F447260
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 453 | 332 | 906 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0194604|Ga0496102_0194604_27_797 |
| Length | 256 |
| Sequence | MYHDPPLLTPQYARIGGEDTEERRPAAMSGLIDTTEMYLRTILELEEEGITPMRARIAERLEQSGPTVSQTVGRMERDGLLRVAGDRHLELTEEGRRLAVRVMRKHRIAECLLVDVIGLEWEQVHEEACRWEHVMSETVERKVLAMLGHPTQSPYGNPIPGLDELGDTKAEGEGFDAALLTLDSVAGAGSSSVVVRRIGEPIQTDEELMRTLRRAGVRPGATVQVAPAAGGVVVGAGESAAELGKDIAAHVFVAQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 78 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 141 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 147 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 148 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 180 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 181 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 285 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 286 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 287 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 288 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 289 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 290 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 291 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 292 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 293 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 294 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 295 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 296 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 297 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 298 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 299 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 300 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 301 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 302 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 303 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 304 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 305 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 306 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 307 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 308 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 309 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 310 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 311 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 312 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 313 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 314 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 315 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 316 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 317 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 318 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 319 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 320 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 321 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 322 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 323 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 324 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 325 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 326 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 327 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 328 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 329 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 330 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 331 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 332 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.64 |
| Metatranscriptomes | 1.55 |
| Isolates | 10.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 5.08 |
| Rhizoplane | 7.51 |
| Rhizosphere | 77.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0194604 | 3300048905 | Bacteria | 1911 |
| 2 | JGI25404J52841_10031930 | 3300003659 | Bacteria | 1124 |
| 3 | Ga0058863_11339592 | 3300004799 | Bacteria | 932 |
| 4 | Ga0070658_10005443 | 3300005327 | Bacteria | 10324 |
| 5 | Ga0070658_10089621 | 3300005327 | Bacteria | 2533 |
| 6 | Ga0070683_100001875 | 3300005329 | Bacteria | 16424 |
| 7 | Ga0070683_100357112 | 3300005329 | Bacteria | 1392 |
| 8 | Ga0070683_100396684 | 3300005329 | Bacteria | 1316 |
| 9 | Ga0070690_100010990 | 3300005330 | Bacteria | 5285 |
| 10 | Ga0068869_100193756 | 3300005334 | Bacteria | 1599 |
| 11 | Ga0070680_100623405 | 3300005336 | Bacteria | 926 |
| 12 | Ga0070682_100051547 | 3300005337 | Bacteria | 2572 |
| 13 | Ga0070660_100104921 | 3300005339 | Bacteria | 2242 |
| 14 | Ga0070689_100123031 | 3300005340 | Bacteria | 2074 |
| 15 | Ga0070691_10021224 | 3300005341 | Bacteria | 3003 |
| 16 | Ga0070687_100015933 | 3300005343 | Bacteria | 3412 |
| 17 | Ga0070675_100067807 | 3300005354 | Bacteria | 2953 |
| 18 | Ga0070671_100265649 | 3300005355 | Bacteria | 1458 |
| 19 | Ga0070674_100066168 | 3300005356 | Bacteria | 2539 |
| 20 | Ga0070674_100543176 | 3300005356 | Bacteria | 974 |
| 21 | Ga0070673_100096938 | 3300005364 | Bacteria | 2421 |
| 22 | Ga0070659_100039456 | 3300005366 | Bacteria | 3686 |
| 23 | Ga0070703_10111328 | 3300005406 | Bacteria | 980 |
| 24 | Ga0070705_100057677 | 3300005440 | Bacteria | 2292 |
| 25 | Ga0070700_100205361 | 3300005441 | Bacteria | 1387 |
| 26 | Ga0070663_100027325 | 3300005455 | Bacteria | 3874 |
| 27 | Ga0070679_100086039 | 3300005530 | Bacteria | 3130 |
| 28 | Ga0070684_100041323 | 3300005535 | Bacteria | 3975 |
| 29 | Ga0070684_100047536 | 3300005535 | Bacteria | 3718 |
| 30 | Ga0070684_100402146 | 3300005535 | Bacteria | 1263 |
| 31 | Ga0070697_100326585 | 3300005536 | Bacteria | 1322 |
| 32 | Ga0070672_100512343 | 3300005543 | Bacteria | 1039 |
| 33 | Ga0070686_100207717 | 3300005544 | Bacteria | 1408 |
| 34 | Ga0070695_100255925 | 3300005545 | Bacteria | 1276 |
| 35 | Ga0070696_100079816 | 3300005546 | Bacteria | 2316 |
| 36 | Ga0070693_100109559 | 3300005547 | Bacteria | 1696 |
| 37 | Ga0068855_100008457 | 3300005563 | Bacteria | 12446 |
| 38 | Ga0068855_100010104 | 3300005563 | Bacteria | 11374 |
| 39 | Ga0070664_100078767 | 3300005564 | Bacteria | 2835 |
| 40 | Ga0070664_100102069 | 3300005564 | Bacteria | 2495 |
| 41 | Ga0068854_100183599 | 3300005578 | Bacteria | 1635 |
| 42 | Ga0068852_100057763 | 3300005616 | Bacteria | 3358 |
| 43 | Ga0068852_100112939 | 3300005616 | Bacteria | 2473 |
| 44 | Ga0068859_100001508 | 3300005617 | Bacteria | 23752 |
| 45 | Ga0068859_100057701 | 3300005617 | Bacteria | 3910 |
| 46 | Ga0068864_100036663 | 3300005618 | Bacteria | 4181 |
| 47 | Ga0068861_100101831 | 3300005719 | Bacteria | 2285 |
| 48 | Ga0068851_10257126 | 3300005834 | Bacteria | 992 |
| 49 | Ga0068870_10012716 | 3300005840 | Bacteria | 3940 |
| 50 | Ga0068863_100000643 | 3300005841 | Bacteria | 35383 |
| 51 | Ga0068863_100111053 | 3300005841 | Bacteria | 2611 |
| 52 | Ga0068863_100547759 | 3300005841 | Bacteria | 1142 |
| 53 | Ga0068858_100000039 | 3300005842 | Bacteria | 136946 |
| 54 | Ga0068858_100023937 | 3300005842 | Bacteria | 5690 |
| 55 | Ga0068858_100114316 | 3300005842 | Bacteria | 2521 |
| 56 | Ga0068860_100885230 | 3300005843 | Bacteria | 908 |
| 57 | Ga0068862_100000150 | 3300005844 | Bacteria | 79040 |
| 58 | Ga0068862_100690648 | 3300005844 | Bacteria | 988 |
| 59 | Ga0081540_1000402 | 3300005983 | Bacteria | 42843 |
| 60 | Ga0075428_100000807 | 3300006844 | Bacteria | 32731 |
| 61 | Ga0075428_100031735 | 3300006844 | Bacteria | 5835 |
| 62 | Ga0075428_100117825 | 3300006844 | Bacteria | 2893 |
| 63 | Ga0075428_100158331 | 3300006844 | Bacteria | 2459 |
| 64 | Ga0075430_100034469 | 3300006846 | Bacteria | 4296 |
| 65 | Ga0075431_100011440 | 3300006847 | Bacteria | 8942 |
| 66 | Ga0075434_100069387 | 3300006871 | Bacteria | 3514 |
| 67 | Ga0075429_100003536 | 3300006880 | Bacteria | 13310 |
| 68 | Ga0075436_100102838 | 3300006914 | Bacteria | 1990 |
| 69 | Ga0097620_100001508 | 3300006931 | Bacteria | 23752 |
| 70 | Ga0097620_100032460 | 3300006931 | Bacteria | 5245 |
| 71 | Ga0097620_100057699 | 3300006931 | Bacteria | 3910 |
| 72 | Ga0105251_10047697 | 3300009011 | Bacteria | 2057 |
| 73 | Ga0105251_10069849 | 3300009011 | Bacteria | 1637 |
| 74 | Ga0105250_10057791 | 3300009092 | Bacteria | 1556 |
| 75 | Ga0105240_10003545 | 3300009093 | Bacteria | 24217 |
| 76 | Ga0105240_10369693 | 3300009093 | Bacteria | 1622 |
| 77 | Ga0105245_10308294 | 3300009098 | Bacteria | 1556 |
| 78 | Ga0105247_10000519 | 3300009101 | Bacteria | 31547 |
| 79 | Ga0105247_10021234 | 3300009101 | Bacteria | 3907 |
| 80 | Ga0105247_10123486 | 3300009101 | Bacteria | 1680 |
| 81 | Ga0114129_10000024 | 3300009147 | Bacteria | 116794 |
| 82 | Ga0114129_10009554 | 3300009147 | Bacteria | 13833 |
| 83 | Ga0114129_10104550 | 3300009147 | Bacteria | 3913 |
| 84 | Ga0105243_10133515 | 3300009148 | Bacteria | 2109 |
| 85 | Ga0105248_10000866 | 3300009177 | Bacteria | 33994 |
| 86 | Ga0105248_10010791 | 3300009177 | Bacteria | 10086 |
| 87 | Ga0105248_10121137 | 3300009177 | Bacteria | 2951 |
| 88 | Ga0105237_10484272 | 3300009545 | Bacteria | 1243 |
| 89 | Ga0105249_10187699 | 3300009553 | Bacteria | 2015 |
| 90 | Ga0105249_10794378 | 3300009553 | Bacteria | 1010 |
| 91 | Ga0105239_11191716 | 3300010375 | Bacteria | 877 |
| 92 | Ga0157320_1000419 | 3300012481 | Bacteria | 1681 |
| 93 | Ga0157373_10074066 | 3300013100 | Bacteria | 2402 |
| 94 | Ga0157371_10068701 | 3300013102 | Bacteria | 2508 |
| 95 | Ga0157370_10016452 | 3300013104 | Bacteria | 7487 |
| 96 | Ga0157370_10100953 | 3300013104 | Bacteria | 2703 |
| 97 | Ga0157369_10044134 | 3300013105 | Bacteria | 4854 |
| 98 | Ga0157369_10268831 | 3300013105 | Bacteria | 1777 |
| 99 | Ga0157369_10339300 | 3300013105 | Bacteria | 1561 |
| 100 | Ga0157369_10931984 | 3300013105 | Bacteria | 890 |
| 101 | Ga0157374_10695781 | 3300013296 | Bacteria | 1029 |
| 102 | Ga0163162_10173003 | 3300013306 | Bacteria | 2284 |
| 103 | Ga0163162_10859359 | 3300013306 | Bacteria | 1022 |
| 104 | Ga0157372_10187206 | 3300013307 | Bacteria | 2397 |
| 105 | Ga0157375_10087170 | 3300013308 | Bacteria | 3173 |
| 106 | Ga0163163_10012689 | 3300014325 | Bacteria | 7686 |
| 107 | Ga0163163_10076455 | 3300014325 | Bacteria | 3343 |
| 108 | Ga0163163_10086098 | 3300014325 | Bacteria | 3151 |
| 109 | Ga0157380_10043855 | 3300014326 | Bacteria | 3503 |
| 110 | Ga0157379_10000288 | 3300014968 | Bacteria | 39832 |
| 111 | Ga0157379_10029041 | 3300014968 | Bacteria | 4917 |
| 112 | Ga0157379_10037097 | 3300014968 | Bacteria | 4346 |
| 113 | Ga0163161_10035827 | 3300017792 | Bacteria | 3552 |
| 114 | Ga0197907_10100242 | 3300020069 | Bacteria | 2117 |
| 115 | Ga0206355_1618483 | 3300020076 | Bacteria | 934 |
| 116 | Ga0206350_10045767 | 3300020080 | Bacteria | 1305 |
| 117 | Ga0206354_11503868 | 3300020081 | Bacteria | 1143 |
| 118 | Ga0206353_11866792 | 3300020082 | Bacteria | 1184 |
| 119 | Ga0213876_10002948 | 3300021384 | Bacteria | 9857 |
| 120 | Ga0207656_10169553 | 3300025321 | Bacteria | 1043 |
| 121 | Ga0207710_10000127 | 3300025900 | Bacteria | 92787 |
| 122 | Ga0207710_10000366 | 3300025900 | Bacteria | 31620 |
| 123 | Ga0207710_10315630 | 3300025900 | Bacteria | 792 |
| 124 | Ga0207688_10032138 | 3300025901 | Bacteria | 2899 |
| 125 | Ga0207699_10051347 | 3300025906 | Bacteria | 2436 |
| 126 | Ga0207645_10078645 | 3300025907 | Bacteria | 2113 |
| 127 | Ga0207643_10053293 | 3300025908 | Bacteria | 2298 |
| 128 | Ga0207705_10035474 | 3300025909 | Bacteria | 3568 |
| 129 | Ga0207705_10071157 | 3300025909 | Bacteria | 2521 |
| 130 | Ga0207705_10171797 | 3300025909 | Bacteria | 1632 |
| 131 | Ga0207684_10848040 | 3300025910 | Bacteria | 770 |
| 132 | Ga0207654_10213409 | 3300025911 | Bacteria | 1277 |
| 133 | Ga0207707_10566377 | 3300025912 | Bacteria | 964 |
| 134 | Ga0207695_10013572 | 3300025913 | Bacteria | 9704 |
| 135 | Ga0207695_10722995 | 3300025913 | Bacteria | 876 |
| 136 | Ga0207693_10022418 | 3300025915 | Bacteria | 5018 |
| 137 | Ga0207662_10003543 | 3300025918 | Bacteria | 8048 |
| 138 | Ga0207657_10021811 | 3300025919 | Bacteria | 6016 |
| 139 | Ga0207652_10103740 | 3300025921 | Bacteria | 2514 |
| 140 | Ga0207681_10420262 | 3300025923 | Bacteria | 1083 |
| 141 | Ga0207650_10670863 | 3300025925 | Bacteria | 875 |
| 142 | Ga0207659_10034914 | 3300025926 | Bacteria | 3472 |
| 143 | Ga0207700_10050655 | 3300025928 | Bacteria | 3095 |
| 144 | Ga0207664_10331528 | 3300025929 | Bacteria | 1344 |
| 145 | Ga0207706_10069709 | 3300025933 | Bacteria | 3092 |
| 146 | Ga0207709_10168382 | 3300025935 | Bacteria | 1535 |
| 147 | Ga0207704_10027505 | 3300025938 | Bacteria | 3140 |
| 148 | Ga0207691_10017441 | 3300025940 | Bacteria | 6810 |
| 149 | Ga0207711_10000293 | 3300025941 | Bacteria | 53424 |
| 150 | Ga0207711_10003201 | 3300025941 | Bacteria | 14270 |
| 151 | Ga0207711_10550851 | 3300025941 | Bacteria | 1076 |
| 152 | Ga0207689_10014481 | 3300025942 | Bacteria | 6710 |
| 153 | Ga0207661_10166493 | 3300025944 | Bacteria | 1916 |
| 154 | Ga0207679_10038099 | 3300025945 | Bacteria | 3423 |
| 155 | Ga0207679_10040207 | 3300025945 | Bacteria | 3346 |
| 156 | Ga0207667_10019922 | 3300025949 | Bacteria | 7475 |
| 157 | Ga0207667_10071615 | 3300025949 | Bacteria | 3603 |
| 158 | Ga0207667_10171454 | 3300025949 | Bacteria | 2230 |
| 159 | Ga0207712_10116269 | 3300025961 | Bacteria | 2015 |
| 160 | Ga0207668_10153327 | 3300025972 | Bacteria | 1787 |
| 161 | Ga0207703_10000039 | 3300026035 | Bacteria | 170322 |
| 162 | Ga0207703_10119978 | 3300026035 | Bacteria | 2256 |
| 163 | Ga0207639_10129039 | 3300026041 | Bacteria | 2090 |
| 164 | Ga0207678_10004697 | 3300026067 | Bacteria | 12253 |
| 165 | Ga0207708_10054761 | 3300026075 | Bacteria | 3041 |
| 166 | Ga0207702_10014473 | 3300026078 | Bacteria | 6551 |
| 167 | Ga0207641_10010806 | 3300026088 | Bacteria | 7483 |
| 168 | Ga0207648_10017887 | 3300026089 | Bacteria | 6431 |
| 169 | Ga0207674_10021199 | 3300026116 | Bacteria | 7005 |
| 170 | Ga0207675_100039165 | 3300026118 | Bacteria | 4423 |
| 171 | Ga0207683_10004059 | 3300026121 | Bacteria | 12651 |
| 172 | Ga0207698_10784137 | 3300026142 | Bacteria | 954 |
| 173 | Ga0268265_10000276 | 3300028380 | Bacteria | 58368 |
| 174 | Ga0268265_10147593 | 3300028380 | Bacteria | 1979 |
| 175 | Ga0268264_10170250 | 3300028381 | Bacteria | 1969 |
| 176 | Ga0307515_10072815 | 3300028794 | Bacteria | 4629 |
| 177 | Ga0265338_10026039 | 3300028800 | Bacteria | 5914 |
| 178 | Ga0265325_10020066 | 3300031241 | Bacteria | 3688 |
| 179 | Ga0265325_10051368 | 3300031241 | Bacteria | 2119 |
| 180 | Ga0265340_10030553 | 3300031247 | Bacteria | 2699 |
| 181 | Ga0265339_10035517 | 3300031249 | Bacteria | 2795 |
| 182 | Ga0265316_10155051 | 3300031344 | Bacteria | 1714 |
| 183 | Ga0307513_10007773 | 3300031456 | Bacteria | 13836 |
| 184 | Ga0307408_100886120 | 3300031548 | Bacteria | 816 |
| 185 | Ga0265313_10111223 | 3300031595 | Bacteria | 1204 |
| 186 | Ga0307508_10044053 | 3300031616 | Bacteria | 3994 |
| 187 | Ga0307508_10081409 | 3300031616 | Bacteria | 2819 |
| 188 | Ga0307508_10140724 | 3300031616 | Bacteria | 2016 |
| 189 | Ga0265314_10020747 | 3300031711 | Bacteria | 5070 |
| 190 | Ga0265342_10031223 | 3300031712 | Bacteria | 3295 |
| 191 | Ga0307405_10345300 | 3300031731 | Bacteria | 1146 |
| 192 | Ga0307406_10055962 | 3300031901 | Bacteria | 2523 |
| 193 | Ga0307406_10547208 | 3300031901 | Bacteria | 946 |
| 194 | Ga0307407_10003495 | 3300031903 | Bacteria | 6463 |
| 195 | Ga0307412_10011952 | 3300031911 | Bacteria | 5044 |
| 196 | Ga0307409_100002991 | 3300031995 | Bacteria | 9014 |
| 197 | Ga0307416_100000174 | 3300032002 | Bacteria | 35948 |
| 198 | Ga0307416_100370578 | 3300032002 | Bacteria | 1458 |
| 199 | Ga0307416_100410337 | 3300032002 | Bacteria | 1395 |
| 200 | Ga0307416_100424972 | 3300032002 | Bacteria | 1374 |
| 201 | Ga0307414_10325030 | 3300032004 | Bacteria | 1311 |
| 202 | Ga0307415_100000183 | 3300032126 | Bacteria | 27846 |
| 203 | Ga0307415_100032058 | 3300032126 | Bacteria | 3394 |
| 204 | Ga0307415_100107078 | 3300032126 | Bacteria | 2065 |
| 205 | Ga0373938_0003199 | 3300034957 | Bacteria | 2663 |
| 206 | Ga0373926_0002798 | 3300035083 | Bacteria | 5567 |
| 207 | Ga0373928_0003128 | 3300035084 | Bacteria | 3175 |
| 208 | Ga0373934_0006688 | 3300035086 | Bacteria | 4284 |
| 209 | Ga0373934_0235833 | 3300035086 | Bacteria | 755 |
| 210 | Ga0373940_0012766 | 3300035088 | Bacteria | 2018 |
| 211 | Ga0373944_0006217 | 3300035089 | Bacteria | 3166 |
| 212 | Ga0373949_0007038 | 3300035090 | Bacteria | 2468 |
| 213 | Ga0373952_0059436 | 3300035092 | Bacteria | 931 |
| 214 | Ga0373923_0036531 | 3300035111 | Bacteria | 2005 |
| 215 | Ga0373936_0000919 | 3300035113 | Bacteria | 10518 |
| 216 | Ga0373945_0002162 | 3300035116 | Bacteria | 6131 |
| 217 | Ga0373953_0004383 | 3300035117 | Bacteria | 4496 |
| 218 | Ga0373957_0017869 | 3300035120 | Bacteria | 2476 |
| 219 | Ga0373943_0002809 | 3300035170 | Bacteria | 7913 |
| 220 | Ga0373946_0000154 | 3300035171 | Bacteria | 20777 |
| 221 | Ga0373955_0002313 | 3300035172 | Bacteria | 8292 |
| 222 | Ga0373961_0006511 | 3300035241 | Bacteria | 2805 |
| 223 | Ga0373924_0054737 | 3300035410 | Bacteria | 1659 |
| 224 | Ga0373931_0169766 | 3300035691 | Bacteria | 1284 |
| 225 | Ga0373935_0012119 | 3300035692 | Bacteria | 5184 |
| 226 | Ga0373927_0025005 | 3300035695 | Bacteria | 3904 |
| 227 | Ga0373933_0005412 | 3300035724 | Bacteria | 6947 |
| 228 | Ga0373947_0007978 | 3300035725 | Bacteria | 6104 |
| 229 | Ga0373937_0449550 | 3300036401 | Bacteria | 1223 |
| 230 | Ga0373937_0545253 | 3300036401 | Bacteria | 1101 |
| 231 | Ga0372808_007129 | 3300036459 | Bacteria | 1523 |
| 232 | Ga0373925_0008864 | 3300037068 | Bacteria | 7328 |
| 233 | Ga0395899_0117863 | 3300037312 | Bacteria | 1904 |
| 234 | Ga0395900_0437335 | 3300037418 | Bacteria | 1266 |
| 235 | Ga0395898_0028177 | 3300037466 | Bacteria | 5632 |
| 236 | Ga0436364_1540925 | 3300037853 | Bacteria | 823 |
| 237 | Ga0395901_0019156 | 3300038443 | Bacteria | 6997 |
| 238 | Ga0436365_0067462 | 3300039437 | Bacteria | 21062 |
| 239 | Ga0451853_0491630 | 3300041512 | Bacteria | 3954 |
| 240 | Ga0450903_031831 | 3300042138 | Bacteria | 795 |
| 241 | Ga0466961_0072842 | 3300044693 | Bacteria | 2179 |
| 242 | Ga0466961_0132824 | 3300044693 | Bacteria | 1560 |
| 243 | Ga0466963_0081091 | 3300044694 | Bacteria | 2197 |
| 244 | Ga0466963_0167112 | 3300044694 | Bacteria | 1532 |
| 245 | Ga0466963_0511770 | 3300044694 | Bacteria | 848 |
| 246 | Ga0466971_0052718 | 3300044719 | Bacteria | 1832 |
| 247 | Ga0466957_0235306 | 3300044842 | Bacteria | 1214 |
| 248 | Ga0466958_0002916 | 3300045836 | Bacteria | 8740 |
| 249 | Ga0466958_0060333 | 3300045836 | Bacteria | 2309 |
| 250 | Ga0466967_0060270 | 3300045976 | Bacteria | 3362 |
| 251 | Ga0466967_0061328 | 3300045976 | Bacteria | 3336 |
| 252 | Ga0466967_0204220 | 3300045976 | Bacteria | 1872 |
| 253 | Ga0495592_0098992 | 3300046454 | Bacteria | 2080 |
| 254 | Ga0495603_0006626 | 3300046455 | Bacteria | 6947 |
| 255 | Ga0495629_0000814 | 3300046459 | Bacteria | 25253 |
| 256 | Ga0495641_0007645 | 3300046461 | Bacteria | 6712 |
| 257 | Ga0495651_0141191 | 3300046462 | Bacteria | 1746 |
| 258 | Ga0495651_0310591 | 3300046462 | Bacteria | 1054 |
| 259 | Ga0495580_0005898 | 3300046472 | Bacteria | 10055 |
| 260 | Ga0495582_0003160 | 3300046473 | Bacteria | 9247 |
| 261 | Ga0495639_0000844 | 3300046475 | Bacteria | 13949 |
| 262 | Ga0495662_0004738 | 3300046476 | Bacteria | 6815 |
| 263 | Ga0495662_0014871 | 3300046476 | Bacteria | 3782 |
| 264 | Ga0495664_0002002 | 3300046477 | Bacteria | 10872 |
| 265 | Ga0495594_0055977 | 3300046499 | Bacteria | 2175 |
| 266 | Ga0495594_0128545 | 3300046499 | Bacteria | 1434 |
| 267 | Ga0495594_0188435 | 3300046499 | Bacteria | 1175 |
| 268 | Ga0495608_0097091 | 3300046511 | Bacteria | 1902 |
| 269 | Ga0495608_0301624 | 3300046511 | Bacteria | 991 |
| 270 | Ga0495628_0022606 | 3300046516 | Bacteria | 5164 |
| 271 | Ga0495628_0550499 | 3300046516 | Bacteria | 828 |
| 272 | Ga0495630_0056074 | 3300046517 | Bacteria | 2952 |
| 273 | Ga0495632_0075312 | 3300046519 | Bacteria | 1615 |
| 274 | Ga0495648_0024376 | 3300046524 | Bacteria | 4122 |
| 275 | Ga0495666_0003615 | 3300046526 | Bacteria | 7810 |
| 276 | Ga0495652_0036153 | 3300046529 | Bacteria | 4295 |
| 277 | Ga0495665_0007595 | 3300046531 | Bacteria | 5871 |
| 278 | Ga0495640_0011073 | 3300046533 | Bacteria | 6943 |
| 279 | Ga0495586_0007118 | 3300046535 | Bacteria | 5960 |
| 280 | Ga0495645_0082377 | 3300046543 | Bacteria | 2307 |
| 281 | Ga0495645_0473580 | 3300046543 | Bacteria | 787 |
| 282 | Ga0495657_0094660 | 3300046675 | Bacteria | 1910 |
| 283 | Ga0495599_0017752 | 3300046678 | Bacteria | 4427 |
| 284 | Ga0495623_0015738 | 3300046679 | Bacteria | 4888 |
| 285 | Ga0495623_0073671 | 3300046679 | Bacteria | 2122 |
| 286 | Ga0495646_0009951 | 3300046680 | Bacteria | 6044 |
| 287 | Ga0495647_0024868 | 3300046681 | Bacteria | 2183 |
| 288 | Ga0495658_0002286 | 3300046683 | Bacteria | 9662 |
| 289 | Ga0495613_0002511 | 3300046689 | Bacteria | 13827 |
| 290 | Ga0495624_0006156 | 3300046690 | Bacteria | 8543 |
| 291 | Ga0495600_0006168 | 3300046809 | Bacteria | 7269 |
| 292 | Ga0495581_0002875 | 3300047315 | Bacteria | 9839 |
| 293 | Ga0495604_0001392 | 3300047317 | Bacteria | 19838 |
| 294 | Ga0495604_0006758 | 3300047317 | Bacteria | 9099 |
| 295 | Ga0495674_0033404 | 3300047319 | Bacteria | 4660 |
| 296 | Ga0495676_0017126 | 3300047321 | Bacteria | 6412 |
| 297 | Ga0495680_0070146 | 3300047322 | Bacteria | 2672 |
| 298 | Ga0495675_0001113 | 3300047444 | Bacteria | 16331 |
| 299 | Ga0495685_031843 | 3300047447 | Bacteria | 1812 |
| 300 | Ga0495684_0024490 | 3300047471 | Bacteria | 4646 |
| 301 | Ga0495593_0014307 | 3300047673 | Bacteria | 4511 |
| 302 | Ga0495602_0079324 | 3300048088 | Bacteria | 2769 |
| 303 | Ga0495602_0452050 | 3300048088 | Bacteria | 906 |
| 304 | Ga0496100_0032418 | 3300048903 | Bacteria | 3259 |
| 305 | Ga0496100_0064273 | 3300048903 | Bacteria | 2428 |
| 306 | Ga0496100_0071077 | 3300048903 | Bacteria | 2322 |
| 307 | Ga0496102_0025371 | 3300048905 | Bacteria | 5277 |
| 308 | Ga0496102_0168137 | 3300048905 | Bacteria | 2064 |
| 309 | Ga0496102_0864216 | 3300048905 | Bacteria | 826 |
| 310 | Ga0496103_0224992 | 3300048906 | Bacteria | 1206 |
| 311 | Ga0496104_0060208 | 3300048907 | Bacteria | 3597 |
| 312 | Ga0496104_0153038 | 3300048907 | Bacteria | 2214 |
| 313 | Ga0496104_0155313 | 3300048907 | Bacteria | 2196 |
| 314 | Ga0496105_0025843 | 3300048908 | Bacteria | 4783 |
| 315 | Ga0496105_0117184 | 3300048908 | Bacteria | 2197 |
| 316 | Ga0496105_0496818 | 3300048908 | Bacteria | 958 |
| 317 | Ga0496105_0609843 | 3300048908 | Bacteria | 846 |
| 318 | Ga0496106_0225349 | 3300048909 | Bacteria | 1495 |
| 319 | Ga0496107_0117969 | 3300048910 | Bacteria | 1954 |
| 320 | Ga0496108_0036119 | 3300048911 | Bacteria | 4109 |
| 321 | Ga0496108_0105545 | 3300048911 | Bacteria | 2405 |
| 322 | Ga0496109_0112435 | 3300048912 | Bacteria | 2532 |
| 323 | Ga0496110_0130899 | 3300048913 | Bacteria | 2265 |
| 324 | Ga0496110_0693465 | 3300048913 | Bacteria | 919 |
| 325 | Ga0496111_0056839 | 3300048914 | Bacteria | 2831 |
| 326 | Ga0496111_0061655 | 3300048914 | Bacteria | 2718 |
| 327 | Ga0496112_0010964 | 3300048915 | Bacteria | 8254 |
| 328 | Ga0496112_0040596 | 3300048915 | Bacteria | 4550 |
| 329 | Ga0496112_0066055 | 3300048915 | Bacteria | 3569 |
| 330 | Ga0496113_0163887 | 3300048916 | Bacteria | 1758 |
| 331 | Ga0496114_0001036 | 3300048917 | Bacteria | 20908 |
| 332 | Ga0496114_0025352 | 3300048917 | Bacteria | 4847 |
| 333 | Ga0496114_0091474 | 3300048917 | Bacteria | 2584 |
| 334 | Ga0496114_0196569 | 3300048917 | Bacteria | 1765 |
| 335 | Ga0496115_0016582 | 3300048918 | Bacteria | 5612 |
| 336 | Ga0496116_0000922 | 3300048919 | Bacteria | 36312 |
| 337 | Ga0496117_0008325 | 3300048920 | Bacteria | 9870 |
| 338 | Ga0496117_0095158 | 3300048920 | Bacteria | 1904 |
| 339 | Ga0496118_0003795 | 3300048921 | Bacteria | 18635 |
| 340 | Ga0496118_0004523 | 3300048921 | Bacteria | 16429 |
| 341 | Ga0496119_0001025 | 3300048922 | Bacteria | 35816 |
| 342 | Ga0496119_0020018 | 3300048922 | Bacteria | 4898 |
| 343 | Ga0496119_0307543 | 3300048922 | Bacteria | 779 |
| 344 | Ga0496120_0000672 | 3300048923 | Bacteria | 50278 |
| 345 | Ga0496121_0008952 | 3300048924 | Bacteria | 11618 |
| 346 | Ga0496125_0366094 | 3300048928 | Bacteria | 855 |
| 347 | Ga0496126_0139448 | 3300048929 | Bacteria | 2089 |
| 348 | Ga0501032_0007123 | 3300049569 | Bacteria | 8188 |
| 349 | Ga0501034_0315259 | 3300049571 | Bacteria | 1498 |
| 350 | Ga0501036_0010617 | 3300049572 | Bacteria | 7608 |
| 351 | Ga0501036_0110539 | 3300049572 | Bacteria | 2322 |
| 352 | Ga0501037_0015156 | 3300049573 | Bacteria | 5673 |
| 353 | Ga0501039_0034996 | 3300049575 | Bacteria | 3876 |
| 354 | Ga0501039_0158134 | 3300049575 | Bacteria | 1781 |
| 355 | Ga0501039_0551180 | 3300049575 | Bacteria | 905 |
| 356 | Ga0501041_0075623 | 3300049577 | Bacteria | 2071 |
| 357 | Ga0501043_0133103 | 3300049579 | Bacteria | 1948 |
| 358 | Ga0501043_0164196 | 3300049579 | Bacteria | 1734 |
| 359 | Ga0501043_0232362 | 3300049579 | Bacteria | 1424 |
| 360 | Ga0501047_0106424 | 3300049581 | Bacteria | 2685 |
| 361 | Ga0501048_0076095 | 3300049582 | Bacteria | 2369 |
| 362 | Ga0501069_0013514 | 3300049585 | Bacteria | 4353 |
| 363 | Ga0501069_0121681 | 3300049585 | Bacteria | 1491 |
| 364 | Ga0501070_0002483 | 3300049586 | Bacteria | 16167 |
| 365 | Ga0501070_0009284 | 3300049586 | Bacteria | 8319 |
| 366 | Ga0501070_0026903 | 3300049586 | Bacteria | 4824 |
| 367 | Ga0501070_0266581 | 3300049586 | Bacteria | 1399 |
| 368 | Ga0501070_0500007 | 3300049586 | Bacteria | 977 |
| 369 | Ga0501071_0030420 | 3300049587 | Bacteria | 3819 |
| 370 | Ga0501072_0019092 | 3300049588 | Bacteria | 5295 |
| 371 | Ga0501074_0020237 | 3300049590 | Bacteria | 4835 |
| 372 | Ga0501074_0057561 | 3300049590 | Bacteria | 2800 |
| 373 | Ga0501075_0569121 | 3300049591 | Bacteria | 864 |
| 374 | Ga0501076_0041875 | 3300049592 | Bacteria | 3606 |
| 375 | Ga0501079_0013828 | 3300049741 | Bacteria | 6155 |
| 376 | Ga0501080_0013977 | 3300049742 | Bacteria | 7389 |
| 377 | Ga0501080_0017570 | 3300049742 | Bacteria | 6613 |
| 378 | Ga0501035_0003825 | 3300049822 | Bacteria | 14346 |
| 379 | Ga0501035_0174597 | 3300049822 | Bacteria | 1854 |
| 380 | Ga0501044_0009182 | 3300049823 | Bacteria | 10799 |
| 381 | Ga0501044_0009930 | 3300049823 | Bacteria | 10340 |
| 382 | Ga0501044_0077900 | 3300049823 | Bacteria | 3360 |
| 383 | Ga0501045_0138646 | 3300049824 | Bacteria | 1809 |
| 384 | nmdc:mga00v17_117663_c1 | 3300050491 | Bacteria | 1690 |
| 385 | nmdc:mga05p37_1984_c1 | 3300050507 | Bacteria | 23864 |
| 386 | nmdc:mga05p37_24_c1 | 3300050507 | Bacteria | 118187 |
| 387 | nmdc:mga05p37_660750_c1 | 3300050507 | Bacteria | 1168 |
| 388 | nmdc:mga05p37_82975_c1 | 3300050507 | Bacteria | 3949 |
| 389 | nmdc:mga09592_205154_c1 | 3300050508 | Bacteria | 1707 |
| 390 | nmdc:mga09592_2_c1 | 3300050508 | Bacteria | 168133 |
| 391 | nmdc:mga0qj67_10_c1 | 3300050509 | Bacteria | 83362 |
| 392 | nmdc:mga06r32_343_c1 | 3300050510 | Bacteria | 38821 |
| 393 | nmdc:mga06r32_397929_c1 | 3300050510 | Bacteria | 1359 |
| 394 | Ga0495601_0010597 | 3300053077 | Bacteria | 5491 |
| 395 | Ga0495612_0006076 | 3300053078 | Bacteria | 4970 |
| 396 | Ga0495619_0003152 | 3300053085 | Bacteria | 10695 |
| 397 | Ga0500644_0056524 | 3300053088 | Bacteria | 1366 |
| 398 | Ga0500583_0156958 | 3300053092 | Bacteria | 1133 |
| 399 | Ga0500568_0001331 | 3300053139 | Bacteria | 16180 |
| 400 | Ga0500616_0123294 | 3300053153 | Bacteria | 1234 |
| 401 | Ga0501082_0438847 | 3300060353 | Bacteria | 1140 |
| 402 | Ga0466962_0026437 | 3300061719 | Bacteria | 2786 |
| 403 | Ga0530510_0116030 | 3300061734 | Bacteria | 1963 |
| 404 | Ga0530510_0170537 | 3300061734 | Bacteria | 1612 |
| 405 | 2506864634 | 2506783011 | Bacteria | 5323186 |
| 406 | 2508670829 | 2508501039 | Bacteria | 9978592 |
| 407 | 2517762370 | 2517572101 | Bacteria | 6884336 |
| 408 | 2528204172 | 2527291627 | Bacteria | 5309833 |
| 409 | 2528214690 | 2527291629 | Bacteria | 5267418 |
| 410 | 2546947067 | 2546825537 | Bacteria | 5389291 |
| 411 | 2579747427 | 2576861822 | Bacteria | 5004595 |
| 412 | 2579857432 | 2579778521 | Bacteria | 7624758 |
| 413 | 2619853931 | 2619618881 | Bacteria | 7521104 |
| 414 | 2620353234 | 2619619003 | Bacteria | 7619552 |
| 415 | 2644017187 | 2643221601 | Bacteria | 7493239 |
| 416 | 2644173852 | 2643221631 | Bacteria | 8168043 |
| 417 | 2671835911 | 2671180195 | Bacteria | 9757215 |
| 418 | 2676201153 | 2675902999 | Bacteria | 9438463 |
| 419 | 2686539806 | 2684623035 | Bacteria | 8032739 |
| 420 | 2686543424 | 2684623036 | Bacteria | 5199090 |
| 421 | 2689959152 | 2687453737 | Bacteria | 11203906 |
| 422 | 2689992185 | 2687453743 | Bacteria | 8361025 |
| 423 | 2710603449 | 2710264753 | Bacteria | 5455564 |
| 424 | 2753070194 | 2751185734 | Bacteria | 8863695 |
| 425 | 2768644728 | 2767802112 | Bacteria | 6465194 |
| 426 | 2774845729 | 2773857921 | Bacteria | 9435764 |
| 427 | 2774854067 | 2773857922 | Bacteria | 9757215 |
| 428 | 2774867189 | 2773857924 | Bacteria | 5256821 |
| 429 | 2774904946 | 2773857933 | Bacteria | 5818019 |
| 430 | 2784588931 | 2784132148 | Bacteria | 8627943 |
| 431 | 2809232550 | 2808606448 | Bacteria | 8656184 |
| 432 | 2819741150 | 2818991472 | Bacteria | 10089953 |
| 433 | 2831938042 | 2831935698 | Bacteria | 5963223 |
| 434 | 2832007650 | 2832004796 | Bacteria | 6538017 |
| 435 | 2866065427 | 2866065130 | Bacteria | 6518152 |
| 436 | 2867507882 | 2867507094 | Bacteria | 6506033 |
| 437 | 2870730002 | 2870721527 | Bacteria | 9689237 |
| 438 | 2895885683 | 2895880812 | Bacteria | 11255272 |
| 439 | 2977251700 | 2977251589 | Bacteria | 2952848 |
| 440 | 2990047031 | 2990044586 | Bacteria | 6603797 |
| 441 | 2995465846 | 2995463766 | Bacteria | 8577691 |
| 442 | 2995466700 | 2995463766 | Bacteria | 8577691 |
| 443 | 637877755 | 637000116 | Bacteria | 5433628 |
| 444 | 8002782223 | 8002775197 | Bacteria | 10728764 |
| 445 | 8002789913 | 8002784119 | Bacteria | 9788632 |
| 446 | 8002813527 | 8002811521 | Bacteria | 2942897 |
| 447 | 8023624042 | 8023623736 | Bacteria | 8593882 |
| 448 | 8054914363 | 8054913762 | Bacteria | 7713009 |
| 449 | 8054923502 | 8054920844 | Bacteria | 7068637 |
| 450 | 8055037010 | 8055034563 | Bacteria | 3562128 |
| 451 | 8055040594 | 8055037949 | Bacteria | 3337834 |
| 452 | 8055160425 | 8055157932 | Bacteria | 6429399 |
| 453 | 8056451063 | 8056447290 | Bacteria | 7680491 |
| 454 | Ga0496102_0194604 | |||
| 455 | JGI25404J52841_10031930 | |||
| 456 | Ga0058863_11339592 | |||
| 457 | Ga0070658_10005443 | |||
| 458 | Ga0070658_10089621 | |||
| 459 | Ga0070683_100001875 | |||
| 460 | Ga0070683_100357112 | |||
| 461 | Ga0070683_100396684 | |||
| 462 | Ga0070690_100010990 | |||
| 463 | Ga0068869_100193756 | |||
| 464 | Ga0070680_100623405 | |||
| 465 | Ga0070682_100051547 | |||
| 466 | Ga0070660_100104921 | |||
| 467 | Ga0070689_100123031 | |||
| 468 | Ga0070691_10021224 | |||
| 469 | Ga0070687_100015933 | |||
| 470 | Ga0070675_100067807 | |||
| 471 | Ga0070671_100265649 | |||
| 472 | Ga0070674_100066168 | |||
| 473 | Ga0070674_100543176 | |||
| 474 | Ga0070673_100096938 | |||
| 475 | Ga0070659_100039456 | |||
| 476 | Ga0070703_10111328 | |||
| 477 | Ga0070705_100057677 | |||
| 478 | Ga0070700_100205361 | |||
| 479 | Ga0070663_100027325 | |||
| 480 | Ga0070679_100086039 | |||
| 481 | Ga0070684_100041323 | |||
| 482 | Ga0070684_100047536 | |||
| 483 | Ga0070684_100402146 | |||
| 484 | Ga0070697_100326585 | |||
| 485 | Ga0070672_100512343 | |||
| 486 | Ga0070686_100207717 | |||
| 487 | Ga0070695_100255925 | |||
| 488 | Ga0070696_100079816 | |||
| 489 | Ga0070693_100109559 | |||
| 490 | Ga0068855_100008457 | |||
| 491 | Ga0068855_100010104 | |||
| 492 | Ga0070664_100078767 | |||
| 493 | Ga0070664_100102069 | |||
| 494 | Ga0068854_100183599 | |||
| 495 | Ga0068852_100057763 | |||
| 496 | Ga0068852_100112939 | |||
| 497 | Ga0068859_100001508 | |||
| 498 | Ga0068859_100057701 | |||
| 499 | Ga0068864_100036663 | |||
| 500 | Ga0068861_100101831 | |||
| 501 | Ga0068851_10257126 | |||
| 502 | Ga0068870_10012716 | |||
| 503 | Ga0068863_100000643 | |||
| 504 | Ga0068863_100111053 | |||
| 505 | Ga0068863_100547759 | |||
| 506 | Ga0068858_100000039 | |||
| 507 | Ga0068858_100023937 | |||
| 508 | Ga0068858_100114316 | |||
| 509 | Ga0068860_100885230 | |||
| 510 | Ga0068862_100000150 | |||
| 511 | Ga0068862_100690648 | |||
| 512 | Ga0081540_1000402 | |||
| 513 | Ga0075428_100000807 | |||
| 514 | Ga0075428_100031735 | |||
| 515 | Ga0075428_100117825 | |||
| 516 | Ga0075428_100158331 | |||
| 517 | Ga0075430_100034469 | |||
| 518 | Ga0075431_100011440 | |||
| 519 | Ga0075434_100069387 | |||
| 520 | Ga0075429_100003536 | |||
| 521 | Ga0075436_100102838 | |||
| 522 | Ga0097620_100001508 | |||
| 523 | Ga0097620_100032460 | |||
| 524 | Ga0097620_100057699 | |||
| 525 | Ga0105251_10047697 | |||
| 526 | Ga0105251_10069849 | |||
| 527 | Ga0105250_10057791 | |||
| 528 | Ga0105240_10003545 | |||
| 529 | Ga0105240_10369693 | |||
| 530 | Ga0105245_10308294 | |||
| 531 | Ga0105247_10000519 | |||
| 532 | Ga0105247_10021234 | |||
| 533 | Ga0105247_10123486 | |||
| 534 | Ga0114129_10000024 | |||
| 535 | Ga0114129_10009554 | |||
| 536 | Ga0114129_10104550 | |||
| 537 | Ga0105243_10133515 | |||
| 538 | Ga0105248_10000866 | |||
| 539 | Ga0105248_10010791 | |||
| 540 | Ga0105248_10121137 | |||
| 541 | Ga0105237_10484272 | |||
| 542 | Ga0105249_10187699 | |||
| 543 | Ga0105249_10794378 | |||
| 544 | Ga0105239_11191716 | |||
| 545 | Ga0157320_1000419 | |||
| 546 | Ga0157373_10074066 | |||
| 547 | Ga0157371_10068701 | |||
| 548 | Ga0157370_10016452 | |||
| 549 | Ga0157370_10100953 | |||
| 550 | Ga0157369_10044134 | |||
| 551 | Ga0157369_10268831 | |||
| 552 | Ga0157369_10339300 | |||
| 553 | Ga0157369_10931984 | |||
| 554 | Ga0157374_10695781 | |||
| 555 | Ga0163162_10173003 | |||
| 556 | Ga0163162_10859359 | |||
| 557 | Ga0157372_10187206 | |||
| 558 | Ga0157375_10087170 | |||
| 559 | Ga0163163_10012689 | |||
| 560 | Ga0163163_10076455 | |||
| 561 | Ga0163163_10086098 | |||
| 562 | Ga0157380_10043855 | |||
| 563 | Ga0157379_10000288 | |||
| 564 | Ga0157379_10029041 | |||
| 565 | Ga0157379_10037097 | |||
| 566 | Ga0163161_10035827 | |||
| 567 | Ga0197907_10100242 | |||
| 568 | Ga0206355_1618483 | |||
| 569 | Ga0206350_10045767 | |||
| 570 | Ga0206354_11503868 | |||
| 571 | Ga0206353_11866792 | |||
| 572 | Ga0213876_10002948 | |||
| 573 | Ga0207656_10169553 | |||
| 574 | Ga0207710_10000127 | |||
| 575 | Ga0207710_10000366 | |||
| 576 | Ga0207710_10315630 | |||
| 577 | Ga0207688_10032138 | |||
| 578 | Ga0207699_10051347 | |||
| 579 | Ga0207645_10078645 | |||
| 580 | Ga0207643_10053293 | |||
| 581 | Ga0207705_10035474 | |||
| 582 | Ga0207705_10071157 | |||
| 583 | Ga0207705_10171797 | |||
| 584 | Ga0207684_10848040 | |||
| 585 | Ga0207654_10213409 | |||
| 586 | Ga0207707_10566377 | |||
| 587 | Ga0207695_10013572 | |||
| 588 | Ga0207695_10722995 | |||
| 589 | Ga0207693_10022418 | |||
| 590 | Ga0207662_10003543 | |||
| 591 | Ga0207657_10021811 | |||
| 592 | Ga0207652_10103740 | |||
| 593 | Ga0207681_10420262 | |||
| 594 | Ga0207650_10670863 | |||
| 595 | Ga0207659_10034914 | |||
| 596 | Ga0207700_10050655 | |||
| 597 | Ga0207664_10331528 | |||
| 598 | Ga0207706_10069709 | |||
| 599 | Ga0207709_10168382 | |||
| 600 | Ga0207704_10027505 | |||
| 601 | Ga0207691_10017441 | |||
| 602 | Ga0207711_10000293 | |||
| 603 | Ga0207711_10003201 | |||
| 604 | Ga0207711_10550851 | |||
| 605 | Ga0207689_10014481 | |||
| 606 | Ga0207661_10166493 | |||
| 607 | Ga0207679_10038099 | |||
| 608 | Ga0207679_10040207 | |||
| 609 | Ga0207667_10019922 | |||
| 610 | Ga0207667_10071615 | |||
| 611 | Ga0207667_10171454 | |||
| 612 | Ga0207712_10116269 | |||
| 613 | Ga0207668_10153327 | |||
| 614 | Ga0207703_10000039 | |||
| 615 | Ga0207703_10119978 | |||
| 616 | Ga0207639_10129039 | |||
| 617 | Ga0207678_10004697 | |||
| 618 | Ga0207708_10054761 | |||
| 619 | Ga0207702_10014473 | |||
| 620 | Ga0207641_10010806 | |||
| 621 | Ga0207648_10017887 | |||
| 622 | Ga0207674_10021199 | |||
| 623 | Ga0207675_100039165 | |||
| 624 | Ga0207683_10004059 | |||
| 625 | Ga0207698_10784137 | |||
| 626 | Ga0268265_10000276 | |||
| 627 | Ga0268265_10147593 | |||
| 628 | Ga0268264_10170250 | |||
| 629 | Ga0307515_10072815 | |||
| 630 | Ga0265338_10026039 | |||
| 631 | Ga0265325_10020066 | |||
| 632 | Ga0265325_10051368 | |||
| 633 | Ga0265340_10030553 | |||
| 634 | Ga0265339_10035517 | |||
| 635 | Ga0265316_10155051 | |||
| 636 | Ga0307513_10007773 | |||
| 637 | Ga0307408_100886120 | |||
| 638 | Ga0265313_10111223 | |||
| 639 | Ga0307508_10044053 | |||
| 640 | Ga0307508_10081409 | |||
| 641 | Ga0307508_10140724 | |||
| 642 | Ga0265314_10020747 | |||
| 643 | Ga0265342_10031223 | |||
| 644 | Ga0307405_10345300 | |||
| 645 | Ga0307406_10055962 | |||
| 646 | Ga0307406_10547208 | |||
| 647 | Ga0307407_10003495 | |||
| 648 | Ga0307412_10011952 | |||
| 649 | Ga0307409_100002991 | |||
| 650 | Ga0307416_100000174 | |||
| 651 | Ga0307416_100370578 | |||
| 652 | Ga0307416_100410337 | |||
| 653 | Ga0307416_100424972 | |||
| 654 | Ga0307414_10325030 | |||
| 655 | Ga0307415_100000183 | |||
| 656 | Ga0307415_100032058 | |||
| 657 | Ga0307415_100107078 | |||
| 658 | Ga0373938_0003199 | |||
| 659 | Ga0373926_0002798 | |||
| 660 | Ga0373928_0003128 | |||
| 661 | Ga0373934_0006688 | |||
| 662 | Ga0373934_0235833 | |||
| 663 | Ga0373940_0012766 | |||
| 664 | Ga0373944_0006217 | |||
| 665 | Ga0373949_0007038 | |||
| 666 | Ga0373952_0059436 | |||
| 667 | Ga0373923_0036531 | |||
| 668 | Ga0373936_0000919 | |||
| 669 | Ga0373945_0002162 | |||
| 670 | Ga0373953_0004383 | |||
| 671 | Ga0373957_0017869 | |||
| 672 | Ga0373943_0002809 | |||
| 673 | Ga0373946_0000154 | |||
| 674 | Ga0373955_0002313 | |||
| 675 | Ga0373961_0006511 | |||
| 676 | Ga0373924_0054737 | |||
| 677 | Ga0373931_0169766 | |||
| 678 | Ga0373935_0012119 | |||
| 679 | Ga0373927_0025005 | |||
| 680 | Ga0373933_0005412 | |||
| 681 | Ga0373947_0007978 | |||
| 682 | Ga0373937_0449550 | |||
| 683 | Ga0373937_0545253 | |||
| 684 | Ga0372808_007129 | |||
| 685 | Ga0373925_0008864 | |||
| 686 | Ga0395899_0117863 | |||
| 687 | Ga0395900_0437335 | |||
| 688 | Ga0395898_0028177 | |||
| 689 | Ga0436364_1540925 | |||
| 690 | Ga0395901_0019156 | |||
| 691 | Ga0436365_0067462 | |||
| 692 | Ga0451853_0491630 | |||
| 693 | Ga0450903_031831 | |||
| 694 | Ga0466961_0072842 | |||
| 695 | Ga0466961_0132824 | |||
| 696 | Ga0466963_0081091 | |||
| 697 | Ga0466963_0167112 | |||
| 698 | Ga0466963_0511770 | |||
| 699 | Ga0466971_0052718 | |||
| 700 | Ga0466957_0235306 | |||
| 701 | Ga0466958_0002916 | |||
| 702 | Ga0466958_0060333 | |||
| 703 | Ga0466967_0060270 | |||
| 704 | Ga0466967_0061328 | |||
| 705 | Ga0466967_0204220 | |||
| 706 | Ga0495592_0098992 | |||
| 707 | Ga0495603_0006626 | |||
| 708 | Ga0495629_0000814 | |||
| 709 | Ga0495641_0007645 | |||
| 710 | Ga0495651_0141191 | |||
| 711 | Ga0495651_0310591 | |||
| 712 | Ga0495580_0005898 | |||
| 713 | Ga0495582_0003160 | |||
| 714 | Ga0495639_0000844 | |||
| 715 | Ga0495662_0004738 | |||
| 716 | Ga0495662_0014871 | |||
| 717 | Ga0495664_0002002 | |||
| 718 | Ga0495594_0055977 | |||
| 719 | Ga0495594_0128545 | |||
| 720 | Ga0495594_0188435 | |||
| 721 | Ga0495608_0097091 | |||
| 722 | Ga0495608_0301624 | |||
| 723 | Ga0495628_0022606 | |||
| 724 | Ga0495628_0550499 | |||
| 725 | Ga0495630_0056074 | |||
| 726 | Ga0495632_0075312 | |||
| 727 | Ga0495648_0024376 | |||
| 728 | Ga0495666_0003615 | |||
| 729 | Ga0495652_0036153 | |||
| 730 | Ga0495665_0007595 | |||
| 731 | Ga0495640_0011073 | |||
| 732 | Ga0495586_0007118 | |||
| 733 | Ga0495645_0082377 | |||
| 734 | Ga0495645_0473580 | |||
| 735 | Ga0495657_0094660 | |||
| 736 | Ga0495599_0017752 | |||
| 737 | Ga0495623_0015738 | |||
| 738 | Ga0495623_0073671 | |||
| 739 | Ga0495646_0009951 | |||
| 740 | Ga0495647_0024868 | |||
| 741 | Ga0495658_0002286 | |||
| 742 | Ga0495613_0002511 | |||
| 743 | Ga0495624_0006156 | |||
| 744 | Ga0495600_0006168 | |||
| 745 | Ga0495581_0002875 | |||
| 746 | Ga0495604_0001392 | |||
| 747 | Ga0495604_0006758 | |||
| 748 | Ga0495674_0033404 | |||
| 749 | Ga0495676_0017126 | |||
| 750 | Ga0495680_0070146 | |||
| 751 | Ga0495675_0001113 | |||
| 752 | Ga0495685_031843 | |||
| 753 | Ga0495684_0024490 | |||
| 754 | Ga0495593_0014307 | |||
| 755 | Ga0495602_0079324 | |||
| 756 | Ga0495602_0452050 | |||
| 757 | Ga0496100_0032418 | |||
| 758 | Ga0496100_0064273 | |||
| 759 | Ga0496100_0071077 | |||
| 760 | Ga0496102_0025371 | |||
| 761 | Ga0496102_0168137 | |||
| 762 | Ga0496102_0864216 | |||
| 763 | Ga0496103_0224992 | |||
| 764 | Ga0496104_0060208 | |||
| 765 | Ga0496104_0153038 | |||
| 766 | Ga0496104_0155313 | |||
| 767 | Ga0496105_0025843 | |||
| 768 | Ga0496105_0117184 | |||
| 769 | Ga0496105_0496818 | |||
| 770 | Ga0496105_0609843 | |||
| 771 | Ga0496106_0225349 | |||
| 772 | Ga0496107_0117969 | |||
| 773 | Ga0496108_0036119 | |||
| 774 | Ga0496108_0105545 | |||
| 775 | Ga0496109_0112435 | |||
| 776 | Ga0496110_0130899 | |||
| 777 | Ga0496110_0693465 | |||
| 778 | Ga0496111_0056839 | |||
| 779 | Ga0496111_0061655 | |||
| 780 | Ga0496112_0010964 | |||
| 781 | Ga0496112_0040596 | |||
| 782 | Ga0496112_0066055 | |||
| 783 | Ga0496113_0163887 | |||
| 784 | Ga0496114_0001036 | |||
| 785 | Ga0496114_0025352 | |||
| 786 | Ga0496114_0091474 | |||
| 787 | Ga0496114_0196569 | |||
| 788 | Ga0496115_0016582 | |||
| 789 | Ga0496116_0000922 | |||
| 790 | Ga0496117_0008325 | |||
| 791 | Ga0496117_0095158 | |||
| 792 | Ga0496118_0003795 | |||
| 793 | Ga0496118_0004523 | |||
| 794 | Ga0496119_0001025 | |||
| 795 | Ga0496119_0020018 | |||
| 796 | Ga0496119_0307543 | |||
| 797 | Ga0496120_0000672 | |||
| 798 | Ga0496121_0008952 | |||
| 799 | Ga0496125_0366094 | |||
| 800 | Ga0496126_0139448 | |||
| 801 | Ga0501032_0007123 | |||
| 802 | Ga0501034_0315259 | |||
| 803 | Ga0501036_0010617 | |||
| 804 | Ga0501036_0110539 | |||
| 805 | Ga0501037_0015156 | |||
| 806 | Ga0501039_0034996 | |||
| 807 | Ga0501039_0158134 | |||
| 808 | Ga0501039_0551180 | |||
| 809 | Ga0501041_0075623 | |||
| 810 | Ga0501043_0133103 | |||
| 811 | Ga0501043_0164196 | |||
| 812 | Ga0501043_0232362 | |||
| 813 | Ga0501047_0106424 | |||
| 814 | Ga0501048_0076095 | |||
| 815 | Ga0501069_0013514 | |||
| 816 | Ga0501069_0121681 | |||
| 817 | Ga0501070_0002483 | |||
| 818 | Ga0501070_0009284 | |||
| 819 | Ga0501070_0026903 | |||
| 820 | Ga0501070_0266581 | |||
| 821 | Ga0501070_0500007 | |||
| 822 | Ga0501071_0030420 | |||
| 823 | Ga0501072_0019092 | |||
| 824 | Ga0501074_0020237 | |||
| 825 | Ga0501074_0057561 | |||
| 826 | Ga0501075_0569121 | |||
| 827 | Ga0501076_0041875 | |||
| 828 | Ga0501079_0013828 | |||
| 829 | Ga0501080_0013977 | |||
| 830 | Ga0501080_0017570 | |||
| 831 | Ga0501035_0003825 | |||
| 832 | Ga0501035_0174597 | |||
| 833 | Ga0501044_0009182 | |||
| 834 | Ga0501044_0009930 | |||
| 835 | Ga0501044_0077900 | |||
| 836 | Ga0501045_0138646 | |||
| 837 | nmdc:mga00v17_117663_c1 | |||
| 838 | nmdc:mga05p37_1984_c1 | |||
| 839 | nmdc:mga05p37_24_c1 | |||
| 840 | nmdc:mga05p37_660750_c1 | |||
| 841 | nmdc:mga05p37_82975_c1 | |||
| 842 | nmdc:mga09592_205154_c1 | |||
| 843 | nmdc:mga09592_2_c1 | |||
| 844 | nmdc:mga0qj67_10_c1 | |||
| 845 | nmdc:mga06r32_343_c1 | |||
| 846 | nmdc:mga06r32_397929_c1 | |||
| 847 | Ga0495601_0010597 | |||
| 848 | Ga0495612_0006076 | |||
| 849 | Ga0495619_0003152 | |||
| 850 | Ga0500644_0056524 | |||
| 851 | Ga0500583_0156958 | |||
| 852 | Ga0500568_0001331 | |||
| 853 | Ga0500616_0123294 | |||
| 854 | Ga0501082_0438847 | |||
| 855 | Ga0466962_0026437 | |||
| 856 | Ga0530510_0116030 | |||
| 857 | Ga0530510_0170537 | |||
| 858 | 2506864634 | |||
| 859 | 2508670829 | |||
| 860 | 2517762370 | |||
| 861 | 2528204172 | |||
| 862 | 2528214690 | |||
| 863 | 2546947067 | |||
| 864 | 2579747427 | |||
| 865 | 2579857432 | |||
| 866 | 2619853931 | |||
| 867 | 2620353234 | |||
| 868 | 2644017187 | |||
| 869 | 2644173852 | |||
| 870 | 2671835911 | |||
| 871 | 2676201153 | |||
| 872 | 2686539806 | |||
| 873 | 2686543424 | |||
| 874 | 2689959152 | |||
| 875 | 2689992185 | |||
| 876 | 2710603449 | |||
| 877 | 2753070194 | |||
| 878 | 2768644728 | |||
| 879 | 2774845729 | |||
| 880 | 2774854067 | |||
| 881 | 2774867189 | |||
| 882 | 2774904946 | |||
| 883 | 2784588931 | |||
| 884 | 2809232550 | |||
| 885 | 2819741150 | |||
| 886 | 2831938042 | |||
| 887 | 2832007650 | |||
| 888 | 2866065427 | |||
| 889 | 2867507882 | |||
| 890 | 2870730002 | |||
| 891 | 2895885683 | |||
| 892 | 2977251700 | |||
| 893 | 2990047031 | |||
| 894 | 2995465846 | |||
| 895 | 2995466700 | |||
| 896 | 637877755 | |||
| 897 | 8002782223 | |||
| 898 | 8002789913 | |||
| 899 | 8002813527 | |||
| 900 | 8023624042 | |||
| 901 | 8054914363 | |||
| 902 | 8054923502 | |||
| 903 | 8055037010 | |||
| 904 | 8055040594 | |||
| 905 | 8055160425 | |||
| 906 | 8056451063 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b25-assembly1.cif.gz_D | dtxr-like iron-dependent regulator ider (q43a variant) complexed with cobalt and its consensus dna-binding sequence | 0.9809 | 6 | 143 |
| 7b1y-assembly1.cif.gz_A | dtxr-like iron-dependent regulator ider complexed with cobalt and its consensus dna-binding sequence | 0.9794 | 6 | 143 |
| 1f5t-assembly1.cif.gz_A | diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence | 0.9784 | 5 | 123 |
| 2tdx-assembly1.cif.gz_A-2 | diphtheria tox repressor (c102d mutant) complexed with nickel | 0.9767 | 5 | 142 |
| 2isz-assembly1.cif.gz_B | crystal structure of a two-domain ider-dna complex crystal form i | 0.9758 | 5 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2iszA02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 1.001 | 79 | 138 | 1.10.60.10 |
| 2it0C02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.9998 | 79 | 138 | 1.10.60.10 |
| 3glxA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9971 | 9 | 75 | 1.10.10.10 |
| 1f5tA02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.997 | 79 | 123 | 1.10.60.10 |
| 1ddnC02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.9933 | 79 | 122 | 1.10.60.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q9F7T1-F1-model_v4 | Iron dependent regulatory protein | 1 | 9 | 111 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A358DE73-F1-model_v4 | Dihydrofolate reductase | 0.9911 | 5 | 107 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-Q9F7T1-F1-model_v4 | Iron dependent regulatory protein | 0.9904 | 9 | 111 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A7G2TG80-F1-model_v4 | Transcriptional regulator MntR | 0.9895 | 5 | 147 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A0D4DMW5-F1-model_v4 | deleted | 0.9733 | 7 | 229 |
|