F447509

General Info

Members Datasets Scaffolds Average Seq Length
455 276 910 127

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100107222|Ga0068869_1001072222
Length 133
Sequence VTVPQDLRYSKEHEWVRLDGDIATIGITHFAQEQLGDVVFVELPEKGATIRQFSSLGVVESVKAASDIYSPISGEVLERNVKVIEKPELVNSKPYDDGWMLRVKLADKAELQKLLSADDYRAHIGETPGSGGD

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
250 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
251 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
275 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
276 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 2.64
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0.22
Rhizoplane 1.32
Rhizosphere 95.82
Stem 0
Stem Tuber 0.22
Unclassified 6.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100107222 3300005334 Bacteria 2121
2 JGI25154J39366_1012339 3300002738 Bacteria 947
3 rootH1_10069000 3300003316 Bacteria 2436
4 Ga0055534_1017285 3300003784 Bacteria 1277
5 Ga0065714_10120408 3300005288 Bacteria 1315
6 Ga0065704_10157089 3300005289 Unclassified 1383
7 Ga0065712_10299423 3300005290 Bacteria 863
8 Ga0065715_10185142 3300005293 Bacteria 1449
9 Ga0065707_10105429 3300005295 Bacteria 2645
10 Ga0065707_10370365 3300005295 Bacteria 880
11 Ga0065707_10676646 3300005295 Unclassified 648
12 Ga0070683_100681868 3300005329 Bacteria 984
13 Ga0070670_100008453 3300005331 Bacteria 8781
14 Ga0070670_100355169 3300005331 Bacteria 1288
15 Ga0070670_100616637 3300005331 Bacteria 972
16 Ga0068869_100183585 3300005334 Bacteria 1641
17 Ga0068869_100223961 3300005334 Bacteria 1492
18 Ga0068868_100000076 3300005338 Bacteria 58193
19 Ga0068868_101955409 3300005338 Bacteria 556
20 Ga0070660_100000090 3300005339 Bacteria 54649
21 Ga0070689_100025667 3300005340 Bacteria 4429
22 Ga0070689_100694711 3300005340 Bacteria 888
23 Ga0070689_101444695 3300005340 Bacteria 622
24 Ga0070689_101980836 3300005340 Bacteria 532
25 Ga0070687_100029014 3300005343 Bacteria 2689
26 Ga0070687_100143872 3300005343 Bacteria 1392
27 Ga0070687_100374841 3300005343 Bacteria 925
28 Ga0070687_100890044 3300005343 Bacteria 637
29 Ga0070692_10567349 3300005345 Bacteria 746
30 Ga0070668_100872629 3300005347 Bacteria 803
31 Ga0070669_100150256 3300005353 Bacteria 1803
32 Ga0070675_100211122 3300005354 Bacteria 1687
33 Ga0070675_100251350 3300005354 Bacteria 1547
34 Ga0070675_101415819 3300005354 Bacteria 641
35 Ga0070675_101487734 3300005354 Bacteria 624
36 Ga0070673_100030689 3300005364 Bacteria 4027
37 Ga0070673_100928470 3300005364 Bacteria 808
38 Ga0070673_101589780 3300005364 Bacteria 617
39 Ga0070673_101847857 3300005364 Bacteria 572
40 Ga0070688_100047957 3300005365 Bacteria 2652
41 Ga0070688_100113211 3300005365 Bacteria 1807
42 Ga0070659_100000122 3300005366 Bacteria 58682
43 Ga0070667_100195415 3300005367 Unclassified 1793
44 Ga0070714_100217118 3300005435 Bacteria 1756
45 Ga0070714_101373795 3300005435 Bacteria 690
46 Ga0070713_100164364 3300005436 Bacteria 1984
47 Ga0070713_100311428 3300005436 Bacteria 1452
48 Ga0070710_10361061 3300005437 Bacteria 964
49 Ga0070701_10231511 3300005438 Bacteria 1107
50 Ga0070700_100232833 3300005441 Bacteria 1312
51 Ga0070708_100035452 3300005445 Bacteria 4346
52 Ga0070678_100493167 3300005456 Unclassified 1080
53 Ga0070681_10412048 3300005458 Bacteria 1263
54 Ga0068867_100130181 3300005459 Unclassified 1954
55 Ga0068867_102008972 3300005459 Bacteria 547
56 Ga0070685_10109764 3300005466 Unclassified 1697
57 Ga0070685_10237549 3300005466 Bacteria 1201
58 Ga0070698_100002858 3300005471 Bacteria 19016
59 Ga0068853_100595678 3300005539 Bacteria 1049
60 Ga0070672_100110624 3300005543 Bacteria 2238
61 Ga0070686_100301998 3300005544 Bacteria 1187
62 Ga0070686_100468600 3300005544 Bacteria 972
63 Ga0070696_100265912 3300005546 Bacteria 1302
64 Ga0070696_100743738 3300005546 Bacteria 803
65 Ga0070665_100372975 3300005548 Bacteria 1434
66 Ga0070704_100405095 3300005549 Bacteria 1165
67 Ga0070664_100175190 3300005564 Bacteria 1904
68 Ga0068857_100154729 3300005577 Bacteria 2079
69 Ga0068857_101636514 3300005577 Bacteria 629
70 Ga0068854_100276540 3300005578 Bacteria 1350
71 Ga0068856_100642941 3300005614 Bacteria 1081
72 Ga0068856_100903765 3300005614 Bacteria 902
73 Ga0068856_101366481 3300005614 Bacteria 723
74 Ga0070702_100370779 3300005615 Bacteria 1015
75 Ga0068852_100325975 3300005616 Bacteria 1493
76 Ga0068859_100114626 3300005617 Bacteria 2759
77 Ga0068859_100276787 3300005617 Bacteria 1771
78 Ga0068859_100619005 3300005617 Bacteria 1175
79 Ga0068859_100948943 3300005617 Bacteria 943
80 Ga0068859_102857084 3300005617 Bacteria 529
81 Ga0068859_103125555 3300005617 Bacteria 504
82 Ga0068864_100393626 3300005618 Bacteria 1316
83 Ga0068861_100015347 3300005719 Bacteria 5396
84 Ga0068861_101564547 3300005719 Bacteria 649
85 Ga0068851_10085570 3300005834 Bacteria 1653
86 Ga0068870_10100068 3300005840 Bacteria 1637
87 Ga0068870_10395653 3300005840 Unclassified 898
88 Ga0068863_100006014 3300005841 Bacteria 11901
89 Ga0068863_100441983 3300005841 Bacteria 1275
90 Ga0068863_102596818 3300005841 Unclassified 515
91 Ga0068860_100394261 3300005843 Bacteria 1368
92 Ga0068860_101679391 3300005843 Bacteria 657
93 Ga0068862_100091016 3300005844 Bacteria 2656
94 Ga0068862_100384687 3300005844 Bacteria 1309
95 Ga0068862_100526237 3300005844 Bacteria 1126
96 Ga0070717_10545285 3300006028 Bacteria 1050
97 Ga0070717_11094252 3300006028 Bacteria 726
98 Ga0070716_100047156 3300006173 Bacteria 2429
99 Ga0070712_100022009 3300006175 Bacteria 4193
100 Ga0097621_100086298 3300006237 Unclassified 2619
101 Ga0097621_100293783 3300006237 Bacteria 1433
102 Ga0068871_101705253 3300006358 Unclassified 597
103 Ga0068871_102242664 3300006358 Bacteria 520
104 Ga0075428_100008765 3300006844 Bacteria 11221
105 Ga0075428_100385457 3300006844 Bacteria 1503
106 Ga0075428_101740857 3300006844 Bacteria 650
107 Ga0075430_100020701 3300006846 Bacteria 5594
108 Ga0075431_100124051 3300006847 Unclassified 2665
109 Ga0075429_100010150 3300006880 Bacteria 8157
110 Ga0075429_100039780 3300006880 Unclassified 4092
111 Ga0075429_101331546 3300006880 Bacteria 626
112 Ga0068865_100637134 3300006881 Unclassified 905
113 Ga0068865_101208792 3300006881 Bacteria 669
114 Ga0097620_100114638 3300006931 Bacteria 2759
115 Ga0097620_100276782 3300006931 Bacteria 1771
116 Ga0097620_100618996 3300006931 Bacteria 1175
117 Ga0097620_100948953 3300006931 Bacteria 943
118 Ga0097620_102856938 3300006931 Bacteria 529
119 Ga0097620_103125558 3300006931 Bacteria 504
120 Ga0111539_10307147 3300009094 Bacteria 1846
121 Ga0111539_10310320 3300009094 Bacteria 1836
122 Ga0111539_10761399 3300009094 Bacteria 1127
123 Ga0111539_11605921 3300009094 Bacteria 754
124 Ga0105245_10107203 3300009098 Bacteria 2593
125 Ga0105245_10354504 3300009098 Bacteria 1455
126 Ga0105247_10864901 3300009101 Bacteria 695
127 Ga0114129_10062841 3300009147 Bacteria 5186
128 Ga0114129_10570937 3300009147 Bacteria 1469
129 Ga0114129_11089891 3300009147 Unclassified 1000
130 Ga0114129_11416548 3300009147 Bacteria 857
131 Ga0105241_11361678 3300009174 Bacteria 678
132 Ga0105242_10024496 3300009176 Bacteria 4768
133 Ga0105242_10244690 3300009176 Bacteria 1614
134 Ga0105242_12871692 3300009176 Unclassified 532
135 Ga0105248_10479566 3300009177 Unclassified 1402
136 Ga0105248_13034411 3300009177 Bacteria 535
137 Ga0105237_10020029 3300009545 Bacteria 6905
138 Ga0105237_10657074 3300009545 Bacteria 1055
139 Ga0105238_10198697 3300009551 Bacteria 1980
140 Ga0105238_10404485 3300009551 Bacteria 1359
141 Ga0105249_10279055 3300009553 Bacteria 1668
142 Ga0105249_10809802 3300009553 Bacteria 1001
143 Ga0105249_11150992 3300009553 Bacteria 846
144 Ga0105249_12261229 3300009553 Bacteria 616
145 Ga0105249_13110931 3300009553 Unclassified 533
146 Ga0105239_11139150 3300010375 Bacteria 898
147 Ga0105239_11576790 3300010375 Bacteria 759
148 Ga0105246_10349572 3300011119 Bacteria 1211
149 Ga0157371_11290893 3300013102 Bacteria 565
150 Ga0157369_10591231 3300013105 Bacteria 1146
151 Ga0157374_10711199 3300013296 Bacteria 1018
152 Ga0157378_11336804 3300013297 Bacteria 758
153 Ga0163162_11665381 3300013306 Bacteria 728
154 Ga0163162_12559367 3300013306 Bacteria 587
155 Ga0157375_10615609 3300013308 Bacteria 1244
156 Ga0157375_12103577 3300013308 Bacteria 672
157 Ga0157375_13773210 3300013308 Bacteria 503
158 Ga0163163_10202713 3300014325 Bacteria 2032
159 Ga0163163_10308308 3300014325 Bacteria 1636
160 Ga0157380_10120589 3300014326 Bacteria 2221
161 Ga0157380_10526015 3300014326 Bacteria 1155
162 Ga0157380_11335172 3300014326 Bacteria 765
163 Ga0182008_10110235 3300014497 Bacteria 1364
164 Ga0182008_10298710 3300014497 Bacteria 842
165 Ga0157377_10024669 3300014745 Bacteria 3198
166 Ga0157377_10588823 3300014745 Bacteria 792
167 Ga0157379_10343338 3300014968 Bacteria 1366
168 Ga0157376_10768745 3300014969 Bacteria 974
169 Ga0157376_11359665 3300014969 Bacteria 741
170 Ga0206356_11430677 3300020070 Bacteria 1389
171 Ga0206352_10286484 3300020078 Bacteria 693
172 Ga0206350_10873092 3300020080 Bacteria 533
173 Ga0206354_10411407 3300020081 Bacteria 654
174 Ga0213875_10191287 3300021388 Bacteria 962
175 Ga0209675_1000792 3300025291 Bacteria 20968
176 Ga0207682_10191820 3300025893 Bacteria 937
177 Ga0207692_10050436 3300025898 Bacteria 2105
178 Ga0207692_10678979 3300025898 Bacteria 667
179 Ga0207642_10362801 3300025899 Bacteria 858
180 Ga0207710_10292609 3300025900 Bacteria 821
181 Ga0207680_10464113 3300025903 Bacteria 899
182 Ga0207699_10008120 3300025906 Bacteria 5165
183 Ga0207699_10740096 3300025906 Bacteria 721
184 Ga0207645_10039763 3300025907 Bacteria 3013
185 Ga0207643_10163403 3300025908 Bacteria 1340
186 Ga0207643_10323155 3300025908 Unclassified 964
187 Ga0207707_11286651 3300025912 Bacteria 588
188 Ga0207671_10015037 3300025914 Bacteria 6084
189 Ga0207693_10109438 3300025915 Bacteria 2167
190 Ga0207663_10079802 3300025916 Bacteria 2138
191 Ga0207663_11398494 3300025916 Bacteria 564
192 Ga0207662_10100862 3300025918 Bacteria 1788
193 Ga0207662_10114367 3300025918 Bacteria 1686
194 Ga0207662_10303852 3300025918 Bacteria 1061
195 Ga0207657_10000445 3300025919 Bacteria 43853
196 Ga0207657_11020970 3300025919 Bacteria 634
197 Ga0207681_10015427 3300025923 Bacteria 4764
198 Ga0207681_11850305 3300025923 Bacteria 503
199 Ga0207694_10609903 3300025924 Bacteria 918
200 Ga0207694_11091261 3300025924 Bacteria 675
201 Ga0207650_10004817 3300025925 Bacteria 9219
202 Ga0207650_10157657 3300025925 Bacteria 1796
203 Ga0207650_10464970 3300025925 Bacteria 1054
204 Ga0207650_10541594 3300025925 Bacteria 975
205 Ga0207659_10021533 3300025926 Bacteria 4280
206 Ga0207659_10115473 3300025926 Bacteria 2048
207 Ga0207659_10443050 3300025926 Bacteria 1093
208 Ga0207659_11300144 3300025926 Bacteria 624
209 Ga0207687_10124885 3300025927 Bacteria 1930
210 Ga0207687_10452249 3300025927 Bacteria 1065
211 Ga0207700_10036497 3300025928 Bacteria 3551
212 Ga0207700_10144946 3300025928 Bacteria 1956
213 Ga0207700_10444263 3300025928 Bacteria 1142
214 Ga0207664_10033484 3300025929 Bacteria 3948
215 Ga0207664_10050268 3300025929 Bacteria 3287
216 Ga0207664_10579025 3300025929 Bacteria 1008
217 Ga0207664_11543274 3300025929 Bacteria 586
218 Ga0207690_10000001 3300025932 Bacteria 807539
219 Ga0207686_10000974 3300025934 Bacteria 17044
220 Ga0207686_10136389 3300025934 Unclassified 1690
221 Ga0207686_10384666 3300025934 Bacteria 1065
222 Ga0207709_10784920 3300025935 Bacteria 768
223 Ga0207670_10004800 3300025936 Bacteria 7337
224 Ga0207704_10087167 3300025938 Bacteria 2038
225 Ga0207665_10155544 3300025939 Bacteria 1640
226 Ga0207691_10160377 3300025940 Bacteria 1973
227 Ga0207711_10131706 3300025941 Unclassified 2243
228 Ga0207711_11345832 3300025941 Bacteria 656
229 Ga0207689_10006191 3300025942 Bacteria 10596
230 Ga0207689_10103947 3300025942 Bacteria 2334
231 Ga0207689_10115007 3300025942 Bacteria 2211
232 Ga0207689_10420443 3300025942 Bacteria 1115
233 Ga0207661_11582709 3300025944 Bacteria 600
234 Ga0207679_10490531 3300025945 Bacteria 1095
235 Ga0207679_11484298 3300025945 Bacteria 622
236 Ga0207651_11416750 3300025960 Bacteria 625
237 Ga0207651_11671448 3300025960 Bacteria 573
238 Ga0207712_10205885 3300025961 Bacteria 1563
239 Ga0207712_11185067 3300025961 Bacteria 681
240 Ga0207668_10308023 3300025972 Bacteria 1310
241 Ga0207640_10312050 3300025981 Bacteria 1248
242 Ga0207658_10119684 3300025986 Bacteria 2097
243 Ga0207658_10364928 3300025986 Bacteria 1261
244 Ga0207677_10000144 3300026023 Bacteria 58198
245 Ga0207677_11859794 3300026023 Bacteria 559
246 Ga0207703_12113311 3300026035 Bacteria 539
247 Ga0207639_10712575 3300026041 Bacteria 931
248 Ga0207708_10039652 3300026075 Bacteria 3589
249 Ga0207702_10129566 3300026078 Bacteria 2269
250 Ga0207702_10501343 3300026078 Bacteria 1183
251 Ga0207641_10001256 3300026088 Bacteria 25238
252 Ga0207641_10435657 3300026088 Bacteria 1264
253 Ga0207641_10644039 3300026088 Bacteria 1040
254 Ga0207648_10137411 3300026089 Unclassified 2153
255 Ga0207648_12208433 3300026089 Bacteria 511
256 Ga0207674_10110396 3300026116 Bacteria 2725
257 Ga0207674_10357051 3300026116 Bacteria 1413
258 Ga0207675_100004454 3300026118 Bacteria 13535
259 Ga0207675_100168282 3300026118 Unclassified 2094
260 Ga0207675_101910323 3300026118 Bacteria 612
261 Ga0207683_10082046 3300026121 Bacteria 2863
262 Ga0207698_10833262 3300026142 Bacteria 926
263 Ga0209974_10064655 3300027876 Bacteria 1242
264 Ga0207428_10211355 3300027907 Bacteria 1457
265 Ga0207428_10332807 3300027907 Bacteria 1120
266 Ga0268266_10358812 3300028379 Bacteria 1371
267 Ga0268266_11977198 3300028379 Bacteria 557
268 Ga0268265_10608189 3300028380 Bacteria 1045
269 Ga0268265_11243055 3300028380 Bacteria 743
270 Ga0268264_10975648 3300028381 Unclassified 853
271 Ga0268264_11323192 3300028381 Bacteria 731
272 Ga0268264_12140603 3300028381 Bacteria 568
273 Ga0265314_10033450 3300031711 Bacteria 3769
274 Ga0307405_10769557 3300031731 Bacteria 804
275 Ga0307413_10064845 3300031824 Bacteria 2271
276 Ga0307406_10325008 3300031901 Bacteria 1191
277 Ga0307406_10661754 3300031901 Bacteria 868
278 Ga0307407_10421987 3300031903 Bacteria 961
279 Ga0307412_10165004 3300031911 Bacteria 1650
280 Ga0307409_101006769 3300031995 Bacteria 851
281 Ga0307409_101398111 3300031995 Unclassified 726
282 Ga0307416_103386441 3300032002 Bacteria 533
283 Ga0307414_10400796 3300032004 Bacteria 1191
284 Ga0307414_10591660 3300032004 Bacteria 994
285 Ga0307411_10198830 3300032005 Bacteria 1537
286 Ga0373926_0229824 3300035083 Bacteria 717
287 Ga0373934_0068378 3300035086 Bacteria 1419
288 Ga0373934_0125248 3300035086 Bacteria 1046
289 Ga0373944_0141715 3300035089 Bacteria 842
290 Ga0373923_0050106 3300035111 Bacteria 1748
291 Ga0373923_0224480 3300035111 Bacteria 874
292 Ga0373936_0060358 3300035113 Bacteria 1547
293 Ga0373953_0021593 3300035117 Bacteria 2418
294 Ga0373954_0610022 3300035118 Bacteria 541
295 Ga0373956_0133318 3300035119 Bacteria 1164
296 Ga0373957_0058599 3300035120 Bacteria 1488
297 Ga0373943_0187288 3300035170 Bacteria 1140
298 Ga0373943_0307166 3300035170 Bacteria 902
299 Ga0373955_0421968 3300035172 Bacteria 811
300 Ga0373924_0053126 3300035410 Bacteria 1683
301 Ga0373935_0164595 3300035692 Bacteria 1514
302 Ga0373935_0208616 3300035692 Bacteria 1353
303 Ga0373927_0140501 3300035695 Bacteria 1579
304 Ga0373933_0001259 3300035724 Bacteria 14953
305 Ga0373933_0016183 3300035724 Bacteria 4168
306 Ga0373933_0258497 3300035724 Bacteria 1122
307 Ga0373947_0228280 3300035725 Bacteria 1225
308 Ga0373937_0012279 3300036401 Bacteria 7529
309 Ga0373937_0021544 3300036401 Bacteria 5785
310 Ga0373937_0033768 3300036401 Bacteria 4649
311 Ga0373937_0074537 3300036401 Bacteria 3132
312 Ga0373937_0297821 3300036401 Bacteria 1524
313 Ga0373925_0026663 3300037068 Bacteria 4229
314 Ga0373925_0304393 3300037068 Bacteria 1287
315 Ga0373925_0909772 3300037068 Unclassified 725
316 Ga0395899_0034960 3300037312 Bacteria 3773
317 Ga0395900_0079859 3300037418 Bacteria 3361
318 Ga0395900_0159804 3300037418 Bacteria 2299
319 Ga0395898_0049228 3300037466 Bacteria 4129
320 Ga0395905_0039125 3300037471 Bacteria 4449
321 Ga0436364_0054456 3300037853 Bacteria 1840
322 Ga0436364_0873741 3300037853 Bacteria 8189
323 Ga0395901_0083763 3300038443 Bacteria 3333
324 Ga0395901_0125788 3300038443 Bacteria 2694
325 Ga0395901_0227418 3300038443 Bacteria 1948
326 Ga0451789_0687752 3300041443 Bacteria 582
327 Ga0451795_0913183 3300041456 Bacteria 564
328 Ga0451807_1342101 3300041486 Bacteria 544
329 Ga0451835_1253975 3300041492 Unclassified 637
330 Ga0451837_1599526 3300041494 Bacteria 867
331 Ga0451855_0406718 3300041511 Bacteria 637
332 Ga0439441_031141 3300042001 Bacteria 1034
333 Ga0439443_025149 3300042003 Bacteria 958
334 Ga0450923_004832 3300042125 Bacteria 2138
335 Ga0450907_064736 3300042146 Bacteria 632
336 Ga0439444_0077227 3300042437 Bacteria 723
337 Ga0451577_0055079 3300042876 Bacteria 3550
338 Ga0451577_0407867 3300042876 Bacteria 1233
339 Ga0453683_0007871 3300044673 Bacteria 7189
340 Ga0453684_0018744 3300044712 Bacteria 10596
341 Ga0466957_0024416 3300044842 Bacteria 3578
342 Ga0466958_0590190 3300045836 Bacteria 722
343 Ga0466967_2425377 3300045976 Bacteria 520
344 Ga0495592_0048336 3300046454 Bacteria 3165
345 Ga0495592_0238736 3300046454 Bacteria 1207
346 Ga0495629_0131578 3300046459 Bacteria 1743
347 Ga0495651_0011597 3300046462 Bacteria 6773
348 Ga0495651_0051259 3300046462 Bacteria 3183
349 Ga0495653_0057792 3300046463 Bacteria 2951
350 Ga0495664_0001049 3300046477 Bacteria 14277
351 Ga0495608_0010502 3300046511 Bacteria 6461
352 Ga0495608_0023871 3300046511 Bacteria 4184
353 Ga0495608_0603872 3300046511 Bacteria 658
354 Ga0495618_0205124 3300046514 Bacteria 1247
355 Ga0495618_0268829 3300046514 Bacteria 1066
356 Ga0495618_0521271 3300046514 Bacteria 714
357 Ga0495628_0108611 3300046516 Bacteria 2136
358 Ga0495628_0268803 3300046516 Bacteria 1269
359 Ga0495630_0218573 3300046517 Bacteria 1455
360 Ga0495642_0404730 3300046528 Bacteria 602
361 Ga0495652_0248466 3300046529 Bacteria 1319
362 Ga0495652_0272516 3300046529 Bacteria 1243
363 Ga0495652_0381844 3300046529 Bacteria 1002
364 Ga0495640_0112576 3300046533 Bacteria 1777
365 Ga0495640_0354992 3300046533 Bacteria 904
366 Ga0495587_0009947 3300046536 Bacteria 6071
367 Ga0495598_0034108 3300046537 Bacteria 1449
368 Ga0495621_0033556 3300046539 Bacteria 1770
369 Ga0495645_0002398 3300046543 Bacteria 12717
370 Ga0495667_0012715 3300046559 Bacteria 5705
371 Ga0495667_0426859 3300046559 Bacteria 834
372 Ga0495635_0244939 3300046663 Bacteria 1209
373 Ga0495635_0693994 3300046663 Bacteria 660
374 Ga0495657_0023610 3300046675 Bacteria 4392
375 Ga0495599_0021533 3300046678 Bacteria 4023
376 Ga0495599_0035122 3300046678 Bacteria 3147
377 Ga0495623_0090066 3300046679 Bacteria 1884
378 Ga0495646_0010387 3300046680 Bacteria 5921
379 Ga0495646_0371040 3300046680 Bacteria 747
380 Ga0495647_0523508 3300046681 Bacteria 553
381 Ga0495613_0671784 3300046689 Bacteria 684
382 Ga0495600_0133629 3300046809 Bacteria 1612
383 Ga0495600_0149712 3300046809 Bacteria 1512
384 Ga0495600_0580517 3300046809 Bacteria 683
385 Ga0495604_0041420 3300047317 Bacteria 3612
386 Ga0495674_0023171 3300047319 Bacteria 5724
387 Ga0495674_0109049 3300047319 Bacteria 2349
388 Ga0495674_0257700 3300047319 Bacteria 1434
389 Ga0495680_0532761 3300047322 Bacteria 793
390 Ga0495675_0062107 3300047444 Bacteria 2366
391 Ga0495684_0099355 3300047471 Bacteria 2200
392 Ga0495684_0176238 3300047471 Bacteria 1587
393 Ga0495593_0405630 3300047673 Bacteria 682
394 Ga0495602_0000307 3300048088 Bacteria 45339
395 Ga0495602_0384876 3300048088 Bacteria 1004
396 Ga0496104_0290712 3300048907 Bacteria 1547
397 Ga0496108_0777751 3300048911 Bacteria 827
398 Ga0496113_0763444 3300048916 Bacteria 769
399 Ga0496126_0696779 3300048929 Bacteria 790
400 Ga0501031_0001662 3300049568 Bacteria 13960
401 Ga0501031_0702416 3300049568 Bacteria 649
402 Ga0501032_0173771 3300049569 Bacteria 1412
403 Ga0501033_0057117 3300049570 Bacteria 2885
404 Ga0501034_0093599 3300049571 Bacteria 3001
405 Ga0501034_0176469 3300049571 Bacteria 2103
406 Ga0501034_0220776 3300049571 Bacteria 1848
407 Ga0501036_0076442 3300049572 Bacteria 2832
408 Ga0501036_0479239 3300049572 Bacteria 1036
409 Ga0501036_1041482 3300049572 Bacteria 669
410 Ga0501037_0025449 3300049573 Bacteria 4373
411 Ga0501037_0121752 3300049573 Bacteria 1875
412 Ga0501038_0001686 3300049574 Bacteria 20477
413 Ga0501039_0013831 3300049575 Bacteria 6175
414 Ga0501040_0329845 3300049576 Bacteria 1092
415 Ga0501041_0392488 3300049577 Bacteria 879
416 Ga0501043_0032977 3300049579 Bacteria 4073
417 Ga0501068_0111811 3300049584 Bacteria 1699
418 Ga0501073_0382829 3300049589 Unclassified 972
419 Ga0501209_086818 3300049656 Bacteria 907
420 Ga0501258_010596 3300049687 Bacteria 977
421 Ga0501234_052603 3300049707 Bacteria 680
422 Ga0501080_0834524 3300049742 Bacteria 807
423 Ga0501083_0911909 3300049744 Bacteria 572
424 Ga0501035_0017278 3300049822 Bacteria 6651
425 Ga0501035_0417846 3300049822 Bacteria 1114
426 Ga0501044_0101156 3300049823 Bacteria 2900
427 Ga0501044_0187667 3300049823 Bacteria 2031
428 nmdc:mga05p37_1050358_c1 3300050507 Unclassified 859
429 nmdc:mga09592_1162699_c1 3300050508 Bacteria 639
430 nmdc:mga09592_226795_c1 3300050508 Unclassified 1619
431 nmdc:mga09592_32021_c1 3300050508 Bacteria 4383
432 nmdc:mga0qj67_110826_c1 3300050509 Unclassified 2216
433 nmdc:mga0qj67_70577_c1 3300050509 Bacteria 2786
434 nmdc:mga06r32_728760_c1 3300050510 Unclassified 956
435 nmdc:mga08y16_291118_c1 3300050511 Bacteria 1684
436 nmdc:mga08y16_342398_c1 3300050511 Bacteria 1537
437 Ga0495601_0001514 3300053077 Bacteria 12823
438 Ga0495601_0382883 3300053077 Bacteria 913
439 Ga0495612_0000760 3300053078 Bacteria 13158
440 Ga0495595_0182061 3300053084 Bacteria 1042
441 Ga0495619_0057845 3300053085 Bacteria 2573
442 Ga0495619_0135751 3300053085 Bacteria 1692
443 Ga0495619_0620430 3300053085 Bacteria 739
444 Ga0587093_034100 3300059478 Bacteria 746
445 Ga0587066_155906 3300059490 Bacteria 570
446 Ga0587073_0091037 3300059492 Bacteria 776
447 Ga0587077_053866 3300059493 Bacteria 851
448 Ga0587080_053768 3300059503 Bacteria 767
449 Ga0587085_025998 3300059506 Bacteria 929
450 Ga0587086_073464 3300059507 Bacteria 591
451 Ga0587107_069955 3300059652 Bacteria 638
452 Ga0501082_1631370 3300060353 Bacteria 563
453 2510840542 2510461069 Bacteria 5505000
454 2885427973 2885427238 Bacteria 2291351
455 8002289982 8002285264 Bacteria 6717907
456 Ga0068869_100107222
457 JGI25154J39366_1012339
458 rootH1_10069000
459 Ga0055534_1017285
460 Ga0065714_10120408
461 Ga0065704_10157089
462 Ga0065712_10299423
463 Ga0065715_10185142
464 Ga0065707_10105429
465 Ga0065707_10370365
466 Ga0065707_10676646
467 Ga0070683_100681868
468 Ga0070670_100008453
469 Ga0070670_100355169
470 Ga0070670_100616637
471 Ga0068869_100183585
472 Ga0068869_100223961
473 Ga0068868_100000076
474 Ga0068868_101955409
475 Ga0070660_100000090
476 Ga0070689_100025667
477 Ga0070689_100694711
478 Ga0070689_101444695
479 Ga0070689_101980836
480 Ga0070687_100029014
481 Ga0070687_100143872
482 Ga0070687_100374841
483 Ga0070687_100890044
484 Ga0070692_10567349
485 Ga0070668_100872629
486 Ga0070669_100150256
487 Ga0070675_100211122
488 Ga0070675_100251350
489 Ga0070675_101415819
490 Ga0070675_101487734
491 Ga0070673_100030689
492 Ga0070673_100928470
493 Ga0070673_101589780
494 Ga0070673_101847857
495 Ga0070688_100047957
496 Ga0070688_100113211
497 Ga0070659_100000122
498 Ga0070667_100195415
499 Ga0070714_100217118
500 Ga0070714_101373795
501 Ga0070713_100164364
502 Ga0070713_100311428
503 Ga0070710_10361061
504 Ga0070701_10231511
505 Ga0070700_100232833
506 Ga0070708_100035452
507 Ga0070678_100493167
508 Ga0070681_10412048
509 Ga0068867_100130181
510 Ga0068867_102008972
511 Ga0070685_10109764
512 Ga0070685_10237549
513 Ga0070698_100002858
514 Ga0068853_100595678
515 Ga0070672_100110624
516 Ga0070686_100301998
517 Ga0070686_100468600
518 Ga0070696_100265912
519 Ga0070696_100743738
520 Ga0070665_100372975
521 Ga0070704_100405095
522 Ga0070664_100175190
523 Ga0068857_100154729
524 Ga0068857_101636514
525 Ga0068854_100276540
526 Ga0068856_100642941
527 Ga0068856_100903765
528 Ga0068856_101366481
529 Ga0070702_100370779
530 Ga0068852_100325975
531 Ga0068859_100114626
532 Ga0068859_100276787
533 Ga0068859_100619005
534 Ga0068859_100948943
535 Ga0068859_102857084
536 Ga0068859_103125555
537 Ga0068864_100393626
538 Ga0068861_100015347
539 Ga0068861_101564547
540 Ga0068851_10085570
541 Ga0068870_10100068
542 Ga0068870_10395653
543 Ga0068863_100006014
544 Ga0068863_100441983
545 Ga0068863_102596818
546 Ga0068860_100394261
547 Ga0068860_101679391
548 Ga0068862_100091016
549 Ga0068862_100384687
550 Ga0068862_100526237
551 Ga0070717_10545285
552 Ga0070717_11094252
553 Ga0070716_100047156
554 Ga0070712_100022009
555 Ga0097621_100086298
556 Ga0097621_100293783
557 Ga0068871_101705253
558 Ga0068871_102242664
559 Ga0075428_100008765
560 Ga0075428_100385457
561 Ga0075428_101740857
562 Ga0075430_100020701
563 Ga0075431_100124051
564 Ga0075429_100010150
565 Ga0075429_100039780
566 Ga0075429_101331546
567 Ga0068865_100637134
568 Ga0068865_101208792
569 Ga0097620_100114638
570 Ga0097620_100276782
571 Ga0097620_100618996
572 Ga0097620_100948953
573 Ga0097620_102856938
574 Ga0097620_103125558
575 Ga0111539_10307147
576 Ga0111539_10310320
577 Ga0111539_10761399
578 Ga0111539_11605921
579 Ga0105245_10107203
580 Ga0105245_10354504
581 Ga0105247_10864901
582 Ga0114129_10062841
583 Ga0114129_10570937
584 Ga0114129_11089891
585 Ga0114129_11416548
586 Ga0105241_11361678
587 Ga0105242_10024496
588 Ga0105242_10244690
589 Ga0105242_12871692
590 Ga0105248_10479566
591 Ga0105248_13034411
592 Ga0105237_10020029
593 Ga0105237_10657074
594 Ga0105238_10198697
595 Ga0105238_10404485
596 Ga0105249_10279055
597 Ga0105249_10809802
598 Ga0105249_11150992
599 Ga0105249_12261229
600 Ga0105249_13110931
601 Ga0105239_11139150
602 Ga0105239_11576790
603 Ga0105246_10349572
604 Ga0157371_11290893
605 Ga0157369_10591231
606 Ga0157374_10711199
607 Ga0157378_11336804
608 Ga0163162_11665381
609 Ga0163162_12559367
610 Ga0157375_10615609
611 Ga0157375_12103577
612 Ga0157375_13773210
613 Ga0163163_10202713
614 Ga0163163_10308308
615 Ga0157380_10120589
616 Ga0157380_10526015
617 Ga0157380_11335172
618 Ga0182008_10110235
619 Ga0182008_10298710
620 Ga0157377_10024669
621 Ga0157377_10588823
622 Ga0157379_10343338
623 Ga0157376_10768745
624 Ga0157376_11359665
625 Ga0206356_11430677
626 Ga0206352_10286484
627 Ga0206350_10873092
628 Ga0206354_10411407
629 Ga0213875_10191287
630 Ga0209675_1000792
631 Ga0207682_10191820
632 Ga0207692_10050436
633 Ga0207692_10678979
634 Ga0207642_10362801
635 Ga0207710_10292609
636 Ga0207680_10464113
637 Ga0207699_10008120
638 Ga0207699_10740096
639 Ga0207645_10039763
640 Ga0207643_10163403
641 Ga0207643_10323155
642 Ga0207707_11286651
643 Ga0207671_10015037
644 Ga0207693_10109438
645 Ga0207663_10079802
646 Ga0207663_11398494
647 Ga0207662_10100862
648 Ga0207662_10114367
649 Ga0207662_10303852
650 Ga0207657_10000445
651 Ga0207657_11020970
652 Ga0207681_10015427
653 Ga0207681_11850305
654 Ga0207694_10609903
655 Ga0207694_11091261
656 Ga0207650_10004817
657 Ga0207650_10157657
658 Ga0207650_10464970
659 Ga0207650_10541594
660 Ga0207659_10021533
661 Ga0207659_10115473
662 Ga0207659_10443050
663 Ga0207659_11300144
664 Ga0207687_10124885
665 Ga0207687_10452249
666 Ga0207700_10036497
667 Ga0207700_10144946
668 Ga0207700_10444263
669 Ga0207664_10033484
670 Ga0207664_10050268
671 Ga0207664_10579025
672 Ga0207664_11543274
673 Ga0207690_10000001
674 Ga0207686_10000974
675 Ga0207686_10136389
676 Ga0207686_10384666
677 Ga0207709_10784920
678 Ga0207670_10004800
679 Ga0207704_10087167
680 Ga0207665_10155544
681 Ga0207691_10160377
682 Ga0207711_10131706
683 Ga0207711_11345832
684 Ga0207689_10006191
685 Ga0207689_10103947
686 Ga0207689_10115007
687 Ga0207689_10420443
688 Ga0207661_11582709
689 Ga0207679_10490531
690 Ga0207679_11484298
691 Ga0207651_11416750
692 Ga0207651_11671448
693 Ga0207712_10205885
694 Ga0207712_11185067
695 Ga0207668_10308023
696 Ga0207640_10312050
697 Ga0207658_10119684
698 Ga0207658_10364928
699 Ga0207677_10000144
700 Ga0207677_11859794
701 Ga0207703_12113311
702 Ga0207639_10712575
703 Ga0207708_10039652
704 Ga0207702_10129566
705 Ga0207702_10501343
706 Ga0207641_10001256
707 Ga0207641_10435657
708 Ga0207641_10644039
709 Ga0207648_10137411
710 Ga0207648_12208433
711 Ga0207674_10110396
712 Ga0207674_10357051
713 Ga0207675_100004454
714 Ga0207675_100168282
715 Ga0207675_101910323
716 Ga0207683_10082046
717 Ga0207698_10833262
718 Ga0209974_10064655
719 Ga0207428_10211355
720 Ga0207428_10332807
721 Ga0268266_10358812
722 Ga0268266_11977198
723 Ga0268265_10608189
724 Ga0268265_11243055
725 Ga0268264_10975648
726 Ga0268264_11323192
727 Ga0268264_12140603
728 Ga0265314_10033450
729 Ga0307405_10769557
730 Ga0307413_10064845
731 Ga0307406_10325008
732 Ga0307406_10661754
733 Ga0307407_10421987
734 Ga0307412_10165004
735 Ga0307409_101006769
736 Ga0307409_101398111
737 Ga0307416_103386441
738 Ga0307414_10400796
739 Ga0307414_10591660
740 Ga0307411_10198830
741 Ga0373926_0229824
742 Ga0373934_0068378
743 Ga0373934_0125248
744 Ga0373944_0141715
745 Ga0373923_0050106
746 Ga0373923_0224480
747 Ga0373936_0060358
748 Ga0373953_0021593
749 Ga0373954_0610022
750 Ga0373956_0133318
751 Ga0373957_0058599
752 Ga0373943_0187288
753 Ga0373943_0307166
754 Ga0373955_0421968
755 Ga0373924_0053126
756 Ga0373935_0164595
757 Ga0373935_0208616
758 Ga0373927_0140501
759 Ga0373933_0001259
760 Ga0373933_0016183
761 Ga0373933_0258497
762 Ga0373947_0228280
763 Ga0373937_0012279
764 Ga0373937_0021544
765 Ga0373937_0033768
766 Ga0373937_0074537
767 Ga0373937_0297821
768 Ga0373925_0026663
769 Ga0373925_0304393
770 Ga0373925_0909772
771 Ga0395899_0034960
772 Ga0395900_0079859
773 Ga0395900_0159804
774 Ga0395898_0049228
775 Ga0395905_0039125
776 Ga0436364_0054456
777 Ga0436364_0873741
778 Ga0395901_0083763
779 Ga0395901_0125788
780 Ga0395901_0227418
781 Ga0451789_0687752
782 Ga0451795_0913183
783 Ga0451807_1342101
784 Ga0451835_1253975
785 Ga0451837_1599526
786 Ga0451855_0406718
787 Ga0439441_031141
788 Ga0439443_025149
789 Ga0450923_004832
790 Ga0450907_064736
791 Ga0439444_0077227
792 Ga0451577_0055079
793 Ga0451577_0407867
794 Ga0453683_0007871
795 Ga0453684_0018744
796 Ga0466957_0024416
797 Ga0466958_0590190
798 Ga0466967_2425377
799 Ga0495592_0048336
800 Ga0495592_0238736
801 Ga0495629_0131578
802 Ga0495651_0011597
803 Ga0495651_0051259
804 Ga0495653_0057792
805 Ga0495664_0001049
806 Ga0495608_0010502
807 Ga0495608_0023871
808 Ga0495608_0603872
809 Ga0495618_0205124
810 Ga0495618_0268829
811 Ga0495618_0521271
812 Ga0495628_0108611
813 Ga0495628_0268803
814 Ga0495630_0218573
815 Ga0495642_0404730
816 Ga0495652_0248466
817 Ga0495652_0272516
818 Ga0495652_0381844
819 Ga0495640_0112576
820 Ga0495640_0354992
821 Ga0495587_0009947
822 Ga0495598_0034108
823 Ga0495621_0033556
824 Ga0495645_0002398
825 Ga0495667_0012715
826 Ga0495667_0426859
827 Ga0495635_0244939
828 Ga0495635_0693994
829 Ga0495657_0023610
830 Ga0495599_0021533
831 Ga0495599_0035122
832 Ga0495623_0090066
833 Ga0495646_0010387
834 Ga0495646_0371040
835 Ga0495647_0523508
836 Ga0495613_0671784
837 Ga0495600_0133629
838 Ga0495600_0149712
839 Ga0495600_0580517
840 Ga0495604_0041420
841 Ga0495674_0023171
842 Ga0495674_0109049
843 Ga0495674_0257700
844 Ga0495680_0532761
845 Ga0495675_0062107
846 Ga0495684_0099355
847 Ga0495684_0176238
848 Ga0495593_0405630
849 Ga0495602_0000307
850 Ga0495602_0384876
851 Ga0496104_0290712
852 Ga0496108_0777751
853 Ga0496113_0763444
854 Ga0496126_0696779
855 Ga0501031_0001662
856 Ga0501031_0702416
857 Ga0501032_0173771
858 Ga0501033_0057117
859 Ga0501034_0093599
860 Ga0501034_0176469
861 Ga0501034_0220776
862 Ga0501036_0076442
863 Ga0501036_0479239
864 Ga0501036_1041482
865 Ga0501037_0025449
866 Ga0501037_0121752
867 Ga0501038_0001686
868 Ga0501039_0013831
869 Ga0501040_0329845
870 Ga0501041_0392488
871 Ga0501043_0032977
872 Ga0501068_0111811
873 Ga0501073_0382829
874 Ga0501209_086818
875 Ga0501258_010596
876 Ga0501234_052603
877 Ga0501080_0834524
878 Ga0501083_0911909
879 Ga0501035_0017278
880 Ga0501035_0417846
881 Ga0501044_0101156
882 Ga0501044_0187667
883 nmdc:mga05p37_1050358_c1
884 nmdc:mga09592_1162699_c1
885 nmdc:mga09592_226795_c1
886 nmdc:mga09592_32021_c1
887 nmdc:mga0qj67_110826_c1
888 nmdc:mga0qj67_70577_c1
889 nmdc:mga06r32_728760_c1
890 nmdc:mga08y16_291118_c1
891 nmdc:mga08y16_342398_c1
892 Ga0495601_0001514
893 Ga0495601_0382883
894 Ga0495612_0000760
895 Ga0495595_0182061
896 Ga0495619_0057845
897 Ga0495619_0135751
898 Ga0495619_0620430
899 Ga0587093_034100
900 Ga0587066_155906
901 Ga0587073_0091037
902 Ga0587077_053866
903 Ga0587080_053768
904 Ga0587085_025998
905 Ga0587086_073464
906 Ga0587107_069955
907 Ga0501082_1631370
908 2510840542
909 2885427973
910 8002289982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9748 2 125
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9724 7 125
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9708 1 125
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9558 1 125
3ift-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis, using x-rays from the compact light source. 0.9555 2 123
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9717 7 125 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9671 7 124 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.965 6 123 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9497 20 124 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9482 4 125 2.40.50.100
ID Description Score Start End GO Terms
AF-I4AGP6-F1-model_v4 Glycine cleavage system H protein 0.9998 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A1H9G454-F1-model_v4 Glycine cleavage system H protein 0.9962 1 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A1V6HJK1-F1-model_v4 Glycine cleavage system H protein 0.9935 1 123 GO:0005829
GO:0005960
GO:0016020
GO:0019464
AF-J6GTL1-F1-model_v4 Glycine cleavage system H protein 0.9931 1 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A847ISU1-F1-model_v4 Glycine cleavage system H protein 0.993 1 123 GO:0005829
GO:0005960
GO:0019464

Map