F447709

General Info

Members Datasets Scaffolds Average Seq Length
456 261 912 126

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_11481148|Ga0070666_114811482
Length 115
Sequence MTEDIKVPDAGAADKVKAVAAGVLLVGGIVAYYALSAQPAWERWAAALAWSQYGRAIWQFVLDSRIELRKVVWPTRNETGMTTLVVFGFVIIAGLFFWTLDLVLAWATKALSGQG

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
235 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
239 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
240 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
253 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
256 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 2.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 0
Rhizoplane 3.73
Rhizosphere 78.51
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_11481148 3300005335 Bacteria 508
2 JGI25406J46586_10073435 3300003203 Bacteria 1067
3 Ga0058863_10123465 3300004799 Bacteria 1104
4 Ga0058861_10005387 3300004800 Bacteria 1129
5 Ga0058861_10091813 3300004800 Bacteria 1164
6 Ga0058862_10071578 3300004803 Bacteria 1164
7 Ga0058862_10282255 3300004803 Bacteria 837
8 Ga0070683_100578361 3300005329 Bacteria 1074
9 Ga0070690_100387971 3300005330 Bacteria 1022
10 Ga0070690_100554877 3300005330 Bacteria 867
11 Ga0070670_100152760 3300005331 Bacteria 1998
12 Ga0068869_100661626 3300005334 Bacteria 888
13 Ga0070666_10370169 3300005335 Bacteria 1027
14 Ga0070680_100512656 3300005336 Bacteria 1027
15 Ga0070680_100557303 3300005336 Bacteria 982
16 Ga0070682_100509999 3300005337 Bacteria 934
17 Ga0070691_10404826 3300005341 Bacteria 770
18 Ga0070661_100533451 3300005344 Bacteria 943
19 Ga0070661_100974259 3300005344 Bacteria 703
20 Ga0070675_102034727 3300005354 Bacteria 530
21 Ga0070671_100008191 3300005355 Bacteria 8363
22 Ga0070671_100336365 3300005355 Bacteria 1287
23 Ga0070659_101227240 3300005366 Bacteria 664
24 Ga0070667_100311716 3300005367 Bacteria 1418
25 Ga0070714_101618737 3300005435 Bacteria 632
26 Ga0070713_100689747 3300005436 Bacteria 975
27 Ga0070713_102236218 3300005436 Bacteria 530
28 Ga0070710_10247492 3300005437 Bacteria 1145
29 Ga0070711_100050127 3300005439 Bacteria 2861
30 Ga0070705_100285339 3300005440 Bacteria 1176
31 Ga0070705_100608066 3300005440 Bacteria 847
32 Ga0070663_100269741 3300005455 Bacteria 1352
33 Ga0070662_100683002 3300005457 Bacteria 868
34 Ga0070662_101695902 3300005457 Bacteria 546
35 Ga0070681_10049652 3300005458 Bacteria 4189
36 Ga0070681_10050412 3300005458 Bacteria 4153
37 Ga0070681_10055586 3300005458 Bacteria 3940
38 Ga0070681_10258215 3300005458 Bacteria 1654
39 Ga0070681_10394281 3300005458 Bacteria 1295
40 Ga0070681_10772607 3300005458 Bacteria 877
41 Ga0068867_102128788 3300005459 Bacteria 532
42 Ga0070706_101558269 3300005467 Bacteria 603
43 Ga0070698_100241217 3300005471 Bacteria 1741
44 Ga0070699_100134654 3300005518 Bacteria 2179
45 Ga0070679_100098471 3300005530 Bacteria 2912
46 Ga0070679_100296648 3300005530 Bacteria 1567
47 Ga0070679_100413402 3300005530 Bacteria 1294
48 Ga0070679_101419726 3300005530 Bacteria 640
49 Ga0070679_101542633 3300005530 Bacteria 611
50 Ga0070684_100128531 3300005535 Bacteria 2284
51 Ga0068853_100379071 3300005539 Bacteria 1321
52 Ga0068853_101216086 3300005539 Bacteria 727
53 Ga0068853_101794875 3300005539 Bacteria 595
54 Ga0070686_100184813 3300005544 Bacteria 1484
55 Ga0070696_100155876 3300005546 Bacteria 1680
56 Ga0070693_100269105 3300005547 Bacteria 1137
57 Ga0070665_100017886 3300005548 Bacteria 7117
58 Ga0070665_100022199 3300005548 Bacteria 6385
59 Ga0070665_100063627 3300005548 Bacteria 3699
60 Ga0070665_100261853 3300005548 Bacteria 1730
61 Ga0068855_100087676 3300005563 Bacteria 3596
62 Ga0068855_100409216 3300005563 Bacteria 1485
63 Ga0068855_100600855 3300005563 Bacteria 1186
64 Ga0070664_100773949 3300005564 Bacteria 897
65 Ga0068854_100907614 3300005578 Bacteria 775
66 Ga0068854_101476957 3300005578 Bacteria 616
67 Ga0068856_100459196 3300005614 Bacteria 1294
68 Ga0068856_100718080 3300005614 Bacteria 1020
69 Ga0068852_101974434 3300005616 Bacteria 606
70 Ga0068859_100009017 3300005617 Bacteria 10076
71 Ga0068859_100011112 3300005617 Bacteria 9056
72 Ga0068859_101566772 3300005617 Bacteria 727
73 Ga0068864_100947697 3300005618 Bacteria 852
74 Ga0068864_101680136 3300005618 Bacteria 640
75 Ga0068861_100014692 3300005719 Bacteria 5498
76 Ga0068861_100531168 3300005719 Bacteria 1068
77 Ga0068851_10067910 3300005834 Bacteria 1839
78 Ga0068851_10567139 3300005834 Bacteria 688
79 Ga0068863_100022008 3300005841 Bacteria 6085
80 Ga0068863_101247605 3300005841 Bacteria 750
81 Ga0068858_100183097 3300005842 Bacteria 1978
82 Ga0068858_100456739 3300005842 Bacteria 1231
83 Ga0068858_100653279 3300005842 Bacteria 1022
84 Ga0068860_100006900 3300005843 Bacteria 11388
85 Ga0068860_100770596 3300005843 Bacteria 974
86 Ga0068860_101770663 3300005843 Bacteria 640
87 Ga0068862_100024248 3300005844 Bacteria 5089
88 Ga0068862_100092988 3300005844 Bacteria 2629
89 Ga0068862_100247393 3300005844 Bacteria 1624
90 Ga0068862_102544975 3300005844 Bacteria 523
91 Ga0081455_10000719 3300005937 Bacteria 42956
92 Ga0081455_10692274 3300005937 Bacteria 650
93 Ga0081539_10000011 3300005985 Bacteria 461887
94 Ga0070715_10678797 3300006163 Bacteria 613
95 Ga0070716_100037560 3300006173 Bacteria 2677
96 Ga0070716_100645929 3300006173 Bacteria 802
97 Ga0070712_100238483 3300006175 Bacteria 1448
98 Ga0097621_100406562 3300006237 Bacteria 1220
99 Ga0097621_100586554 3300006237 Bacteria 1018
100 Ga0097621_101652346 3300006237 Bacteria 609
101 Ga0075370_10378700 3300006353 Bacteria 848
102 Ga0068871_100089772 3300006358 Bacteria 2558
103 Ga0068871_100131087 3300006358 Bacteria 2126
104 Ga0097620_100009017 3300006931 Bacteria 10076
105 Ga0097620_100011113 3300006931 Bacteria 9056
106 Ga0097620_101566731 3300006931 Bacteria 727
107 Ga0075435_100116321 3300007076 Bacteria 2227
108 Ga0099795_10492853 3300007788 Bacteria 570
109 Ga0105251_10471881 3300009011 Bacteria 584
110 Ga0105240_10048107 3300009093 Bacteria 5392
111 Ga0105240_10309689 3300009093 Bacteria 1804
112 Ga0105240_10323084 3300009093 Bacteria 1758
113 Ga0105240_10444579 3300009093 Bacteria 1452
114 Ga0105240_10512896 3300009093 Bacteria 1332
115 Ga0105240_10697892 3300009093 Bacteria 1108
116 Ga0105247_10000824 3300009101 Bacteria 23626
117 Ga0105247_10262410 3300009101 Bacteria 1185
118 Ga0105247_11119668 3300009101 Bacteria 622
119 Ga0105243_12828246 3300009148 Bacteria 526
120 Ga0105241_10498547 3300009174 Bacteria 1085
121 Ga0105241_11104497 3300009174 Bacteria 747
122 Ga0105242_11835145 3300009176 Bacteria 645
123 Ga0105248_10013468 3300009177 Bacteria 9005
124 Ga0105248_10057615 3300009177 Bacteria 4362
125 Ga0105237_10536440 3300009545 Bacteria 1177
126 Ga0105237_10544912 3300009545 Bacteria 1167
127 Ga0105237_10622766 3300009545 Bacteria 1086
128 Ga0105237_10789420 3300009545 Bacteria 956
129 Ga0105237_11146980 3300009545 Bacteria 784
130 Ga0105237_11384366 3300009545 Bacteria 710
131 Ga0105237_12070525 3300009545 Bacteria 578
132 Ga0105237_12226251 3300009545 Bacteria 558
133 Ga0105238_10306274 3300009551 Bacteria 1573
134 Ga0105238_10340830 3300009551 Bacteria 1487
135 Ga0105238_10414260 3300009551 Bacteria 1341
136 Ga0105238_10498568 3300009551 Bacteria 1218
137 Ga0105238_10640875 3300009551 Bacteria 1072
138 Ga0105238_10855141 3300009551 Bacteria 927
139 Ga0105238_10869199 3300009551 Bacteria 919
140 Ga0105238_10997411 3300009551 Bacteria 858
141 Ga0105238_11043936 3300009551 Bacteria 839
142 Ga0105249_10124159 3300009553 Bacteria 2457
143 Ga0105249_10346423 3300009553 Bacteria 1504
144 Ga0105249_10760126 3300009553 Bacteria 1032
145 Ga0105246_10272727 3300011119 Bacteria 1353
146 Ga0105246_10882556 3300011119 Bacteria 800
147 Ga0105246_10925008 3300011119 Bacteria 784
148 Ga0154012_110135 3300013059 Bacteria 918
149 Ga0157370_10089215 3300013104 Bacteria 2896
150 Ga0157370_10797543 3300013104 Bacteria 859
151 Ga0157370_11870227 3300013104 Bacteria 538
152 Ga0157369_10241138 3300013105 Bacteria 1888
153 Ga0157369_10244035 3300013105 Bacteria 1876
154 Ga0157369_10322851 3300013105 Bacteria 1605
155 Ga0157369_11636655 3300013105 Bacteria 654
156 Ga0157374_10119536 3300013296 Bacteria 2541
157 Ga0157374_11302613 3300013296 Bacteria 749
158 Ga0163162_10224014 3300013306 Bacteria 2010
159 Ga0163162_10374676 3300013306 Bacteria 1557
160 Ga0163162_13142632 3300013306 Unclassified 530
161 Ga0157372_10188785 3300013307 Bacteria 2387
162 Ga0157372_10297178 3300013307 Bacteria 1878
163 Ga0157372_10394259 3300013307 Bacteria 1613
164 Ga0157372_10508799 3300013307 Bacteria 1404
165 Ga0157372_13372048 3300013307 Bacteria 508
166 Ga0163163_10058700 3300014325 Bacteria 3805
167 Ga0163163_10452079 3300014325 Bacteria 1345
168 Ga0163163_10539134 3300014325 Bacteria 1229
169 Ga0163163_10560371 3300014325 Bacteria 1205
170 Ga0157379_10045858 3300014968 Bacteria 3902
171 Ga0157379_10267395 3300014968 Bacteria 1554
172 Ga0157379_10323911 3300014968 Bacteria 1407
173 Ga0157379_10405781 3300014968 Bacteria 1253
174 Ga0157379_11136427 3300014968 Bacteria 749
175 Ga0157376_11991772 3300014969 Bacteria 618
176 Ga0157376_12792712 3300014969 Bacteria 528
177 Ga0206356_11377459 3300020070 Bacteria 872
178 Ga0206353_11936550 3300020082 Bacteria 533
179 Ga0213871_10102813 3300021441 Bacteria 838
180 Ga0224712_10248999 3300022467 Bacteria 820
181 Ga0224712_10604645 3300022467 Bacteria 535
182 Ga0207710_10000407 3300025900 Bacteria 28598
183 Ga0207710_10185538 3300025900 Bacteria 1022
184 Ga0207710_10473557 3300025900 Bacteria 648
185 Ga0207680_10111235 3300025903 Bacteria 1777
186 Ga0207647_10165286 3300025904 Bacteria 1290
187 Ga0207685_10627505 3300025905 Bacteria 579
188 Ga0207654_10128137 3300025911 Bacteria 1603
189 Ga0207707_10008546 3300025912 Bacteria 8878
190 Ga0207707_10121480 3300025912 Bacteria 2284
191 Ga0207707_10132884 3300025912 Bacteria 2176
192 Ga0207707_10184832 3300025912 Bacteria 1819
193 Ga0207707_10188175 3300025912 Bacteria 1801
194 Ga0207707_10218790 3300025912 Bacteria 1658
195 Ga0207695_10010802 3300025913 Bacteria 11132
196 Ga0207695_10105144 3300025913 Bacteria 2811
197 Ga0207695_10153161 3300025913 Bacteria 2243
198 Ga0207695_10308992 3300025913 Bacteria 1471
199 Ga0207695_10736641 3300025913 Bacteria 866
200 Ga0207695_10969048 3300025913 Bacteria 730
201 Ga0207671_10649475 3300025914 Bacteria 840
202 Ga0207671_11077024 3300025914 Bacteria 632
203 Ga0207693_10039591 3300025915 Bacteria 3712
204 Ga0207663_10726525 3300025916 Bacteria 788
205 Ga0207660_10196044 3300025917 Bacteria 1575
206 Ga0207660_10523591 3300025917 Bacteria 963
207 Ga0207660_10792341 3300025917 Bacteria 773
208 Ga0207649_10369391 3300025920 Bacteria 1066
209 Ga0207649_10759152 3300025920 Bacteria 755
210 Ga0207652_10572784 3300025921 Bacteria 1014
211 Ga0207694_10667163 3300025924 Bacteria 876
212 Ga0207694_11079250 3300025924 Bacteria 679
213 Ga0207694_11578546 3300025924 Unclassified 553
214 Ga0207664_11661258 3300025929 Bacteria 561
215 Ga0207644_10001881 3300025931 Bacteria 13675
216 Ga0207706_10481481 3300025933 Bacteria 1072
217 Ga0207665_10102351 3300025939 Bacteria 2001
218 Ga0207711_10173903 3300025941 Bacteria 1955
219 Ga0207711_11215450 3300025941 Bacteria 695
220 Ga0207661_10321401 3300025944 Bacteria 1391
221 Ga0207667_10024800 3300025949 Bacteria 6577
222 Ga0207667_10282956 3300025949 Bacteria 1694
223 Ga0207667_10431285 3300025949 Bacteria 1340
224 Ga0207667_11934655 3300025949 Bacteria 551
225 Ga0207712_10008980 3300025961 Bacteria 6321
226 Ga0207712_10047011 3300025961 Bacteria 2995
227 Ga0207712_10945617 3300025961 Bacteria 763
228 Ga0207668_10481149 3300025972 Bacteria 1065
229 Ga0207640_10678690 3300025981 Bacteria 881
230 Ga0207640_11364265 3300025981 Bacteria 634
231 Ga0207640_11368581 3300025981 Bacteria 633
232 Ga0207658_10015130 3300025986 Bacteria 5291
233 Ga0207658_10505839 3300025986 Bacteria 1076
234 Ga0207677_10256693 3300026023 Bacteria 1423
235 Ga0207703_10059888 3300026035 Bacteria 3111
236 Ga0207703_10138006 3300026035 Bacteria 2113
237 Ga0207703_10259234 3300026035 Bacteria 1571
238 Ga0207678_10288958 3300026067 Bacteria 1408
239 Ga0207678_10324093 3300026067 Bacteria 1326
240 Ga0207702_10535336 3300026078 Bacteria 1145
241 Ga0207641_10026438 3300026088 Bacteria 4789
242 Ga0207641_10058526 3300026088 Bacteria 3279
243 Ga0207641_11263675 3300026088 Bacteria 738
244 Ga0207674_10081307 3300026116 Bacteria 3242
245 Ga0207674_10086673 3300026116 Bacteria 3126
246 Ga0207674_10139672 3300026116 Bacteria 2383
247 Ga0207674_11565896 3300026116 Bacteria 628
248 Ga0207675_100093400 3300026118 Bacteria 2830
249 Ga0207675_101152192 3300026118 Bacteria 795
250 Ga0268266_10001238 3300028379 Bacteria 31222
251 Ga0268266_10005116 3300028379 Bacteria 12357
252 Ga0268266_10018657 3300028379 Bacteria 5911
253 Ga0268266_10022996 3300028379 Bacteria 5304
254 Ga0268265_10186233 3300028380 Bacteria 1788
255 Ga0268265_10519435 3300028380 Bacteria 1125
256 Ga0268265_11239526 3300028380 Bacteria 744
257 Ga0268264_10005981 3300028381 Bacteria 10303
258 Ga0268264_10590643 3300028381 Bacteria 1093
259 Ga0268264_11101476 3300028381 Bacteria 803
260 Ga0307515_10257101 3300028794 Bacteria 1489
261 Ga0307515_10318021 3300028794 Bacteria 1225
262 Ga0265338_10389026 3300028800 Bacteria 996
263 Ga0307511_10045114 3300030521 Bacteria 3649
264 Ga0265340_10059624 3300031247 Bacteria 1830
265 Ga0265340_10202185 3300031247 Bacteria 893
266 Ga0307513_10262172 3300031456 Bacteria 1517
267 Ga0307513_10769641 3300031456 Bacteria 668
268 Ga0307509_10003419 3300031507 Bacteria 24132
269 Ga0307509_10279911 3300031507 Bacteria 1430
270 Ga0307408_100754444 3300031548 Bacteria 879
271 Ga0265313_10055615 3300031595 Bacteria 1874
272 Ga0307508_10267937 3300031616 Bacteria 1302
273 Ga0307514_10514261 3300031649 Bacteria 564
274 Ga0307518_10531026 3300031838 Bacteria 592
275 Ga0307412_10023158 3300031911 Bacteria 3818
276 Ga0307416_100584216 3300032002 Bacteria 1195
277 Ga0307415_100705142 3300032126 Bacteria 911
278 Ga0307510_10000006 3300033180 Bacteria 566474
279 Ga0307510_10083945 3300033180 Bacteria 3071
280 Ga0373923_0556685 3300035111 Unclassified 562
281 Ga0373936_0233014 3300035113 Bacteria 819
282 Ga0373927_0230409 3300035695 Bacteria 1217
283 Ga0373937_0460310 3300036401 Bacteria 1208
284 Ga0373925_0264696 3300037068 Bacteria 1382
285 Ga0395900_1237997 3300037418 Bacteria 661
286 Ga0395898_0044456 3300037466 Bacteria 4371
287 Ga0395898_0342222 3300037466 Bacteria 1426
288 Ga0395905_1823119 3300037471 Bacteria 514
289 Ga0436364_1042254 3300037853 Bacteria 536
290 Ga0395901_0906815 3300038443 Bacteria 863
291 Ga0436365_1591577 3300039437 Bacteria 1831
292 Ga0436360_0872355 3300039438 Bacteria 2704
293 Ga0436360_1084608 3300039438 Bacteria 616
294 Ga0436361_0739149 3300039447 Bacteria 1251
295 Ga0436363_0226272 3300039450 Bacteria 952
296 Ga0436363_1421103 3300039450 Bacteria 1151
297 Ga0436363_1436445 3300039450 Bacteria 8017
298 Ga0436362_0220282 3300039453 Bacteria 930
299 Ga0436362_0390755 3300039453 Bacteria 730
300 Ga0439453_0063750 3300041408 Bacteria 768
301 Ga0451795_1690387 3300041456 Bacteria 646
302 Ga0451800_0320251 3300041459 Bacteria 599
303 Ga0439435_0009759 3300042436 Bacteria 2260
304 Ga0466969_0023547 3300044656 Bacteria 3172
305 Ga0466969_0238706 3300044656 Bacteria 825
306 Ga0466972_0217882 3300044658 Bacteria 893
307 Ga0466972_0239767 3300044658 Bacteria 848
308 Ga0466965_0448145 3300044683 Bacteria 718
309 Ga0466966_0001857 3300044684 Bacteria 13701
310 Ga0466961_0045918 3300044693 Bacteria 2794
311 Ga0466963_0259838 3300044694 Bacteria 1219
312 Ga0466964_0000290 3300044706 Bacteria 14731
313 Ga0466971_0001929 3300044719 Bacteria 8800
314 Ga0466968_0289526 3300044735 Bacteria 785
315 Ga0466968_0337720 3300044735 Bacteria 730
316 Ga0466970_0020368 3300044765 Bacteria 3445
317 Ga0466957_0005087 3300044842 Bacteria 7356
318 Ga0466960_0040184 3300044901 Bacteria 2210
319 Ga0466959_0003400 3300045049 Bacteria 10404
320 Ga0466959_0700735 3300045049 Bacteria 679
321 Ga0466958_0632904 3300045836 Bacteria 696
322 Ga0495583_0346055 3300046506 Bacteria 587
323 Ga0495606_0183886 3300046507 Bacteria 1203
324 Ga0495632_0037524 3300046519 Bacteria 2458
325 Ga0495632_0111343 3300046519 Bacteria 1285
326 Ga0495643_0057027 3300046522 Bacteria 2083
327 Ga0495648_0202537 3300046524 Bacteria 992
328 Ga0495625_0264857 3300046660 Bacteria 1111
329 Ga0495625_0268468 3300046660 Bacteria 1102
330 Ga0495671_0084811 3300046692 Bacteria 1552
331 Ga0495687_100629 3300047443 Bacteria 1085
332 Ga0495687_211413 3300047443 Bacteria 607
333 Ga0495686_0285135 3300047472 Bacteria 917
334 Ga0496100_0168138 3300048903 Bacteria 1577
335 Ga0496100_1126771 3300048903 Bacteria 618
336 Ga0496101_0620005 3300048904 Bacteria 855
337 Ga0496102_0055017 3300048905 Bacteria 3629
338 Ga0496102_0081226 3300048905 Bacteria 2988
339 Ga0496102_0240429 3300048905 Bacteria 1707
340 Ga0496103_0048249 3300048906 Bacteria 2631
341 Ga0496103_0069653 3300048906 Bacteria 2199
342 Ga0496104_1477862 3300048907 Bacteria 582
343 Ga0496106_0095263 3300048909 Bacteria 2302
344 Ga0496112_0024880 3300048915 Bacteria 5744
345 Ga0496112_1576631 3300048915 Bacteria 570
346 Ga0496114_0188128 3300048917 Bacteria 1805
347 Ga0496115_0636488 3300048918 Bacteria 844
348 Ga0496115_0886966 3300048918 Bacteria 688
349 Ga0496116_0001431 3300048919 Bacteria 26836
350 Ga0496117_0032967 3300048920 Bacteria 3924
351 Ga0496118_0000032 3300048921 Bacteria 330072
352 Ga0496118_0546242 3300048921 Bacteria 566
353 Ga0496119_0066727 3300048922 Bacteria 2124
354 Ga0496119_0201688 3300048922 Bacteria 1029
355 Ga0496119_0210182 3300048922 Bacteria 1001
356 Ga0496120_0078165 3300048923 Bacteria 1799
357 Ga0496120_0182367 3300048923 Bacteria 1029
358 Ga0496121_0003252 3300048924 Bacteria 23361
359 Ga0496121_0080741 3300048924 Bacteria 2576
360 Ga0496124_0005651 3300048927 Bacteria 13975
361 Ga0496125_0007994 3300048928 Bacteria 11170
362 Ga0496125_0115724 3300048928 Bacteria 1927
363 Ga0496125_0187683 3300048928 Bacteria 1369
364 Ga0496126_0007227 3300048929 Bacteria 12214
365 Ga0496126_0365098 3300048929 Bacteria 1178
366 Ga0495682_0359592 3300049460 Bacteria 513
367 Ga0501032_0127486 3300049569 Bacteria 1680
368 Ga0501033_0113701 3300049570 Bacteria 1968
369 Ga0501036_0025195 3300049572 Bacteria 5018
370 Ga0501037_0147502 3300049573 Bacteria 1682
371 Ga0501038_0012174 3300049574 Bacteria 7854
372 Ga0501039_0061796 3300049575 Bacteria 2901
373 Ga0501039_0684454 3300049575 Bacteria 802
374 Ga0501040_0014345 3300049576 Bacteria 5219
375 Ga0501041_0004395 3300049577 Bacteria 8158
376 Ga0501041_0517211 3300049577 Bacteria 760
377 Ga0501042_0038835 3300049578 Bacteria 3380
378 Ga0501043_0141421 3300049579 Bacteria 1884
379 Ga0501043_0788044 3300049579 Bacteria 688
380 Ga0501046_0009156 3300049580 Bacteria 8576
381 Ga0501046_0361120 3300049580 Bacteria 1053
382 Ga0501047_0611625 3300049581 Bacteria 911
383 Ga0501047_0825416 3300049581 Bacteria 741
384 Ga0501048_0008919 3300049582 Bacteria 7549
385 Ga0501068_0096642 3300049584 Bacteria 1827
386 Ga0501071_0006619 3300049587 Bacteria 7529
387 Ga0501072_0044373 3300049588 Bacteria 3496
388 Ga0501073_0969854 3300049589 Bacteria 585
389 Ga0501074_0222887 3300049590 Bacteria 1342
390 Ga0501075_0003291 3300049591 Bacteria 10816
391 Ga0501075_0124502 3300049591 Bacteria 1962
392 Ga0501076_0001559 3300049592 Bacteria 15350
393 Ga0501076_0818781 3300049592 Bacteria 768
394 Ga0501077_0035722 3300049593 Bacteria 3164
395 Ga0501079_0006685 3300049741 Bacteria 8674
396 Ga0501080_0020681 3300049742 Bacteria 6096
397 Ga0501080_0257551 3300049742 Bacteria 1590
398 Ga0501081_0038037 3300049743 Bacteria 3285
399 Ga0501083_0652352 3300049744 Bacteria 684
400 Ga0501035_0047800 3300049822 Bacteria 3840
401 Ga0501045_0006991 3300049824 Bacteria 7825
402 nmdc:mga0rr50_689521_c1 3300050513 Bacteria 872
403 nmdc:mga0a205_1199110_c1 3300050515 Bacteria 607
404 Ga0500644_0047346 3300053088 Bacteria 1458
405 Ga0500646_0038092 3300053090 Bacteria 1345
406 Ga0500646_0134319 3300053090 Bacteria 807
407 Ga0500646_0213451 3300053090 Bacteria 667
408 Ga0500583_0016948 3300053092 Bacteria 2921
409 Ga0500583_0071021 3300053092 Bacteria 1664
410 Ga0500583_0099731 3300053092 Bacteria 1421
411 Ga0500583_0102145 3300053092 Bacteria 1405
412 Ga0500583_0326857 3300053092 Bacteria 747
413 Ga0500651_0186419 3300053093 Bacteria 1230
414 Ga0500651_0488058 3300053093 Bacteria 681
415 Ga0500566_0220874 3300053094 Bacteria 942
416 Ga0500641_0004514 3300053096 Bacteria 4919
417 Ga0500641_0137661 3300053096 Bacteria 1054
418 Ga0500641_0240747 3300053096 Bacteria 761
419 Ga0500556_0001832 3300053104 Bacteria 7761
420 Ga0500556_0083103 3300053104 Bacteria 1213
421 Ga0500562_017519 3300053108 Bacteria 1848
422 Ga0500572_051899 3300053111 Bacteria 1224
423 Ga0500591_131156 3300053115 Bacteria 1010
424 Ga0500593_129319 3300053117 Bacteria 1011
425 Ga0500594_0198151 3300053118 Bacteria 659
426 Ga0500595_024264 3300053119 Bacteria 2119
427 Ga0500617_076098 3300053124 Bacteria 1462
428 Ga0500621_150451 3300053126 Bacteria 874
429 Ga0500623_205299 3300053127 Bacteria 721
430 Ga0500652_176818 3300053131 Bacteria 876
431 Ga0500655_025864 3300053133 Bacteria 1115
432 Ga0500658_0096929 3300053134 Bacteria 1282
433 Ga0500559_0127031 3300053136 Bacteria 1189
434 Ga0500588_0003896 3300053146 Bacteria 3193
435 Ga0500588_0408644 3300053146 Unclassified 517
436 Ga0500590_356791 3300053148 Bacteria 520
437 Ga0500604_0104956 3300053151 Bacteria 934
438 Ga0500604_0140232 3300053151 Bacteria 817
439 Ga0500616_0000499 3300053153 Bacteria 50346
440 Ga0500616_0051339 3300053153 Bacteria 2173
441 Ga0500619_312150 3300053154 Bacteria 505
442 Ga0500622_0053035 3300053156 Bacteria 2084
443 Ga0500622_0444840 3300053156 Bacteria 517
444 Ga0500627_0271136 3300053158 Bacteria 747
445 Ga0500630_280153 3300053159 Bacteria 559
446 Ga0500633_0161033 3300053160 Bacteria 842
447 Ga0500633_0301899 3300053160 Bacteria 589
448 Ga0500637_0293920 3300053178 Bacteria 889
449 Ga0500656_003559 3300053732 Bacteria 1462
450 Ga0587084_118364 3300059477 Bacteria 555
451 Ga0587093_080899 3300059478 Bacteria 560
452 Ga0587080_016553 3300059503 Bacteria 1165
453 Ga0501082_0000933 3300060353 Bacteria 25877
454 Ga0466962_0017390 3300061719 Bacteria 3461
455 Ga0530510_0072177 3300061734 Bacteria 2505
456 Ga0530510_0358710 3300061734 Bacteria 1095
457 Ga0070666_11481148
458 JGI25406J46586_10073435
459 Ga0058863_10123465
460 Ga0058861_10005387
461 Ga0058861_10091813
462 Ga0058862_10071578
463 Ga0058862_10282255
464 Ga0070683_100578361
465 Ga0070690_100387971
466 Ga0070690_100554877
467 Ga0070670_100152760
468 Ga0068869_100661626
469 Ga0070666_10370169
470 Ga0070680_100512656
471 Ga0070680_100557303
472 Ga0070682_100509999
473 Ga0070691_10404826
474 Ga0070661_100533451
475 Ga0070661_100974259
476 Ga0070675_102034727
477 Ga0070671_100008191
478 Ga0070671_100336365
479 Ga0070659_101227240
480 Ga0070667_100311716
481 Ga0070714_101618737
482 Ga0070713_100689747
483 Ga0070713_102236218
484 Ga0070710_10247492
485 Ga0070711_100050127
486 Ga0070705_100285339
487 Ga0070705_100608066
488 Ga0070663_100269741
489 Ga0070662_100683002
490 Ga0070662_101695902
491 Ga0070681_10049652
492 Ga0070681_10050412
493 Ga0070681_10055586
494 Ga0070681_10258215
495 Ga0070681_10394281
496 Ga0070681_10772607
497 Ga0068867_102128788
498 Ga0070706_101558269
499 Ga0070698_100241217
500 Ga0070699_100134654
501 Ga0070679_100098471
502 Ga0070679_100296648
503 Ga0070679_100413402
504 Ga0070679_101419726
505 Ga0070679_101542633
506 Ga0070684_100128531
507 Ga0068853_100379071
508 Ga0068853_101216086
509 Ga0068853_101794875
510 Ga0070686_100184813
511 Ga0070696_100155876
512 Ga0070693_100269105
513 Ga0070665_100017886
514 Ga0070665_100022199
515 Ga0070665_100063627
516 Ga0070665_100261853
517 Ga0068855_100087676
518 Ga0068855_100409216
519 Ga0068855_100600855
520 Ga0070664_100773949
521 Ga0068854_100907614
522 Ga0068854_101476957
523 Ga0068856_100459196
524 Ga0068856_100718080
525 Ga0068852_101974434
526 Ga0068859_100009017
527 Ga0068859_100011112
528 Ga0068859_101566772
529 Ga0068864_100947697
530 Ga0068864_101680136
531 Ga0068861_100014692
532 Ga0068861_100531168
533 Ga0068851_10067910
534 Ga0068851_10567139
535 Ga0068863_100022008
536 Ga0068863_101247605
537 Ga0068858_100183097
538 Ga0068858_100456739
539 Ga0068858_100653279
540 Ga0068860_100006900
541 Ga0068860_100770596
542 Ga0068860_101770663
543 Ga0068862_100024248
544 Ga0068862_100092988
545 Ga0068862_100247393
546 Ga0068862_102544975
547 Ga0081455_10000719
548 Ga0081455_10692274
549 Ga0081539_10000011
550 Ga0070715_10678797
551 Ga0070716_100037560
552 Ga0070716_100645929
553 Ga0070712_100238483
554 Ga0097621_100406562
555 Ga0097621_100586554
556 Ga0097621_101652346
557 Ga0075370_10378700
558 Ga0068871_100089772
559 Ga0068871_100131087
560 Ga0097620_100009017
561 Ga0097620_100011113
562 Ga0097620_101566731
563 Ga0075435_100116321
564 Ga0099795_10492853
565 Ga0105251_10471881
566 Ga0105240_10048107
567 Ga0105240_10309689
568 Ga0105240_10323084
569 Ga0105240_10444579
570 Ga0105240_10512896
571 Ga0105240_10697892
572 Ga0105247_10000824
573 Ga0105247_10262410
574 Ga0105247_11119668
575 Ga0105243_12828246
576 Ga0105241_10498547
577 Ga0105241_11104497
578 Ga0105242_11835145
579 Ga0105248_10013468
580 Ga0105248_10057615
581 Ga0105237_10536440
582 Ga0105237_10544912
583 Ga0105237_10622766
584 Ga0105237_10789420
585 Ga0105237_11146980
586 Ga0105237_11384366
587 Ga0105237_12070525
588 Ga0105237_12226251
589 Ga0105238_10306274
590 Ga0105238_10340830
591 Ga0105238_10414260
592 Ga0105238_10498568
593 Ga0105238_10640875
594 Ga0105238_10855141
595 Ga0105238_10869199
596 Ga0105238_10997411
597 Ga0105238_11043936
598 Ga0105249_10124159
599 Ga0105249_10346423
600 Ga0105249_10760126
601 Ga0105246_10272727
602 Ga0105246_10882556
603 Ga0105246_10925008
604 Ga0154012_110135
605 Ga0157370_10089215
606 Ga0157370_10797543
607 Ga0157370_11870227
608 Ga0157369_10241138
609 Ga0157369_10244035
610 Ga0157369_10322851
611 Ga0157369_11636655
612 Ga0157374_10119536
613 Ga0157374_11302613
614 Ga0163162_10224014
615 Ga0163162_10374676
616 Ga0163162_13142632
617 Ga0157372_10188785
618 Ga0157372_10297178
619 Ga0157372_10394259
620 Ga0157372_10508799
621 Ga0157372_13372048
622 Ga0163163_10058700
623 Ga0163163_10452079
624 Ga0163163_10539134
625 Ga0163163_10560371
626 Ga0157379_10045858
627 Ga0157379_10267395
628 Ga0157379_10323911
629 Ga0157379_10405781
630 Ga0157379_11136427
631 Ga0157376_11991772
632 Ga0157376_12792712
633 Ga0206356_11377459
634 Ga0206353_11936550
635 Ga0213871_10102813
636 Ga0224712_10248999
637 Ga0224712_10604645
638 Ga0207710_10000407
639 Ga0207710_10185538
640 Ga0207710_10473557
641 Ga0207680_10111235
642 Ga0207647_10165286
643 Ga0207685_10627505
644 Ga0207654_10128137
645 Ga0207707_10008546
646 Ga0207707_10121480
647 Ga0207707_10132884
648 Ga0207707_10184832
649 Ga0207707_10188175
650 Ga0207707_10218790
651 Ga0207695_10010802
652 Ga0207695_10105144
653 Ga0207695_10153161
654 Ga0207695_10308992
655 Ga0207695_10736641
656 Ga0207695_10969048
657 Ga0207671_10649475
658 Ga0207671_11077024
659 Ga0207693_10039591
660 Ga0207663_10726525
661 Ga0207660_10196044
662 Ga0207660_10523591
663 Ga0207660_10792341
664 Ga0207649_10369391
665 Ga0207649_10759152
666 Ga0207652_10572784
667 Ga0207694_10667163
668 Ga0207694_11079250
669 Ga0207694_11578546
670 Ga0207664_11661258
671 Ga0207644_10001881
672 Ga0207706_10481481
673 Ga0207665_10102351
674 Ga0207711_10173903
675 Ga0207711_11215450
676 Ga0207661_10321401
677 Ga0207667_10024800
678 Ga0207667_10282956
679 Ga0207667_10431285
680 Ga0207667_11934655
681 Ga0207712_10008980
682 Ga0207712_10047011
683 Ga0207712_10945617
684 Ga0207668_10481149
685 Ga0207640_10678690
686 Ga0207640_11364265
687 Ga0207640_11368581
688 Ga0207658_10015130
689 Ga0207658_10505839
690 Ga0207677_10256693
691 Ga0207703_10059888
692 Ga0207703_10138006
693 Ga0207703_10259234
694 Ga0207678_10288958
695 Ga0207678_10324093
696 Ga0207702_10535336
697 Ga0207641_10026438
698 Ga0207641_10058526
699 Ga0207641_11263675
700 Ga0207674_10081307
701 Ga0207674_10086673
702 Ga0207674_10139672
703 Ga0207674_11565896
704 Ga0207675_100093400
705 Ga0207675_101152192
706 Ga0268266_10001238
707 Ga0268266_10005116
708 Ga0268266_10018657
709 Ga0268266_10022996
710 Ga0268265_10186233
711 Ga0268265_10519435
712 Ga0268265_11239526
713 Ga0268264_10005981
714 Ga0268264_10590643
715 Ga0268264_11101476
716 Ga0307515_10257101
717 Ga0307515_10318021
718 Ga0265338_10389026
719 Ga0307511_10045114
720 Ga0265340_10059624
721 Ga0265340_10202185
722 Ga0307513_10262172
723 Ga0307513_10769641
724 Ga0307509_10003419
725 Ga0307509_10279911
726 Ga0307408_100754444
727 Ga0265313_10055615
728 Ga0307508_10267937
729 Ga0307514_10514261
730 Ga0307518_10531026
731 Ga0307412_10023158
732 Ga0307416_100584216
733 Ga0307415_100705142
734 Ga0307510_10000006
735 Ga0307510_10083945
736 Ga0373923_0556685
737 Ga0373936_0233014
738 Ga0373927_0230409
739 Ga0373937_0460310
740 Ga0373925_0264696
741 Ga0395900_1237997
742 Ga0395898_0044456
743 Ga0395898_0342222
744 Ga0395905_1823119
745 Ga0436364_1042254
746 Ga0395901_0906815
747 Ga0436365_1591577
748 Ga0436360_0872355
749 Ga0436360_1084608
750 Ga0436361_0739149
751 Ga0436363_0226272
752 Ga0436363_1421103
753 Ga0436363_1436445
754 Ga0436362_0220282
755 Ga0436362_0390755
756 Ga0439453_0063750
757 Ga0451795_1690387
758 Ga0451800_0320251
759 Ga0439435_0009759
760 Ga0466969_0023547
761 Ga0466969_0238706
762 Ga0466972_0217882
763 Ga0466972_0239767
764 Ga0466965_0448145
765 Ga0466966_0001857
766 Ga0466961_0045918
767 Ga0466963_0259838
768 Ga0466964_0000290
769 Ga0466971_0001929
770 Ga0466968_0289526
771 Ga0466968_0337720
772 Ga0466970_0020368
773 Ga0466957_0005087
774 Ga0466960_0040184
775 Ga0466959_0003400
776 Ga0466959_0700735
777 Ga0466958_0632904
778 Ga0495583_0346055
779 Ga0495606_0183886
780 Ga0495632_0037524
781 Ga0495632_0111343
782 Ga0495643_0057027
783 Ga0495648_0202537
784 Ga0495625_0264857
785 Ga0495625_0268468
786 Ga0495671_0084811
787 Ga0495687_100629
788 Ga0495687_211413
789 Ga0495686_0285135
790 Ga0496100_0168138
791 Ga0496100_1126771
792 Ga0496101_0620005
793 Ga0496102_0055017
794 Ga0496102_0081226
795 Ga0496102_0240429
796 Ga0496103_0048249
797 Ga0496103_0069653
798 Ga0496104_1477862
799 Ga0496106_0095263
800 Ga0496112_0024880
801 Ga0496112_1576631
802 Ga0496114_0188128
803 Ga0496115_0636488
804 Ga0496115_0886966
805 Ga0496116_0001431
806 Ga0496117_0032967
807 Ga0496118_0000032
808 Ga0496118_0546242
809 Ga0496119_0066727
810 Ga0496119_0201688
811 Ga0496119_0210182
812 Ga0496120_0078165
813 Ga0496120_0182367
814 Ga0496121_0003252
815 Ga0496121_0080741
816 Ga0496124_0005651
817 Ga0496125_0007994
818 Ga0496125_0115724
819 Ga0496125_0187683
820 Ga0496126_0007227
821 Ga0496126_0365098
822 Ga0495682_0359592
823 Ga0501032_0127486
824 Ga0501033_0113701
825 Ga0501036_0025195
826 Ga0501037_0147502
827 Ga0501038_0012174
828 Ga0501039_0061796
829 Ga0501039_0684454
830 Ga0501040_0014345
831 Ga0501041_0004395
832 Ga0501041_0517211
833 Ga0501042_0038835
834 Ga0501043_0141421
835 Ga0501043_0788044
836 Ga0501046_0009156
837 Ga0501046_0361120
838 Ga0501047_0611625
839 Ga0501047_0825416
840 Ga0501048_0008919
841 Ga0501068_0096642
842 Ga0501071_0006619
843 Ga0501072_0044373
844 Ga0501073_0969854
845 Ga0501074_0222887
846 Ga0501075_0003291
847 Ga0501075_0124502
848 Ga0501076_0001559
849 Ga0501076_0818781
850 Ga0501077_0035722
851 Ga0501079_0006685
852 Ga0501080_0020681
853 Ga0501080_0257551
854 Ga0501081_0038037
855 Ga0501083_0652352
856 Ga0501035_0047800
857 Ga0501045_0006991
858 nmdc:mga0rr50_689521_c1
859 nmdc:mga0a205_1199110_c1
860 Ga0500644_0047346
861 Ga0500646_0038092
862 Ga0500646_0134319
863 Ga0500646_0213451
864 Ga0500583_0016948
865 Ga0500583_0071021
866 Ga0500583_0099731
867 Ga0500583_0102145
868 Ga0500583_0326857
869 Ga0500651_0186419
870 Ga0500651_0488058
871 Ga0500566_0220874
872 Ga0500641_0004514
873 Ga0500641_0137661
874 Ga0500641_0240747
875 Ga0500556_0001832
876 Ga0500556_0083103
877 Ga0500562_017519
878 Ga0500572_051899
879 Ga0500591_131156
880 Ga0500593_129319
881 Ga0500594_0198151
882 Ga0500595_024264
883 Ga0500617_076098
884 Ga0500621_150451
885 Ga0500623_205299
886 Ga0500652_176818
887 Ga0500655_025864
888 Ga0500658_0096929
889 Ga0500559_0127031
890 Ga0500588_0003896
891 Ga0500588_0408644
892 Ga0500590_356791
893 Ga0500604_0104956
894 Ga0500604_0140232
895 Ga0500616_0000499
896 Ga0500616_0051339
897 Ga0500619_312150
898 Ga0500622_0053035
899 Ga0500622_0444840
900 Ga0500627_0271136
901 Ga0500630_280153
902 Ga0500633_0161033
903 Ga0500633_0301899
904 Ga0500637_0293920
905 Ga0500656_003559
906 Ga0587084_118364
907 Ga0587093_080899
908 Ga0587080_016553
909 Ga0501082_0000933
910 Ga0466962_0017390
911 Ga0530510_0072177
912 Ga0530510_0358710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

58

112

0.95

Map