 Ga0157369_10807281
700 Ga0157374_10048571
701 Ga0157374_10462298
702 Ga0157378_10004705
703 Ga0157378_10008240
704 Ga0157378_10034392
705 Ga0157378_10064899
706 Ga0157378_11117820
707 Ga0163162_10005365
708 Ga0163162_10213418
709 Ga0163162_11160604
710 Ga0157372_10009197
711 Ga0157372_10276277
712 Ga0157375_10026061
713 Ga0157375_10202252
714 Ga0157375_10514694
715 Ga0157375_13028934
716 Ga0157380_10101131
717 Ga0157380_10307416
718 Ga0157377_10213780
719 Ga0157379_10006100
720 Ga0157379_10163433
721 Ga0157376_10135696
722 Ga0157376_12416230
723 Ga0163161_11167485
724 Ga0209051_1024441
725 Ga0207697_10189189
726 Ga0207642_10000214
727 Ga0207680_10010842
728 Ga0207699_10562051
729 Ga0207699_10984097
730 Ga0207645_10002435
731 Ga0207645_10941568
732 Ga0207643_10191201
733 Ga0207684_10012264
734 Ga0207684_10091860
735 Ga0207684_10134875
736 Ga0207684_10432690
737 Ga0207684_10465533
738 Ga0207654_10000060
739 Ga0207654_10020508
740 Ga0207707_10761647
741 Ga0207695_10605967
742 Ga0207693_10000519
743 Ga0207693_10292850
744 Ga0207660_10029273
745 Ga0207660_10091514
746 Ga0207652_10049926
747 Ga0207646_10026359
748 Ga0207646_10040663
749 Ga0207646_10095931
750 Ga0207646_10152195
751 Ga0207681_10009857
752 Ga0207681_10357241
753 Ga0207681_10407607
754 Ga0207650_10016771
755 Ga0207650_10608201
756 Ga0207659_10252904
757 Ga0207687_10032228
758 Ga0207700_10000183
759 Ga0207644_10524467
760 Ga0207690_11017497
761 Ga0207706_10000116
762 Ga0207686_10000245
763 Ga0207686_10167915
764 Ga0207709_10004711
765 Ga0207669_10000414
766 Ga0207704_10002203
767 Ga0207665_10107556
768 Ga0207691_10473427
769 Ga0207711_10061675
770 Ga0207689_10001745
771 Ga0207689_10548939
772 Ga0207689_10934291
773 Ga0207661_10053361
774 Ga0207661_10128653
775 Ga0207667_10002390
776 Ga0207667_10079954
777 Ga0207667_10118893
778 Ga0207651_10182781
779 Ga0207712_10034145
780 Ga0207712_10133251
781 Ga0207668_10017598
782 Ga0207668_10421777
783 Ga0207640_10001361
784 Ga0207640_10278807
785 Ga0207658_11467142
786 Ga0207703_10057550
787 Ga0207639_10017061
788 Ga0207639_10871201
789 Ga0207678_10126973
790 Ga0207708_10439053
791 Ga0207708_10727734
792 Ga0207708_10951353
793 Ga0207702_10924052
794 Ga0207648_10000030
795 Ga0207648_10457877
796 Ga0207648_10771068
797 Ga0207648_10953152
798 Ga0207676_10229834
799 Ga0207674_10007183
800 Ga0207675_100055858
801 Ga0207683_10009145
802 Ga0207683_11483458
803 Ga0207698_10864015
804 Ga0209995_1010237
805 Ga0209995_1018463
806 Ga0209968_1015536
807 Ga0209999_1007315
808 Ga0209999_1011857
809 Ga0209970_1035304
810 Ga0209588_1004204
811 Ga0209998_10002758
812 Ga0207428_10529716
813 Ga0268266_12033806
814 Ga0268265_10155746
815 Ga0268265_10317411
816 Ga0268264_10009141
817 Ga0307408_100186583
818 Ga0307405_10791331
819 Ga0307413_10105110
820 Ga0307410_10479171
821 Ga0307410_11058871
822 Ga0307407_10172363
823 Ga0307407_10269765
824 Ga0307409_100097220
825 Ga0307416_100104358
826 Ga0307416_100145769
827 Ga0307416_100263593
828 Ga0307414_10202711
829 Ga0307411_10378581
830 Ga0307411_10381858
831 Ga0307411_11195717
832 Ga0307415_100117890
833 Ga0307415_100243774
834 Ga0307415_100403497
835 Ga0307415_100669700
836 Ga0307415_100753551
837 Ga0373958_0023183
838 Ga0373941_0131373
839 Ga0373931_0579577
840 Ga0373927_0135566
841 Ga0373925_0128284
842 Ga0395905_0035972
843 Ga0242420_006967
844 Ga0436361_0323284
845 Ga0439438_107092
846 Ga0439439_0005467
847 Ga0439439_0039629
848 Ga0439433_0043155
849 Ga0451577_0069497
850 Ga0451577_0648608
851 Ga0453683_0115100
852 Ga0453684_0674547
853 Ga0453684_1971353
854 Ga0466957_0534977
855 Ga0451576_0443478
856 Ga0451576_0628604
857 Ga0495603_0009766
858 Ga0495580_0582071
859 Ga0495639_0273420
860 Ga0495662_0038425
861 Ga0495594_0022729
862 Ga0495594_0846129
863 Ga0495628_0248934
864 Ga0495630_0131815
865 Ga0495630_0316000
866 Ga0495652_0523471
867 Ga0495665_0537426
868 Ga0495640_0367770
869 Ga0495586_0223186
870 Ga0495587_0341638
871 Ga0495645_0077102
872 Ga0495634_0689875
873 Ga0495611_0258221
874 Ga0495635_0410815
875 Ga0495659_0001505
876 Ga0495613_0146006
877 Ga0495670_0584523
878 Ga0495636_0158410
879 Ga0495674_0614746
880 Ga0495684_0262404
881 Ga0495602_0984835
882 Ga0496106_0239600
883 Ga0496109_1662116
884 Ga0501034_0184090
885 Ga0501047_0157784
886 Ga0501069_0608390
887 Ga0501072_0551775
888 Ga0501075_1220810
889 Ga0501083_0074283
890 nmdc:mga05p37_2701_c1
891 nmdc:mga05p37_64669_c1
892 nmdc:mga05p37_925951_c1
893 nmdc:mga09592_749551_c1
894 nmdc:mga0qj67_114980_c1
895 nmdc:mga06r32_754223_c1
896 nmdc:mga06r32_797453_c1
897 nmdc:mga0n895_10417_c1
898 nmdc:mga0n895_1839648_c1
899 nmdc:mga0n895_324_c1
900 nmdc:mga0rr50_132629_c1
901 nmdc:mga0rr50_468739_c1
902 nmdc:mga0rr50_524979_c1
903 nmdc:mga0rr50_565_c1
904 nmdc:mga0rr50_58768_c1
905 nmdc:mga0rr50_754318_c1
906 nmdc:mga08x19_11944_c1
907 nmdc:mga08x19_537_c1
908 nmdc:mga08x19_6557_c1
909 nmdc:mga0a205_1221248_c1
910 nmdc:mga0a205_145_c1
911 nmdc:mga0a205_516766_c1
912 Ga0495619_0434869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

76

144

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9468 20 115
3dl3-assembly3.cif.gz_B crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.9216 57 113
3fe5-assembly1.cif.gz_A crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from bovine kidney 0.9107 44 115
5efu-assembly1.cif.gz_A resting state of rat cysteine dioxygenase h155q variant 0.905 44 118
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9015 36 113
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9104 44 113 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9053 44 116 2.60.120.10
af_Q5U3F8_5_287_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9051 44 115 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8996 60 110 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8963 36 113 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1V3P0U5-F1-model_v4 Cupin 0.9795 13 119
AF-A0A2V7G5G5-F1-model_v4 Cupin domain-containing protein 0.9769 5 120
AF-A0A249PQB5-F1-model_v4 deleted 0.9766 41 117
AF-A0A2B3L6T5-F1-model_v4 deleted 0.9766 41 115
AF-W7Z987-F1-model_v4 deleted 0.9757 38 115

Map