F447423

General Info

Members Datasets Scaffolds Average Seq Length
454 332 908 114

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0033797|Ga0395905_0033797_2448_2831
Length 127
Sequence MGYRAANEMARSEGRVASVDECREALLRLAEKMAANAEEVRGRVDLDRPLTCRLTDLDVAFHGRLAGGRLVDIRDGDDPSAKIKLTTTSDDLVALVDGQLDFARAVAARRVSISANPYDLFKLRKLL

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
129 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
152 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
153 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
154 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
155 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
283 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
284 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
285 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
288 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
289 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
293 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
294 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
295 2643221548 Streptomyces sp. Root55 Isolate Unclassified
296 2643221647 Streptomyces sp. Root369 Isolate Unclassified
297 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
298 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
299 2643221714 Streptomyces sp. Root264 Isolate Unclassified
300 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
301 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
302 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
303 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
304 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
305 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
306 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
307 2867475112 Streptomyces sp. TM32 Isolate Unclassified
308 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
309 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
310 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
311 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
312 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
313 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
314 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
315 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
316 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
317 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
318 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
319 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
320 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
321 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
322 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
323 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
324 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
325 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
326 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
327 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
328 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
329 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
330 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
331 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
332 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.75
Metatranscriptomes 0.22
Isolates 9.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0.88
Rhizoplane 4.41
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0033797 3300037471 Bacteria 4803
2 LJQas_1014578 3300000549 Bacteria 922
3 JGI24739J22299_10022220 3300001989 Bacteria 2253
4 JGI24737J22298_10019292 3300001990 Bacteria 2181
5 rootH1_10034009 3300003316 Bacteria 1392
6 rootL2_10058526 3300003322 Bacteria 6981
7 rootH1_10041470 3300003323 Bacteria 7466
8 Ga0070658_10398275 3300005327 Bacteria 1182
9 Ga0070676_10261605 3300005328 Bacteria 1159
10 Ga0070683_100001179 3300005329 Bacteria 19821
11 Ga0070677_10128695 3300005333 Bacteria 1153
12 Ga0068869_100005670 3300005334 Bacteria 7872
13 Ga0070680_100022934 3300005336 Bacteria 4974
14 Ga0070680_100206862 3300005336 Bacteria 1655
15 Ga0070680_100814751 3300005336 Bacteria 804
16 Ga0070682_100002393 3300005337 Bacteria 10396
17 Ga0068868_100369866 3300005338 Bacteria 1231
18 Ga0070660_100411979 3300005339 Bacteria 1118
19 Ga0070687_101137319 3300005343 Bacteria 573
20 Ga0070661_100072799 3300005344 Bacteria 2529
21 Ga0070668_100757205 3300005347 Bacteria 860
22 Ga0070675_100085615 3300005354 Bacteria 2633
23 Ga0070688_100109093 3300005365 Bacteria 1838
24 Ga0070667_100269369 3300005367 Bacteria 1527
25 Ga0070709_10010447 3300005434 Bacteria 5145
26 Ga0070714_100043814 3300005435 Bacteria 3786
27 Ga0070713_100013322 3300005436 Bacteria 6068
28 Ga0070711_100005299 3300005439 Bacteria 7701
29 Ga0070705_101946772 3300005440 Bacteria 501
30 Ga0070678_100019100 3300005456 Bacteria 4459
31 Ga0070681_10663558 3300005458 Bacteria 958
32 Ga0070681_11097759 3300005458 Bacteria 716
33 Ga0070679_100324915 3300005530 Bacteria 1487
34 Ga0070679_102197203 3300005530 Bacteria 501
35 Ga0070684_100030041 3300005535 Bacteria 4614
36 Ga0068853_101051301 3300005539 Bacteria 785
37 Ga0070686_100364232 3300005544 Bacteria 1090
38 Ga0070665_100444642 3300005548 Bacteria 1306
39 Ga0070664_100063071 3300005564 Bacteria 3160
40 Ga0068857_100162925 3300005577 Bacteria 2024
41 Ga0068857_100642207 3300005577 Bacteria 1005
42 Ga0068856_100013663 3300005614 Bacteria 7852
43 Ga0068856_100313998 3300005614 Bacteria 1585
44 Ga0068864_101195415 3300005618 Bacteria 759
45 Ga0068861_100351213 3300005719 Bacteria 1294
46 Ga0068851_10746318 3300005834 Bacteria 605
47 Ga0068870_10012365 3300005840 Bacteria 3987
48 Ga0068863_100128482 3300005841 Bacteria 2418
49 Ga0068862_100288023 3300005844 Bacteria 1507
50 Ga0081455_10251640 3300005937 Bacteria 1292
51 Ga0081455_10712554 3300005937 Bacteria 638
52 Ga0070717_10039216 3300006028 Bacteria 3854
53 Ga0075368_10032516 3300006042 Bacteria 2027
54 Ga0075363_100168961 3300006048 Bacteria 1241
55 Ga0070716_100693480 3300006173 Bacteria 777
56 Ga0070716_101273325 3300006173 Bacteria 593
57 Ga0075367_10003006 3300006178 Bacteria 7895
58 Ga0075433_11676887 3300006852 Bacteria 548
59 Ga0075434_100094952 3300006871 Bacteria 2987
60 Ga0075429_100094853 3300006880 Bacteria 2602
61 Ga0075436_100027320 3300006914 Bacteria 3928
62 Ga0099826_10027257 3300006948 Bacteria 4201
63 Ga0105251_10028308 3300009011 Bacteria 2833
64 Ga0105250_10083394 3300009092 Bacteria 1297
65 Ga0105240_10733266 3300009093 Bacteria 1076
66 Ga0111539_10083940 3300009094 Bacteria 3745
67 Ga0105245_10218624 3300009098 Bacteria 1837
68 Ga0105247_10361073 3300009101 Bacteria 1024
69 Ga0114129_10495158 3300009147 Bacteria 1597
70 Ga0114129_10764476 3300009147 Bacteria 1236
71 Ga0105243_10426508 3300009148 Bacteria 1238
72 Ga0105243_11820241 3300009148 Bacteria 640
73 Ga0105241_10735010 3300009174 Bacteria 904
74 Ga0105242_12995420 3300009176 Bacteria 523
75 Ga0105248_10535291 3300009177 Bacteria 1321
76 Ga0105237_11770168 3300009545 Bacteria 625
77 Ga0105238_10223247 3300009551 Bacteria 1860
78 Ga0105238_11353527 3300009551 Bacteria 739
79 Ga0105238_12851921 3300009551 Bacteria 520
80 Ga0105249_10173752 3300009553 Bacteria 2091
81 Ga0105249_12218846 3300009553 Bacteria 622
82 Ga0105249_12562594 3300009553 Bacteria 582
83 Ga0105239_10184325 3300010375 Bacteria 2336
84 Ga0105239_11673651 3300010375 Bacteria 736
85 Ga0105246_10031316 3300011119 Bacteria 3519
86 Ga0157338_1043542 3300012515 Bacteria 620
87 Ga0157371_10326205 3300013102 Bacteria 1115
88 Ga0157370_10287292 3300013104 Bacteria 1519
89 Ga0157369_10272221 3300013105 Bacteria 1764
90 Ga0157369_12457477 3300013105 Bacteria 528
91 Ga0157374_10026423 3300013296 Bacteria 5223
92 Ga0163162_10854321 3300013306 Bacteria 1025
93 Ga0157372_10089235 3300013307 Bacteria 3502
94 Ga0157372_11767939 3300013307 Bacteria 711
95 Ga0157375_10284070 3300013308 Bacteria 1818
96 Ga0163163_10691455 3300014325 Bacteria 1083
97 Ga0163163_10725975 3300014325 Bacteria 1057
98 Ga0182008_10002172 3300014497 Bacteria 12480
99 Ga0157377_10050680 3300014745 Bacteria 2339
100 Ga0157379_10303716 3300014968 Bacteria 1455
101 Ga0182007_10000584 3300015262 Bacteria 21416
102 Ga0183367_1010 3300015688 Bacteria 416164
103 Ga0206353_10612025 3300020082 Bacteria 1564
104 Ga0207426_1036447 3300025302 Bacteria 1563
105 Ga0207692_10086541 3300025898 Bacteria 1689
106 Ga0207642_10142282 3300025899 Bacteria 1266
107 Ga0207647_10006160 3300025904 Bacteria 8736
108 Ga0207699_10029141 3300025906 Bacteria 3075
109 Ga0207707_10578219 3300025912 Bacteria 952
110 Ga0207707_10751902 3300025912 Bacteria 815
111 Ga0207693_10070719 3300025915 Bacteria 2731
112 Ga0207663_10143159 3300025916 Bacteria 1668
113 Ga0207660_10162920 3300025917 Bacteria 1722
114 Ga0207657_10182155 3300025919 Bacteria 1698
115 Ga0207694_10405061 3300025924 Bacteria 1134
116 Ga0207694_11768581 3300025924 Bacteria 520
117 Ga0207659_10516701 3300025926 Bacteria 1012
118 Ga0207687_10448368 3300025927 Bacteria 1070
119 Ga0207664_10031953 3300025929 Bacteria 4032
120 Ga0207709_10087757 3300025935 Bacteria 2023
121 Ga0207665_11195244 3300025939 Bacteria 607
122 Ga0207691_10256463 3300025940 Bacteria 1508
123 Ga0207711_10523863 3300025941 Bacteria 1105
124 Ga0207711_10899637 3300025941 Bacteria 823
125 Ga0207689_10001169 3300025942 Bacteria 25272
126 Ga0207661_10657181 3300025944 Bacteria 963
127 Ga0207661_10729785 3300025944 Bacteria 911
128 Ga0207661_11570072 3300025944 Unclassified 602
129 Ga0207679_11022777 3300025945 Bacteria 757
130 Ga0207668_10292893 3300025972 Bacteria 1340
131 Ga0207678_10037807 3300026067 Bacteria 4197
132 Ga0207708_10106707 3300026075 Bacteria 2172
133 Ga0207702_10054135 3300026078 Bacteria 3399
134 Ga0207702_10075544 3300026078 Bacteria 2911
135 Ga0207641_10423298 3300026088 Bacteria 1282
136 Ga0207648_10228003 3300026089 Bacteria 1657
137 Ga0207676_12134881 3300026095 Bacteria 558
138 Ga0207675_100644304 3300026118 Bacteria 1065
139 Ga0207683_10005976 3300026121 Bacteria 10425
140 Ga0209371_1010894 3300027312 Bacteria 2749
141 Ga0209282_1121833 3300027666 Bacteria 1303
142 Ga0268266_10563404 3300028379 Bacteria 1092
143 Ga0268266_10572249 3300028379 Bacteria 1084
144 Ga0307515_10055049 3300028794 Bacteria 5823
145 Ga0268256_1011752 3300030500 Bacteria 2749
146 Ga0307512_10008602 3300030522 Bacteria 9923
147 Ga0307512_10045059 3300030522 Bacteria 3617
148 Ga0307513_10025771 3300031456 Bacteria 6801
149 Ga0307509_10013842 3300031507 Bacteria 9516
150 Ga0307509_10043096 3300031507 Bacteria 4885
151 Ga0307509_10290480 3300031507 Bacteria 1390
152 Ga0307508_10004252 3300031616 Bacteria 14054
153 Ga0307508_10189223 3300031616 Bacteria 1659
154 Ga0307514_10005547 3300031649 Bacteria 11208
155 Ga0307514_10218897 3300031649 Bacteria 1170
156 Ga0307516_10006120 3300031730 Bacteria 14184
157 Ga0307516_10044817 3300031730 Bacteria 4373
158 Ga0307413_11965608 3300031824 Bacteria 526
159 Ga0307518_10071310 3300031838 Bacteria 2516
160 Ga0307518_10097833 3300031838 Bacteria 2104
161 Ga0307518_10278104 3300031838 Bacteria 1038
162 Ga0326468_10035903 3300031889 Bacteria 684
163 Ga0307406_10248387 3300031901 Bacteria 1339
164 Ga0307407_11208614 3300031903 Bacteria 591
165 Ga0307416_100167349 3300032002 Bacteria 2041
166 Ga0307415_100931015 3300032126 Bacteria 803
167 Ga0307415_101866716 3300032126 Bacteria 583
168 Ga0307510_10194946 3300033180 Bacteria 1568
169 Ga0373940_0288070 3300035088 Bacteria 563
170 Ga0395899_0315104 3300037312 Bacteria 1055
171 Ga0395900_0113403 3300037418 Bacteria 2782
172 Ga0395900_0327348 3300037418 Bacteria 1511
173 Ga0395900_0824220 3300037418 Bacteria 855
174 Ga0395898_0002252 3300037466 Bacteria 23420
175 Ga0395898_0014089 3300037466 Bacteria 8217
176 Ga0395898_0411455 3300037466 Bacteria 1289
177 Ga0395898_0439455 3300037466 Bacteria 1243
178 Ga0395898_0942338 3300037466 Bacteria 801
179 Ga0395901_0222421 3300038443 Bacteria 1973
180 Ga0395901_0243184 3300038443 Bacteria 1876
181 Ga0395901_0292904 3300038443 Bacteria 1689
182 Ga0439436_0038094 3300041404 Bacteria 1384
183 Ga0439439_0060612 3300041406 Bacteria 1004
184 Ga0451787_686052 3300041441 Bacteria 1110
185 Ga0451804_0991350 3300041463 Bacteria 753
186 Ga0451835_0132630 3300041492 Bacteria 859
187 Ga0451853_2088911 3300041512 Bacteria 1473
188 Ga0451853_3535122 3300041512 Bacteria 1759
189 Ga0439433_0057157 3300041999 Bacteria 926
190 Ga0439448_0002504 3300042005 Bacteria 5002
191 Ga0439448_0068909 3300042005 Bacteria 1177
192 Ga0439448_0197270 3300042005 Bacteria 705
193 Ga0439432_120834 3300042006 Bacteria 776
194 Ga0439449_0302729 3300042007 Bacteria 604
195 Ga0439457_008228 3300042014 Bacteria 2465
196 Ga0439463_008331 3300042016 Bacteria 2555
197 Ga0450890_012392 3300042127 Bacteria 1106
198 Ga0450902_060684 3300042137 Bacteria 654
199 Ga0450903_000332 3300042138 Bacteria 10381
200 Ga0450906_074423 3300042145 Bacteria 610
201 Ga0439458_0001312 3300042157 Bacteria 6282
202 Ga0439458_0016234 3300042157 Bacteria 1693
203 Ga0439458_0039879 3300042157 Bacteria 1137
204 Ga0439440_0204728 3300042993 Bacteria 586
205 Ga0466965_0007886 3300044683 Bacteria 4910
206 Ga0466965_0512234 3300044683 Bacteria 674
207 Ga0466966_0001647 3300044684 Bacteria 14406
208 Ga0466966_0722157 3300044684 Bacteria 600
209 Ga0466961_0001431 3300044693 Bacteria 14807
210 Ga0466963_0001698 3300044694 Bacteria 11997
211 Ga0466964_0087060 3300044706 Bacteria 1353
212 Ga0466971_0000897 3300044719 Bacteria 12199
213 Ga0466970_0001486 3300044765 Bacteria 11290
214 Ga0466970_0003069 3300044765 Bacteria 8108
215 Ga0466957_0001849 3300044842 Bacteria 11173
216 Ga0466957_0710728 3300044842 Bacteria 710
217 Ga0466960_0225580 3300044901 Bacteria 1032
218 Ga0466960_0421415 3300044901 Bacteria 772
219 Ga0466959_0002793 3300045049 Bacteria 11240
220 Ga0466958_0010504 3300045836 Bacteria 5187
221 Ga0466967_0007428 3300045976 Bacteria 7904
222 Ga0466967_0651699 3300045976 Bacteria 1041
223 Ga0495617_016631 3300046452 Bacteria 2488
224 Ga0495627_017766 3300046453 Bacteria 2410
225 Ga0495592_0007981 3300046454 Bacteria 7943
226 Ga0495603_0007603 3300046455 Bacteria 6521
227 Ga0495603_0011163 3300046455 Bacteria 5446
228 Ga0495603_0013358 3300046455 Bacteria 4968
229 Ga0495603_0033030 3300046455 Bacteria 3113
230 Ga0495590_0099912 3300046457 Bacteria 1030
231 Ga0495629_0005095 3300046459 Bacteria 9823
232 Ga0495629_0016728 3300046459 Bacteria 5263
233 Ga0495629_0024576 3300046459 Bacteria 4290
234 Ga0495629_0085018 3300046459 Bacteria 2207
235 Ga0495629_0765296 3300046459 Bacteria 638
236 Ga0495638_0341420 3300046460 Bacteria 793
237 Ga0495651_0002537 3300046462 Bacteria 14127
238 Ga0495651_0600746 3300046462 Bacteria 694
239 Ga0495653_0363426 3300046463 Bacteria 928
240 Ga0495582_0749818 3300046473 Bacteria 565
241 Ga0495582_0933960 3300046473 Bacteria 501
242 Ga0495605_0034145 3300046474 Bacteria 2577
243 Ga0495639_0012535 3300046475 Bacteria 3657
244 Ga0495662_0001049 3300046476 Bacteria 13572
245 Ga0495662_0075253 3300046476 Bacteria 1638
246 Ga0495664_0001113 3300046477 Bacteria 13913
247 Ga0495664_0022664 3300046477 Bacteria 3642
248 Ga0495584_0138654 3300046491 Bacteria 1235
249 Ga0495594_0002465 3300046499 Bacteria 9631
250 Ga0495594_0005728 3300046499 Bacteria 6385
251 Ga0495594_0262515 3300046499 Bacteria 983
252 Ga0495596_0025122 3300046500 Bacteria 2409
253 Ga0495607_0077942 3300046501 Bacteria 1829
254 Ga0495583_0056036 3300046506 Bacteria 1779
255 Ga0495583_0134790 3300046506 Bacteria 1031
256 Ga0495606_0009912 3300046507 Bacteria 7980
257 Ga0495610_0264243 3300046512 Bacteria 676
258 Ga0495616_0004531 3300046513 Bacteria 8748
259 Ga0495618_0109065 3300046514 Bacteria 1772
260 Ga0495620_0047443 3300046515 Bacteria 1848
261 Ga0495628_0586467 3300046516 Bacteria 797
262 Ga0495630_0009521 3300046517 Bacteria 6988
263 Ga0495630_0316918 3300046517 Bacteria 1192
264 Ga0495630_0667260 3300046517 Bacteria 796
265 Ga0495631_0164562 3300046518 Bacteria 952
266 Ga0495632_0177353 3300046519 Bacteria 977
267 Ga0495637_0045593 3300046520 Bacteria 1859
268 Ga0495643_0006749 3300046522 Bacteria 7506
269 Ga0495643_0217492 3300046522 Bacteria 908
270 Ga0495648_0057982 3300046524 Bacteria 2318
271 Ga0495648_0086686 3300046524 Bacteria 1765
272 Ga0495666_0087447 3300046526 Bacteria 1472
273 Ga0495666_0102276 3300046526 Bacteria 1349
274 Ga0495652_0105636 3300046529 Bacteria 2275
275 Ga0495652_0926075 3300046529 Bacteria 574
276 Ga0495640_0004357 3300046533 Bacteria 11297
277 Ga0495586_0028878 3300046535 Bacteria 2968
278 Ga0495587_0010445 3300046536 Bacteria 5908
279 Ga0495609_0199581 3300046538 Bacteria 837
280 Ga0495645_0908105 3300046543 Bacteria 522
281 Ga0495622_0003595 3300046557 Bacteria 7278
282 Ga0495622_0028376 3300046557 Bacteria 2614
283 Ga0495622_0041059 3300046557 Bacteria 2151
284 Ga0495622_0234148 3300046557 Bacteria 811
285 Ga0495633_0024423 3300046558 Bacteria 2987
286 Ga0495667_0067094 3300046559 Bacteria 2345
287 Ga0495667_0440728 3300046559 Bacteria 819
288 Ga0495668_0019323 3300046616 Bacteria 3928
289 Ga0495668_0096833 3300046616 Bacteria 1614
290 Ga0495634_0002881 3300046642 Bacteria 14112
291 Ga0495611_0173521 3300046648 Bacteria 1007
292 Ga0495625_0112509 3300046660 Bacteria 1860
293 Ga0495625_0163939 3300046660 Bacteria 1487
294 Ga0495635_0003658 3300046663 Bacteria 10664
295 Ga0495635_0263920 3300046663 Bacteria 1159
296 Ga0495661_0032032 3300046665 Bacteria 3327
297 Ga0495588_0002818 3300046674 Bacteria 7471
298 Ga0495588_0021080 3300046674 Bacteria 3208
299 Ga0495588_0039173 3300046674 Bacteria 2413
300 Ga0495657_0000839 3300046675 Bacteria 27194
301 Ga0495657_0001015 3300046675 Bacteria 24750
302 Ga0495657_0041107 3300046675 Bacteria 3166
303 Ga0495623_0285586 3300046679 Bacteria 916
304 Ga0495646_0006126 3300046680 Bacteria 7627
305 Ga0495613_0006172 3300046689 Bacteria 8973
306 Ga0495613_0047500 3300046689 Bacteria 3171
307 Ga0495613_0070801 3300046689 Bacteria 2542
308 Ga0495613_0907386 3300046689 Bacteria 570
309 Ga0495624_0310939 3300046690 Bacteria 949
310 Ga0495670_0024023 3300046691 Bacteria 3010
311 Ga0495649_0075961 3300046694 Bacteria 1798
312 Ga0495589_0018950 3300046794 Bacteria 3529
313 Ga0495589_0031672 3300046794 Bacteria 2662
314 Ga0495589_0476100 3300046794 Bacteria 571
315 Ga0495589_0590771 3300046794 Bacteria 506
316 Ga0495600_0011305 3300046809 Bacteria 5561
317 Ga0495600_0111373 3300046809 Bacteria 1782
318 Ga0495600_0306805 3300046809 Bacteria 1000
319 Ga0495581_0000797 3300047315 Bacteria 16733
320 Ga0495581_0202083 3300047315 Bacteria 1162
321 Ga0495581_0654180 3300047315 Bacteria 607
322 Ga0495604_0000467 3300047317 Bacteria 35655
323 Ga0495604_0137074 3300047317 Bacteria 1752
324 Ga0495636_0019297 3300047318 Bacteria 2740
325 Ga0495674_0032547 3300047319 Bacteria 4729
326 Ga0495676_0007150 3300047321 Bacteria 10244
327 Ga0495676_0014530 3300047321 Bacteria 7044
328 Ga0495676_0176953 3300047321 Bacteria 1497
329 Ga0495683_0102030 3300047323 Bacteria 1378
330 Ga0495687_004066 3300047443 Bacteria 10136
331 Ga0495687_025331 3300047443 Bacteria 2806
332 Ga0495687_038399 3300047443 Bacteria 2125
333 Ga0495675_0032649 3300047444 Bacteria 3322
334 Ga0495675_0134507 3300047444 Bacteria 1535
335 Ga0495677_0210657 3300047445 Bacteria 756
336 Ga0495685_006749 3300047447 Bacteria 3771
337 Ga0495685_028129 3300047447 Bacteria 1934
338 Ga0495685_107260 3300047447 Bacteria 920
339 Ga0495685_135844 3300047447 Bacteria 802
340 Ga0495673_0319909 3300047469 Bacteria 553
341 Ga0495681_0038156 3300047470 Bacteria 2358
342 Ga0495681_0085556 3300047470 Bacteria 1400
343 Ga0495684_0303930 3300047471 Bacteria 1145
344 Ga0495686_0008778 3300047472 Bacteria 7366
345 Ga0495686_0115243 3300047472 Bacteria 1607
346 Ga0495593_0000836 3300047673 Bacteria 17924
347 Ga0495593_0075959 3300047673 Bacteria 1741
348 Ga0495602_0067203 3300048088 Bacteria 3085
349 Ga0495614_0041518 3300048089 Bacteria 1973
350 Ga0495614_0389491 3300048089 Bacteria 653
351 Ga0496101_1025357 3300048904 Bacteria 649
352 Ga0496102_0747735 3300048905 Bacteria 901
353 Ga0496102_1035704 3300048905 Bacteria 741
354 Ga0496104_0047621 3300048907 Bacteria 4040
355 Ga0496105_0061261 3300048908 Bacteria 3105
356 Ga0496105_0772527 3300048908 Bacteria 732
357 Ga0496105_1230491 3300048908 Bacteria 550
358 Ga0496107_0042454 3300048910 Bacteria 3266
359 Ga0496108_0026870 3300048911 Bacteria 4750
360 Ga0496108_0034173 3300048911 Bacteria 4223
361 Ga0496109_0172385 3300048912 Bacteria 2030
362 Ga0496109_0222146 3300048912 Bacteria 1776
363 Ga0496110_0059043 3300048913 Bacteria 3379
364 Ga0496110_0182655 3300048913 Bacteria 1905
365 Ga0496111_0814088 3300048914 Bacteria 675
366 Ga0496112_0255277 3300048915 Bacteria 1703
367 Ga0496112_0310276 3300048915 Bacteria 1523
368 Ga0496113_0039389 3300048916 Bacteria 3478
369 Ga0495678_127921 3300049459 Bacteria 845
370 Ga0495682_0020517 3300049460 Bacteria 2481
371 Ga0501033_0660113 3300049570 Bacteria 714
372 Ga0501034_0041523 3300049571 Bacteria 4654
373 Ga0501036_0036881 3300049572 Bacteria 4136
374 Ga0501036_0247271 3300049572 Bacteria 1495
375 Ga0501038_0000677 3300049574 Bacteria 30374
376 Ga0501046_0319336 3300049580 Bacteria 1132
377 Ga0501047_0136367 3300049581 Bacteria 2334
378 Ga0501047_0206927 3300049581 Bacteria 1821
379 Ga0501047_0331444 3300049581 Bacteria 1360
380 Ga0501048_0291920 3300049582 Bacteria 1160
381 Ga0501069_0312979 3300049585 Bacteria 922
382 Ga0501070_0885137 3300049586 Bacteria 697
383 Ga0501071_0982881 3300049587 Bacteria 652
384 Ga0501223_129926 3300049663 Bacteria 537
385 Ga0501080_0100134 3300049742 Bacteria 2689
386 Ga0501035_0121911 3300049822 Bacteria 2278
387 Ga0501035_0349728 3300049822 Bacteria 1237
388 Ga0501035_0830096 3300049822 Bacteria 736
389 Ga0501044_0128261 3300049823 Bacteria 2532
390 Ga0501044_0924098 3300049823 Bacteria 746
391 nmdc:mga03n38_229783_c1 3300050490 Bacteria 972
392 nmdc:mga06z11_2366_c1 3300050494 Bacteria 7177
393 nmdc:mga04h51_200909_c1 3300050495 Bacteria 783
394 nmdc:mga07m45_618904_c1 3300050496 Bacteria 625
395 nmdc:mga05p37_1604382_c1 3300050507 Bacteria 641
396 nmdc:mga05p37_495813_c1 3300050507 Bacteria 1403
397 nmdc:mga09592_231386_c1 3300050508 Bacteria 1601
398 nmdc:mga06r32_525187_c1 3300050510 Bacteria 1159
399 nmdc:mga0n895_54701_c1 3300050512 Bacteria 3927
400 nmdc:mga0rr50_36485_c1 3300050513 Bacteria 3541
401 nmdc:mga08x19_150081_c1 3300050514 Bacteria 1578
402 Ga0495619_0344934 3300053085 Bacteria 1030
403 Ga0500647_0382137 3300053091 Bacteria 576
404 Ga0500640_004082 3300053095 Bacteria 5246
405 Ga0500572_038190 3300053111 Bacteria 1380
406 Ga0500614_061605 3300053123 Bacteria 1010
407 Ga0500573_0026286 3300053140 Bacteria 3346
408 Ga0500574_168579 3300053141 Bacteria 632
409 Ga0500600_0101290 3300053149 Bacteria 1518
410 Ga0500600_0392112 3300053149 Bacteria 554
411 Ga0500620_299516 3300053155 Bacteria 521
412 Ga0500636_0191902 3300053177 Bacteria 1088
413 Ga0466962_0000087 3300061719 Bacteria 37548
414 2547406828 2547132111 Bacteria 8013147
415 2585303927 2582581313 Bacteria 10042643
416 2585315392 2582581314 Bacteria 11452267
417 2643759864 2643221548 Bacteria 8053412
418 2644268402 2643221647 Bacteria 10741251
419 2644438367 2643221678 Bacteria 9540101
420 2644460439 2643221682 Bacteria 6743283
421 2644629343 2643221714 Bacteria 9015452
422 2785345381 2784746763 Bacteria 9783172
423 2785367504 2784746768 Bacteria 10036182
424 2786668565 2786546132 Bacteria 10419719
425 2808918753 2808606375 Bacteria 9466072
426 2811847272 2808606982 Bacteria 7791042
427 2862289285 2862281513 Bacteria 9621493
428 2862391002 2862382967 Bacteria 10317375
429 2867479107 2867475112 Bacteria 6909112
430 2873157373 2873151551 Bacteria 8625867
431 2875392996 2875391855 Bacteria 7600475
432 2877683039 2877676314 Bacteria 9512378
433 2912722046 2912715099 Bacteria 9460473
434 2912725810 2912723979 Bacteria 8557534
435 2946074225 2946072368 Bacteria 8999607
436 2954388260 2954380949 Bacteria 10050426
437 2954674841 2954673503 Bacteria 9685905
438 2954689292 2954682443 Bacteria 9862841
439 2954699064 2954691527 Bacteria 10720516
440 2954703155 2954701450 Bacteria 10834262
441 2954718019 2954711539 Bacteria 10867210
442 2954727986 2954721474 Bacteria 10456478
443 2954733818 2954731030 Bacteria 10243860
444 2954746883 2954740390 Bacteria 10229294
445 2954752703 2954749733 Bacteria 10366972
446 2954765997 2954759201 Bacteria 9358192
447 2966604069 2966598605 Bacteria 7676064
448 2990065384 2990059506 Bacteria 9321252
449 2997454010 2997451912 Bacteria 8492419
450 3006399804 3006393351 Bacteria 6615579
451 3006495347 3006493962 Bacteria 8825450
452 8008561676 8008558824 Bacteria 10610750
453 8025536941 8025530807 Bacteria 8495698
454 8048411993 8048406513 Bacteria 8936924
455 Ga0395905_0033797
456 LJQas_1014578
457 JGI24739J22299_10022220
458 JGI24737J22298_10019292
459 rootH1_10034009
460 rootL2_10058526
461 rootH1_10041470
462 Ga0070658_10398275
463 Ga0070676_10261605
464 Ga0070683_100001179
465 Ga0070677_10128695
466 Ga0068869_100005670
467 Ga0070680_100022934
468 Ga0070680_100206862
469 Ga0070680_100814751
470 Ga0070682_100002393
471 Ga0068868_100369866
472 Ga0070660_100411979
473 Ga0070687_101137319
474 Ga0070661_100072799
475 Ga0070668_100757205
476 Ga0070675_100085615
477 Ga0070688_100109093
478 Ga0070667_100269369
479 Ga0070709_10010447
480 Ga0070714_100043814
481 Ga0070713_100013322
482 Ga0070711_100005299
483 Ga0070705_101946772
484 Ga0070678_100019100
485 Ga0070681_10663558
486 Ga0070681_11097759
487 Ga0070679_100324915
488 Ga0070679_102197203
489 Ga0070684_100030041
490 Ga0068853_101051301
491 Ga0070686_100364232
492 Ga0070665_100444642
493 Ga0070664_100063071
494 Ga0068857_100162925
495 Ga0068857_100642207
496 Ga0068856_100013663
497 Ga0068856_100313998
498 Ga0068864_101195415
499 Ga0068861_100351213
500 Ga0068851_10746318
501 Ga0068870_10012365
502 Ga0068863_100128482
503 Ga0068862_100288023
504 Ga0081455_10251640
505 Ga0081455_10712554
506 Ga0070717_10039216
507 Ga0075368_10032516
508 Ga0075363_100168961
509 Ga0070716_100693480
510 Ga0070716_101273325
511 Ga0075367_10003006
512 Ga0075433_11676887
513 Ga0075434_100094952
514 Ga0075429_100094853
515 Ga0075436_100027320
516 Ga0099826_10027257
517 Ga0105251_10028308
518 Ga0105250_10083394
519 Ga0105240_10733266
520 Ga0111539_10083940
521 Ga0105245_10218624
522 Ga0105247_10361073
523 Ga0114129_10495158
524 Ga0114129_10764476
525 Ga0105243_10426508
526 Ga0105243_11820241
527 Ga0105241_10735010
528 Ga0105242_12995420
529 Ga0105248_10535291
530 Ga0105237_11770168
531 Ga0105238_10223247
532 Ga0105238_11353527
533 Ga0105238_12851921
534 Ga0105249_10173752
535 Ga0105249_12218846
536 Ga0105249_12562594
537 Ga0105239_10184325
538 Ga0105239_11673651
539 Ga0105246_10031316
540 Ga0157338_1043542
541 Ga0157371_10326205
542 Ga0157370_10287292
543 Ga0157369_10272221
544 Ga0157369_12457477
545 Ga0157374_10026423
546 Ga0163162_10854321
547 Ga0157372_10089235
548 Ga0157372_11767939
549 Ga0157375_10284070
550 Ga0163163_10691455
551 Ga0163163_10725975
552 Ga0182008_10002172
553 Ga0157377_10050680
554 Ga0157379_10303716
555 Ga0182007_10000584
556 Ga0183367_1010
557 Ga0206353_10612025
558 Ga0207426_1036447
559 Ga0207692_10086541
560 Ga0207642_10142282
561 Ga0207647_10006160
562 Ga0207699_10029141
563 Ga0207707_10578219
564 Ga0207707_10751902
565 Ga0207693_10070719
566 Ga0207663_10143159
567 Ga0207660_10162920
568 Ga0207657_10182155
569 Ga0207694_10405061
570 Ga0207694_11768581
571 Ga0207659_10516701
572 Ga0207687_10448368
573 Ga0207664_10031953
574 Ga0207709_10087757
575 Ga0207665_11195244
576 Ga0207691_10256463
577 Ga0207711_10523863
578 Ga0207711_10899637
579 Ga0207689_10001169
580 Ga0207661_10657181
581 Ga0207661_10729785
582 Ga0207661_11570072
583 Ga0207679_11022777
584 Ga0207668_10292893
585 Ga0207678_10037807
586 Ga0207708_10106707
587 Ga0207702_10054135
588 Ga0207702_10075544
589 Ga0207641_10423298
590 Ga0207648_10228003
591 Ga0207676_12134881
592 Ga0207675_100644304
593 Ga0207683_10005976
594 Ga0209371_1010894
595 Ga0209282_1121833
596 Ga0268266_10563404
597 Ga0268266_10572249
598 Ga0307515_10055049
599 Ga0268256_1011752
600 Ga0307512_10008602
601 Ga0307512_10045059
602 Ga0307513_10025771
603 Ga0307509_10013842
604 Ga0307509_10043096
605 Ga0307509_10290480
606 Ga0307508_10004252
607 Ga0307508_10189223
608 Ga0307514_10005547
609 Ga0307514_10218897
610 Ga0307516_10006120
611 Ga0307516_10044817
612 Ga0307413_11965608
613 Ga0307518_10071310
614 Ga0307518_10097833
615 Ga0307518_10278104
616 Ga0326468_10035903
617 Ga0307406_10248387
618 Ga0307407_11208614
619 Ga0307416_100167349
620 Ga0307415_100931015
621 Ga0307415_101866716
622 Ga0307510_10194946
623 Ga0373940_0288070
624 Ga0395899_0315104
625 Ga0395900_0113403
626 Ga0395900_0327348
627 Ga0395900_0824220
628 Ga0395898_0002252
629 Ga0395898_0014089
630 Ga0395898_0411455
631 Ga0395898_0439455
632 Ga0395898_0942338
633 Ga0395901_0222421
634 Ga0395901_0243184
635 Ga0395901_0292904
636 Ga0439436_0038094
637 Ga0439439_0060612
638 Ga0451787_686052
639 Ga0451804_0991350
640 Ga0451835_0132630
641 Ga0451853_2088911
642 Ga0451853_3535122
643 Ga0439433_0057157
644 Ga0439448_0002504
645 Ga0439448_0068909
646 Ga0439448_0197270
647 Ga0439432_120834
648 Ga0439449_0302729
649 Ga0439457_008228
650 Ga0439463_008331
651 Ga0450890_012392
652 Ga0450902_060684
653 Ga0450903_000332
654 Ga0450906_074423
655 Ga0439458_0001312
656 Ga0439458_0016234
657 Ga0439458_0039879
658 Ga0439440_0204728
659 Ga0466965_0007886
660 Ga0466965_0512234
661 Ga0466966_0001647
662 Ga0466966_0722157
663 Ga0466961_0001431
664 Ga0466963_0001698
665 Ga0466964_0087060
666 Ga0466971_0000897
667 Ga0466970_0001486
668 Ga0466970_0003069
669 Ga0466957_0001849
670 Ga0466957_0710728
671 Ga0466960_0225580
672 Ga0466960_0421415
673 Ga0466959_0002793
674 Ga0466958_0010504
675 Ga0466967_0007428
676 Ga0466967_0651699
677 Ga0495617_016631
678 Ga0495627_017766
679 Ga0495592_0007981
680 Ga0495603_0007603
681 Ga0495603_0011163
682 Ga0495603_0013358
683 Ga0495603_0033030
684 Ga0495590_0099912
685 Ga0495629_0005095
686 Ga0495629_0016728
687 Ga0495629_0024576
688 Ga0495629_0085018
689 Ga0495629_0765296
690 Ga0495638_0341420
691 Ga0495651_0002537
692 Ga0495651_0600746
693 Ga0495653_0363426
694 Ga0495582_0749818
695 Ga0495582_0933960
696 Ga0495605_0034145
697 Ga0495639_0012535
698 Ga0495662_0001049
699 Ga0495662_0075253
700 Ga0495664_0001113
701 Ga0495664_0022664
702 Ga0495584_0138654
703 Ga0495594_0002465
704 Ga0495594_0005728
705 Ga0495594_0262515
706 Ga0495596_0025122
707 Ga0495607_0077942
708 Ga0495583_0056036
709 Ga0495583_0134790
710 Ga0495606_0009912
711 Ga0495610_0264243
712 Ga0495616_0004531
713 Ga0495618_0109065
714 Ga0495620_0047443
715 Ga0495628_0586467
716 Ga0495630_0009521
717 Ga0495630_0316918
718 Ga0495630_0667260
719 Ga0495631_0164562
720 Ga0495632_0177353
721 Ga0495637_0045593
722 Ga0495643_0006749
723 Ga0495643_0217492
724 Ga0495648_0057982
725 Ga0495648_0086686
726 Ga0495666_0087447
727 Ga0495666_0102276
728 Ga0495652_0105636
729 Ga0495652_0926075
730 Ga0495640_0004357
731 Ga0495586_0028878
732 Ga0495587_0010445
733 Ga0495609_0199581
734 Ga0495645_0908105
735 Ga0495622_0003595
736 Ga0495622_0028376
737 Ga0495622_0041059
738 Ga0495622_0234148
739 Ga0495633_0024423
740 Ga0495667_0067094
741 Ga0495667_0440728
742 Ga0495668_0019323
743 Ga0495668_0096833
744 Ga0495634_0002881
745 Ga0495611_0173521
746 Ga0495625_0112509
747 Ga0495625_0163939
748 Ga0495635_0003658
749 Ga0495635_0263920
750 Ga0495661_0032032
751 Ga0495588_0002818
752 Ga0495588_0021080
753 Ga0495588_0039173
754 Ga0495657_0000839
755 Ga0495657_0001015
756 Ga0495657_0041107
757 Ga0495623_0285586
758 Ga0495646_0006126
759 Ga0495613_0006172
760 Ga0495613_0047500
761 Ga0495613_0070801
762 Ga0495613_0907386
763 Ga0495624_0310939
764 Ga0495670_0024023
765 Ga0495649_0075961
766 Ga0495589_0018950
767 Ga0495589_0031672
768 Ga0495589_0476100
769 Ga0495589_0590771
770 Ga0495600_0011305
771 Ga0495600_0111373
772 Ga0495600_0306805
773 Ga0495581_0000797
774 Ga0495581_0202083
775 Ga0495581_0654180
776 Ga0495604_0000467
777 Ga0495604_0137074
778 Ga0495636_0019297
779 Ga0495674_0032547
780 Ga0495676_0007150
781 Ga0495676_0014530
782 Ga0495676_0176953
783 Ga0495683_0102030
784 Ga0495687_004066
785 Ga0495687_025331
786 Ga0495687_038399
787 Ga0495675_0032649
788 Ga0495675_0134507
789 Ga0495677_0210657
790 Ga0495685_006749
791 Ga0495685_028129
792 Ga0495685_107260
793 Ga0495685_135844
794 Ga0495673_0319909
795 Ga0495681_0038156
796 Ga0495681_0085556
797 Ga0495684_0303930
798 Ga0495686_0008778
799 Ga0495686_0115243
800 Ga0495593_0000836
801 Ga0495593_0075959
802 Ga0495602_0067203
803 Ga0495614_0041518
804 Ga0495614_0389491
805 Ga0496101_1025357
806 Ga0496102_0747735
807 Ga0496102_1035704
808 Ga0496104_0047621
809 Ga0496105_0061261
810 Ga0496105_0772527
811 Ga0496105_1230491
812 Ga0496107_0042454
813 Ga0496108_0026870
814 Ga0496108_0034173
815 Ga0496109_0172385
816 Ga0496109_0222146
817 Ga0496110_0059043
818 Ga0496110_0182655
819 Ga0496111_0814088
820 Ga0496112_0255277
821 Ga0496112_0310276
822 Ga0496113_0039389
823 Ga0495678_127921
824 Ga0495682_0020517
825 Ga0501033_0660113
826 Ga0501034_0041523
827 Ga0501036_0036881
828 Ga0501036_0247271
829 Ga0501038_0000677
830 Ga0501046_0319336
831 Ga0501047_0136367
832 Ga0501047_0206927
833 Ga0501047_0331444
834 Ga0501048_0291920
835 Ga0501069_0312979
836 Ga0501070_0885137
837 Ga0501071_0982881
838 Ga0501223_129926
839 Ga0501080_0100134
840 Ga0501035_0121911
841 Ga0501035_0349728
842 Ga0501035_0830096
843 Ga0501044_0128261
844 Ga0501044_0924098
845 nmdc:mga03n38_229783_c1
846 nmdc:mga06z11_2366_c1
847 nmdc:mga04h51_200909_c1
848 nmdc:mga07m45_618904_c1
849 nmdc:mga05p37_1604382_c1
850 nmdc:mga05p37_495813_c1
851 nmdc:mga09592_231386_c1
852 nmdc:mga06r32_525187_c1
853 nmdc:mga0n895_54701_c1
854 nmdc:mga0rr50_36485_c1
855 nmdc:mga08x19_150081_c1
856 Ga0495619_0344934
857 Ga0500647_0382137
858 Ga0500640_004082
859 Ga0500572_038190
860 Ga0500614_061605
861 Ga0500573_0026286
862 Ga0500574_168579
863 Ga0500600_0101290
864 Ga0500600_0392112
865 Ga0500620_299516
866 Ga0500636_0191902
867 Ga0466962_0000087
868 2547406828
869 2585303927
870 2585315392
871 2643759864
872 2644268402
873 2644438367
874 2644460439
875 2644629343
876 2785345381
877 2785367504
878 2786668565
879 2808918753
880 2811847272
881 2862289285
882 2862391002
883 2867479107
884 2873157373
885 2875392996
886 2877683039
887 2912722046
888 2912725810
889 2946074225
890 2954388260
891 2954674841
892 2954689292
893 2954699064
894 2954703155
895 2954718019
896 2954727986
897 2954733818
898 2954746883
899 2954752703
900 2954765997
901 2966604069
902 2990065384
903 2997454010
904 3006399804
905 3006495347
906 8008561676
907 8025536941
908 8048411993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tl5-assembly1.cif.gz_B crystal structure of putative hydrolase yjcs from klebsiella pneumoniae. 0.7459 24 110
4nur-assembly1.cif.gz_B crystal structure of thermostable alkylsulfatase sdsap from pseudomonas sp. s9 0.7219 34 110
4av7-assembly3.cif.gz_F structure determination of the double mutant s233y f250g from the sec- alkyl sulfatase pisa1 0.7144 24 112
2cx7-assembly1.cif.gz_A crystal structure of sterol carrier protein 2 0.6967 9 106
3bn8-assembly2.cif.gz_B-2 crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution 0.6936 6 111
ID Description Score Start End Superfamily
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.7573 33 111 3.30.1050.10
af_Q54PA2_138_240_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.7339 5 108 3.30.1050.10
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.693 33 111 3.30.1050.10
4nurB03 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6862 14 110 3.30.1050.10
af_O69728_505_626_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6842 1 112 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A2W6BRB2-F1-model_v4 Alkyl sulfatase C-terminal domain-containing protein 0.9552 1 112
AF-A0A1C6VZJ4-F1-model_v4 SCP-2 sterol transfer family protein 0.9489 1 112
AF-A0A2W6BRB2-F1-model_v4 Alkyl sulfatase C-terminal domain-containing protein 0.9469 1 112
AF-A0A1C6VZJ4-F1-model_v4 SCP-2 sterol transfer family protein 0.9407 1 112
AF-A0A6L5G880-F1-model_v4 Sterol-binding protein 0.9327 1 109

Map