F447260

General Info

Members Datasets Scaffolds Average Seq Length
453 332 906 228

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0194604|Ga0496102_0194604_27_797
Length 256
Sequence MYHDPPLLTPQYARIGGEDTEERRPAAMSGLIDTTEMYLRTILELEEEGITPMRARIAERLEQSGPTVSQTVGRMERDGLLRVAGDRHLELTEEGRRLAVRVMRKHRIAECLLVDVIGLEWEQVHEEACRWEHVMSETVERKVLAMLGHPTQSPYGNPIPGLDELGDTKAEGEGFDAALLTLDSVAGAGSSSVVVRRIGEPIQTDEELMRTLRRAGVRPGATVQVAPAAGGVVVGAGESAAELGKDIAAHVFVAQV

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 2506783011 Frankia datiscae Dg1 Isolate Nodule
286 2508501039 Frankia saprophytica CN3 Isolate Nodule
287 2517572101 Frankia sp. DC12 Isolate Nodule
288 2527291627 Frankia casuarinae Thr Isolate Nodule
289 2527291629 Frankia sp. BMG5.23 Isolate Nodule
290 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
291 2576861822 Frankia sp. CeD Isolate Nodule
292 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
293 2619618881 Frankia sp. ACN1ag Isolate Unclassified
294 2619619003 Frankia sp. CpI1-P Isolate Nodule
295 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
296 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
297 2671180195 Frankia sp. CcI49 Isolate Nodule
298 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
299 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
300 2684623036 Frankia sp. CgIM4 Isolate Nodule
301 2687453737 Frankia sp. BMG5.36 Isolate Nodule
302 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
303 2710264753 Frankia sp. KB5 Isolate Nodule
304 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
305 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
306 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
307 2773857922 Frankia sp. CcI49 Isolate Nodule
308 2773857924 Frankia sp. CgIS1 Isolate Nodule
309 2773857933 Frankia sp. BMG5.30 Isolate Nodule
310 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
311 2808606448 Streptomyces sp. 193411 Isolate Unclassified
312 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
313 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
314 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
315 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
316 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
317 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
318 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
319 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
320 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
321 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
322 637000116 Frankia casuarinae CcI3 Isolate Nodule
323 8002775197 Frankia nepalensis CN7 Isolate Nodule
324 8002784119 Frankia sp. AgB1.9 Isolate Nodule
325 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
326 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
327 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
328 8054920844 Frankia tisae Agncl-8 Isolate Nodule
329 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
330 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
331 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
332 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.64
Metatranscriptomes 1.55
Isolates 10.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 5.08
Rhizoplane 7.51
Rhizosphere 77.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0194604 3300048905 Bacteria 1911
2 JGI25404J52841_10031930 3300003659 Bacteria 1124
3 Ga0058863_11339592 3300004799 Bacteria 932
4 Ga0070658_10005443 3300005327 Bacteria 10324
5 Ga0070658_10089621 3300005327 Bacteria 2533
6 Ga0070683_100001875 3300005329 Bacteria 16424
7 Ga0070683_100357112 3300005329 Bacteria 1392
8 Ga0070683_100396684 3300005329 Bacteria 1316
9 Ga0070690_100010990 3300005330 Bacteria 5285
10 Ga0068869_100193756 3300005334 Bacteria 1599
11 Ga0070680_100623405 3300005336 Bacteria 926
12 Ga0070682_100051547 3300005337 Bacteria 2572
13 Ga0070660_100104921 3300005339 Bacteria 2242
14 Ga0070689_100123031 3300005340 Bacteria 2074
15 Ga0070691_10021224 3300005341 Bacteria 3003
16 Ga0070687_100015933 3300005343 Bacteria 3412
17 Ga0070675_100067807 3300005354 Bacteria 2953
18 Ga0070671_100265649 3300005355 Bacteria 1458
19 Ga0070674_100066168 3300005356 Bacteria 2539
20 Ga0070674_100543176 3300005356 Bacteria 974
21 Ga0070673_100096938 3300005364 Bacteria 2421
22 Ga0070659_100039456 3300005366 Bacteria 3686
23 Ga0070703_10111328 3300005406 Bacteria 980
24 Ga0070705_100057677 3300005440 Bacteria 2292
25 Ga0070700_100205361 3300005441 Bacteria 1387
26 Ga0070663_100027325 3300005455 Bacteria 3874
27 Ga0070679_100086039 3300005530 Bacteria 3130
28 Ga0070684_100041323 3300005535 Bacteria 3975
29 Ga0070684_100047536 3300005535 Bacteria 3718
30 Ga0070684_100402146 3300005535 Bacteria 1263
31 Ga0070697_100326585 3300005536 Bacteria 1322
32 Ga0070672_100512343 3300005543 Bacteria 1039
33 Ga0070686_100207717 3300005544 Bacteria 1408
34 Ga0070695_100255925 3300005545 Bacteria 1276
35 Ga0070696_100079816 3300005546 Bacteria 2316
36 Ga0070693_100109559 3300005547 Bacteria 1696
37 Ga0068855_100008457 3300005563 Bacteria 12446
38 Ga0068855_100010104 3300005563 Bacteria 11374
39 Ga0070664_100078767 3300005564 Bacteria 2835
40 Ga0070664_100102069 3300005564 Bacteria 2495
41 Ga0068854_100183599 3300005578 Bacteria 1635
42 Ga0068852_100057763 3300005616 Bacteria 3358
43 Ga0068852_100112939 3300005616 Bacteria 2473
44 Ga0068859_100001508 3300005617 Bacteria 23752
45 Ga0068859_100057701 3300005617 Bacteria 3910
46 Ga0068864_100036663 3300005618 Bacteria 4181
47 Ga0068861_100101831 3300005719 Bacteria 2285
48 Ga0068851_10257126 3300005834 Bacteria 992
49 Ga0068870_10012716 3300005840 Bacteria 3940
50 Ga0068863_100000643 3300005841 Bacteria 35383
51 Ga0068863_100111053 3300005841 Bacteria 2611
52 Ga0068863_100547759 3300005841 Bacteria 1142
53 Ga0068858_100000039 3300005842 Bacteria 136946
54 Ga0068858_100023937 3300005842 Bacteria 5690
55 Ga0068858_100114316 3300005842 Bacteria 2521
56 Ga0068860_100885230 3300005843 Bacteria 908
57 Ga0068862_100000150 3300005844 Bacteria 79040
58 Ga0068862_100690648 3300005844 Bacteria 988
59 Ga0081540_1000402 3300005983 Bacteria 42843
60 Ga0075428_100000807 3300006844 Bacteria 32731
61 Ga0075428_100031735 3300006844 Bacteria 5835
62 Ga0075428_100117825 3300006844 Bacteria 2893
63 Ga0075428_100158331 3300006844 Bacteria 2459
64 Ga0075430_100034469 3300006846 Bacteria 4296
65 Ga0075431_100011440 3300006847 Bacteria 8942
66 Ga0075434_100069387 3300006871 Bacteria 3514
67 Ga0075429_100003536 3300006880 Bacteria 13310
68 Ga0075436_100102838 3300006914 Bacteria 1990
69 Ga0097620_100001508 3300006931 Bacteria 23752
70 Ga0097620_100032460 3300006931 Bacteria 5245
71 Ga0097620_100057699 3300006931 Bacteria 3910
72 Ga0105251_10047697 3300009011 Bacteria 2057
73 Ga0105251_10069849 3300009011 Bacteria 1637
74 Ga0105250_10057791 3300009092 Bacteria 1556
75 Ga0105240_10003545 3300009093 Bacteria 24217
76 Ga0105240_10369693 3300009093 Bacteria 1622
77 Ga0105245_10308294 3300009098 Bacteria 1556
78 Ga0105247_10000519 3300009101 Bacteria 31547
79 Ga0105247_10021234 3300009101 Bacteria 3907
80 Ga0105247_10123486 3300009101 Bacteria 1680
81 Ga0114129_10000024 3300009147 Bacteria 116794
82 Ga0114129_10009554 3300009147 Bacteria 13833
83 Ga0114129_10104550 3300009147 Bacteria 3913
84 Ga0105243_10133515 3300009148 Bacteria 2109
85 Ga0105248_10000866 3300009177 Bacteria 33994
86 Ga0105248_10010791 3300009177 Bacteria 10086
87 Ga0105248_10121137 3300009177 Bacteria 2951
88 Ga0105237_10484272 3300009545 Bacteria 1243
89 Ga0105249_10187699 3300009553 Bacteria 2015
90 Ga0105249_10794378 3300009553 Bacteria 1010
91 Ga0105239_11191716 3300010375 Bacteria 877
92 Ga0157320_1000419 3300012481 Bacteria 1681
93 Ga0157373_10074066 3300013100 Bacteria 2402
94 Ga0157371_10068701 3300013102 Bacteria 2508
95 Ga0157370_10016452 3300013104 Bacteria 7487
96 Ga0157370_10100953 3300013104 Bacteria 2703
97 Ga0157369_10044134 3300013105 Bacteria 4854
98 Ga0157369_10268831 3300013105 Bacteria 1777
99 Ga0157369_10339300 3300013105 Bacteria 1561
100 Ga0157369_10931984 3300013105 Bacteria 890
101 Ga0157374_10695781 3300013296 Bacteria 1029
102 Ga0163162_10173003 3300013306 Bacteria 2284
103 Ga0163162_10859359 3300013306 Bacteria 1022
104 Ga0157372_10187206 3300013307 Bacteria 2397
105 Ga0157375_10087170 3300013308 Bacteria 3173
106 Ga0163163_10012689 3300014325 Bacteria 7686
107 Ga0163163_10076455 3300014325 Bacteria 3343
108 Ga0163163_10086098 3300014325 Bacteria 3151
109 Ga0157380_10043855 3300014326 Bacteria 3503
110 Ga0157379_10000288 3300014968 Bacteria 39832
111 Ga0157379_10029041 3300014968 Bacteria 4917
112 Ga0157379_10037097 3300014968 Bacteria 4346
113 Ga0163161_10035827 3300017792 Bacteria 3552
114 Ga0197907_10100242 3300020069 Bacteria 2117
115 Ga0206355_1618483 3300020076 Bacteria 934
116 Ga0206350_10045767 3300020080 Bacteria 1305
117 Ga0206354_11503868 3300020081 Bacteria 1143
118 Ga0206353_11866792 3300020082 Bacteria 1184
119 Ga0213876_10002948 3300021384 Bacteria 9857
120 Ga0207656_10169553 3300025321 Bacteria 1043
121 Ga0207710_10000127 3300025900 Bacteria 92787
122 Ga0207710_10000366 3300025900 Bacteria 31620
123 Ga0207710_10315630 3300025900 Bacteria 792
124 Ga0207688_10032138 3300025901 Bacteria 2899
125 Ga0207699_10051347 3300025906 Bacteria 2436
126 Ga0207645_10078645 3300025907 Bacteria 2113
127 Ga0207643_10053293 3300025908 Bacteria 2298
128 Ga0207705_10035474 3300025909 Bacteria 3568
129 Ga0207705_10071157 3300025909 Bacteria 2521
130 Ga0207705_10171797 3300025909 Bacteria 1632
131 Ga0207684_10848040 3300025910 Bacteria 770
132 Ga0207654_10213409 3300025911 Bacteria 1277
133 Ga0207707_10566377 3300025912 Bacteria 964
134 Ga0207695_10013572 3300025913 Bacteria 9704
135 Ga0207695_10722995 3300025913 Bacteria 876
136 Ga0207693_10022418 3300025915 Bacteria 5018
137 Ga0207662_10003543 3300025918 Bacteria 8048
138 Ga0207657_10021811 3300025919 Bacteria 6016
139 Ga0207652_10103740 3300025921 Bacteria 2514
140 Ga0207681_10420262 3300025923 Bacteria 1083
141 Ga0207650_10670863 3300025925 Bacteria 875
142 Ga0207659_10034914 3300025926 Bacteria 3472
143 Ga0207700_10050655 3300025928 Bacteria 3095
144 Ga0207664_10331528 3300025929 Bacteria 1344
145 Ga0207706_10069709 3300025933 Bacteria 3092
146 Ga0207709_10168382 3300025935 Bacteria 1535
147 Ga0207704_10027505 3300025938 Bacteria 3140
148 Ga0207691_10017441 3300025940 Bacteria 6810
149 Ga0207711_10000293 3300025941 Bacteria 53424
150 Ga0207711_10003201 3300025941 Bacteria 14270
151 Ga0207711_10550851 3300025941 Bacteria 1076
152 Ga0207689_10014481 3300025942 Bacteria 6710
153 Ga0207661_10166493 3300025944 Bacteria 1916
154 Ga0207679_10038099 3300025945 Bacteria 3423
155 Ga0207679_10040207 3300025945 Bacteria 3346
156 Ga0207667_10019922 3300025949 Bacteria 7475
157 Ga0207667_10071615 3300025949 Bacteria 3603
158 Ga0207667_10171454 3300025949 Bacteria 2230
159 Ga0207712_10116269 3300025961 Bacteria 2015
160 Ga0207668_10153327 3300025972 Bacteria 1787
161 Ga0207703_10000039 3300026035 Bacteria 170322
162 Ga0207703_10119978 3300026035 Bacteria 2256
163 Ga0207639_10129039 3300026041 Bacteria 2090
164 Ga0207678_10004697 3300026067 Bacteria 12253
165 Ga0207708_10054761 3300026075 Bacteria 3041
166 Ga0207702_10014473 3300026078 Bacteria 6551
167 Ga0207641_10010806 3300026088 Bacteria 7483
168 Ga0207648_10017887 3300026089 Bacteria 6431
169 Ga0207674_10021199 3300026116 Bacteria 7005
170 Ga0207675_100039165 3300026118 Bacteria 4423
171 Ga0207683_10004059 3300026121 Bacteria 12651
172 Ga0207698_10784137 3300026142 Bacteria 954
173 Ga0268265_10000276 3300028380 Bacteria 58368
174 Ga0268265_10147593 3300028380 Bacteria 1979
175 Ga0268264_10170250 3300028381 Bacteria 1969
176 Ga0307515_10072815 3300028794 Bacteria 4629
177 Ga0265338_10026039 3300028800 Bacteria 5914
178 Ga0265325_10020066 3300031241 Bacteria 3688
179 Ga0265325_10051368 3300031241 Bacteria 2119
180 Ga0265340_10030553 3300031247 Bacteria 2699
181 Ga0265339_10035517 3300031249 Bacteria 2795
182 Ga0265316_10155051 3300031344 Bacteria 1714
183 Ga0307513_10007773 3300031456 Bacteria 13836
184 Ga0307408_100886120 3300031548 Bacteria 816
185 Ga0265313_10111223 3300031595 Bacteria 1204
186 Ga0307508_10044053 3300031616 Bacteria 3994
187 Ga0307508_10081409 3300031616 Bacteria 2819
188 Ga0307508_10140724 3300031616 Bacteria 2016
189 Ga0265314_10020747 3300031711 Bacteria 5070
190 Ga0265342_10031223 3300031712 Bacteria 3295
191 Ga0307405_10345300 3300031731 Bacteria 1146
192 Ga0307406_10055962 3300031901 Bacteria 2523
193 Ga0307406_10547208 3300031901 Bacteria 946
194 Ga0307407_10003495 3300031903 Bacteria 6463
195 Ga0307412_10011952 3300031911 Bacteria 5044
196 Ga0307409_100002991 3300031995 Bacteria 9014
197 Ga0307416_100000174 3300032002 Bacteria 35948
198 Ga0307416_100370578 3300032002 Bacteria 1458
199 Ga0307416_100410337 3300032002 Bacteria 1395
200 Ga0307416_100424972 3300032002 Bacteria 1374
201 Ga0307414_10325030 3300032004 Bacteria 1311
202 Ga0307415_100000183 3300032126 Bacteria 27846
203 Ga0307415_100032058 3300032126 Bacteria 3394
204 Ga0307415_100107078 3300032126 Bacteria 2065
205 Ga0373938_0003199 3300034957 Bacteria 2663
206 Ga0373926_0002798 3300035083 Bacteria 5567
207 Ga0373928_0003128 3300035084 Bacteria 3175
208 Ga0373934_0006688 3300035086 Bacteria 4284
209 Ga0373934_0235833 3300035086 Bacteria 755
210 Ga0373940_0012766 3300035088 Bacteria 2018
211 Ga0373944_0006217 3300035089 Bacteria 3166
212 Ga0373949_0007038 3300035090 Bacteria 2468
213 Ga0373952_0059436 3300035092 Bacteria 931
214 Ga0373923_0036531 3300035111 Bacteria 2005
215 Ga0373936_0000919 3300035113 Bacteria 10518
216 Ga0373945_0002162 3300035116 Bacteria 6131
217 Ga0373953_0004383 3300035117 Bacteria 4496
218 Ga0373957_0017869 3300035120 Bacteria 2476
219 Ga0373943_0002809 3300035170 Bacteria 7913
220 Ga0373946_0000154 3300035171 Bacteria 20777
221 Ga0373955_0002313 3300035172 Bacteria 8292
222 Ga0373961_0006511 3300035241 Bacteria 2805
223 Ga0373924_0054737 3300035410 Bacteria 1659
224 Ga0373931_0169766 3300035691 Bacteria 1284
225 Ga0373935_0012119 3300035692 Bacteria 5184
226 Ga0373927_0025005 3300035695 Bacteria 3904
227 Ga0373933_0005412 3300035724 Bacteria 6947
228 Ga0373947_0007978 3300035725 Bacteria 6104
229 Ga0373937_0449550 3300036401 Bacteria 1223
230 Ga0373937_0545253 3300036401 Bacteria 1101
231 Ga0372808_007129 3300036459 Bacteria 1523
232 Ga0373925_0008864 3300037068 Bacteria 7328
233 Ga0395899_0117863 3300037312 Bacteria 1904
234 Ga0395900_0437335 3300037418 Bacteria 1266
235 Ga0395898_0028177 3300037466 Bacteria 5632
236 Ga0436364_1540925 3300037853 Bacteria 823
237 Ga0395901_0019156 3300038443 Bacteria 6997
238 Ga0436365_0067462 3300039437 Bacteria 21062
239 Ga0451853_0491630 3300041512 Bacteria 3954
240 Ga0450903_031831 3300042138 Bacteria 795
241 Ga0466961_0072842 3300044693 Bacteria 2179
242 Ga0466961_0132824 3300044693 Bacteria 1560
243 Ga0466963_0081091 3300044694 Bacteria 2197
244 Ga0466963_0167112 3300044694 Bacteria 1532
245 Ga0466963_0511770 3300044694 Bacteria 848
246 Ga0466971_0052718 3300044719 Bacteria 1832
247 Ga0466957_0235306 3300044842 Bacteria 1214
248 Ga0466958_0002916 3300045836 Bacteria 8740
249 Ga0466958_0060333 3300045836 Bacteria 2309
250 Ga0466967_0060270 3300045976 Bacteria 3362
251 Ga0466967_0061328 3300045976 Bacteria 3336
252 Ga0466967_0204220 3300045976 Bacteria 1872
253 Ga0495592_0098992 3300046454 Bacteria 2080
254 Ga0495603_0006626 3300046455 Bacteria 6947
255 Ga0495629_0000814 3300046459 Bacteria 25253
256 Ga0495641_0007645 3300046461 Bacteria 6712
257 Ga0495651_0141191 3300046462 Bacteria 1746
258 Ga0495651_0310591 3300046462 Bacteria 1054
259 Ga0495580_0005898 3300046472 Bacteria 10055
260 Ga0495582_0003160 3300046473 Bacteria 9247
261 Ga0495639_0000844 3300046475 Bacteria 13949
262 Ga0495662_0004738 3300046476 Bacteria 6815
263 Ga0495662_0014871 3300046476 Bacteria 3782
264 Ga0495664_0002002 3300046477 Bacteria 10872
265 Ga0495594_0055977 3300046499 Bacteria 2175
266 Ga0495594_0128545 3300046499 Bacteria 1434
267 Ga0495594_0188435 3300046499 Bacteria 1175
268 Ga0495608_0097091 3300046511 Bacteria 1902
269 Ga0495608_0301624 3300046511 Bacteria 991
270 Ga0495628_0022606 3300046516 Bacteria 5164
271 Ga0495628_0550499 3300046516 Bacteria 828
272 Ga0495630_0056074 3300046517 Bacteria 2952
273 Ga0495632_0075312 3300046519 Bacteria 1615
274 Ga0495648_0024376 3300046524 Bacteria 4122
275 Ga0495666_0003615 3300046526 Bacteria 7810
276 Ga0495652_0036153 3300046529 Bacteria 4295
277 Ga0495665_0007595 3300046531 Bacteria 5871
278 Ga0495640_0011073 3300046533 Bacteria 6943
279 Ga0495586_0007118 3300046535 Bacteria 5960
280 Ga0495645_0082377 3300046543 Bacteria 2307
281 Ga0495645_0473580 3300046543 Bacteria 787
282 Ga0495657_0094660 3300046675 Bacteria 1910
283 Ga0495599_0017752 3300046678 Bacteria 4427
284 Ga0495623_0015738 3300046679 Bacteria 4888
285 Ga0495623_0073671 3300046679 Bacteria 2122
286 Ga0495646_0009951 3300046680 Bacteria 6044
287 Ga0495647_0024868 3300046681 Bacteria 2183
288 Ga0495658_0002286 3300046683 Bacteria 9662
289 Ga0495613_0002511 3300046689 Bacteria 13827
290 Ga0495624_0006156 3300046690 Bacteria 8543
291 Ga0495600_0006168 3300046809 Bacteria 7269
292 Ga0495581_0002875 3300047315 Bacteria 9839
293 Ga0495604_0001392 3300047317 Bacteria 19838
294 Ga0495604_0006758 3300047317 Bacteria 9099
295 Ga0495674_0033404 3300047319 Bacteria 4660
296 Ga0495676_0017126 3300047321 Bacteria 6412
297 Ga0495680_0070146 3300047322 Bacteria 2672
298 Ga0495675_0001113 3300047444 Bacteria 16331
299 Ga0495685_031843 3300047447 Bacteria 1812
300 Ga0495684_0024490 3300047471 Bacteria 4646
301 Ga0495593_0014307 3300047673 Bacteria 4511
302 Ga0495602_0079324 3300048088 Bacteria 2769
303 Ga0495602_0452050 3300048088 Bacteria 906
304 Ga0496100_0032418 3300048903 Bacteria 3259
305 Ga0496100_0064273 3300048903 Bacteria 2428
306 Ga0496100_0071077 3300048903 Bacteria 2322
307 Ga0496102_0025371 3300048905 Bacteria 5277
308 Ga0496102_0168137 3300048905 Bacteria 2064
309 Ga0496102_0864216 3300048905 Bacteria 826
310 Ga0496103_0224992 3300048906 Bacteria 1206
311 Ga0496104_0060208 3300048907 Bacteria 3597
312 Ga0496104_0153038 3300048907 Bacteria 2214
313 Ga0496104_0155313 3300048907 Bacteria 2196
314 Ga0496105_0025843 3300048908 Bacteria 4783
315 Ga0496105_0117184 3300048908 Bacteria 2197
316 Ga0496105_0496818 3300048908 Bacteria 958
317 Ga0496105_0609843 3300048908 Bacteria 846
318 Ga0496106_0225349 3300048909 Bacteria 1495
319 Ga0496107_0117969 3300048910 Bacteria 1954
320 Ga0496108_0036119 3300048911 Bacteria 4109
321 Ga0496108_0105545 3300048911 Bacteria 2405
322 Ga0496109_0112435 3300048912 Bacteria 2532
323 Ga0496110_0130899 3300048913 Bacteria 2265
324 Ga0496110_0693465 3300048913 Bacteria 919
325 Ga0496111_0056839 3300048914 Bacteria 2831
326 Ga0496111_0061655 3300048914 Bacteria 2718
327 Ga0496112_0010964 3300048915 Bacteria 8254
328 Ga0496112_0040596 3300048915 Bacteria 4550
329 Ga0496112_0066055 3300048915 Bacteria 3569
330 Ga0496113_0163887 3300048916 Bacteria 1758
331 Ga0496114_0001036 3300048917 Bacteria 20908
332 Ga0496114_0025352 3300048917 Bacteria 4847
333 Ga0496114_0091474 3300048917 Bacteria 2584
334 Ga0496114_0196569 3300048917 Bacteria 1765
335 Ga0496115_0016582 3300048918 Bacteria 5612
336 Ga0496116_0000922 3300048919 Bacteria 36312
337 Ga0496117_0008325 3300048920 Bacteria 9870
338 Ga0496117_0095158 3300048920 Bacteria 1904
339 Ga0496118_0003795 3300048921 Bacteria 18635
340 Ga0496118_0004523 3300048921 Bacteria 16429
341 Ga0496119_0001025 3300048922 Bacteria 35816
342 Ga0496119_0020018 3300048922 Bacteria 4898
343 Ga0496119_0307543 3300048922 Bacteria 779
344 Ga0496120_0000672 3300048923 Bacteria 50278
345 Ga0496121_0008952 3300048924 Bacteria 11618
346 Ga0496125_0366094 3300048928 Bacteria 855
347 Ga0496126_0139448 3300048929 Bacteria 2089
348 Ga0501032_0007123 3300049569 Bacteria 8188
349 Ga0501034_0315259 3300049571 Bacteria 1498
350 Ga0501036_0010617 3300049572 Bacteria 7608
351 Ga0501036_0110539 3300049572 Bacteria 2322
352 Ga0501037_0015156 3300049573 Bacteria 5673
353 Ga0501039_0034996 3300049575 Bacteria 3876
354 Ga0501039_0158134 3300049575 Bacteria 1781
355 Ga0501039_0551180 3300049575 Bacteria 905
356 Ga0501041_0075623 3300049577 Bacteria 2071
357 Ga0501043_0133103 3300049579 Bacteria 1948
358 Ga0501043_0164196 3300049579 Bacteria 1734
359 Ga0501043_0232362 3300049579 Bacteria 1424
360 Ga0501047_0106424 3300049581 Bacteria 2685
361 Ga0501048_0076095 3300049582 Bacteria 2369
362 Ga0501069_0013514 3300049585 Bacteria 4353
363 Ga0501069_0121681 3300049585 Bacteria 1491
364 Ga0501070_0002483 3300049586 Bacteria 16167
365 Ga0501070_0009284 3300049586 Bacteria 8319
366 Ga0501070_0026903 3300049586 Bacteria 4824
367 Ga0501070_0266581 3300049586 Bacteria 1399
368 Ga0501070_0500007 3300049586 Bacteria 977
369 Ga0501071_0030420 3300049587 Bacteria 3819
370 Ga0501072_0019092 3300049588 Bacteria 5295
371 Ga0501074_0020237 3300049590 Bacteria 4835
372 Ga0501074_0057561 3300049590 Bacteria 2800
373 Ga0501075_0569121 3300049591 Bacteria 864
374 Ga0501076_0041875 3300049592 Bacteria 3606
375 Ga0501079_0013828 3300049741 Bacteria 6155
376 Ga0501080_0013977 3300049742 Bacteria 7389
377 Ga0501080_0017570 3300049742 Bacteria 6613
378 Ga0501035_0003825 3300049822 Bacteria 14346
379 Ga0501035_0174597 3300049822 Bacteria 1854
380 Ga0501044_0009182 3300049823 Bacteria 10799
381 Ga0501044_0009930 3300049823 Bacteria 10340
382 Ga0501044_0077900 3300049823 Bacteria 3360
383 Ga0501045_0138646 3300049824 Bacteria 1809
384 nmdc:mga00v17_117663_c1 3300050491 Bacteria 1690
385 nmdc:mga05p37_1984_c1 3300050507 Bacteria 23864
386 nmdc:mga05p37_24_c1 3300050507 Bacteria 118187
387 nmdc:mga05p37_660750_c1 3300050507 Bacteria 1168
388 nmdc:mga05p37_82975_c1 3300050507 Bacteria 3949
389 nmdc:mga09592_205154_c1 3300050508 Bacteria 1707
390 nmdc:mga09592_2_c1 3300050508 Bacteria 168133
391 nmdc:mga0qj67_10_c1 3300050509 Bacteria 83362
392 nmdc:mga06r32_343_c1 3300050510 Bacteria 38821
393 nmdc:mga06r32_397929_c1 3300050510 Bacteria 1359
394 Ga0495601_0010597 3300053077 Bacteria 5491
395 Ga0495612_0006076 3300053078 Bacteria 4970
396 Ga0495619_0003152 3300053085 Bacteria 10695
397 Ga0500644_0056524 3300053088 Bacteria 1366
398 Ga0500583_0156958 3300053092 Bacteria 1133
399 Ga0500568_0001331 3300053139 Bacteria 16180
400 Ga0500616_0123294 3300053153 Bacteria 1234
401 Ga0501082_0438847 3300060353 Bacteria 1140
402 Ga0466962_0026437 3300061719 Bacteria 2786
403 Ga0530510_0116030 3300061734 Bacteria 1963
404 Ga0530510_0170537 3300061734 Bacteria 1612
405 2506864634 2506783011 Bacteria 5323186
406 2508670829 2508501039 Bacteria 9978592
407 2517762370 2517572101 Bacteria 6884336
408 2528204172 2527291627 Bacteria 5309833
409 2528214690 2527291629 Bacteria 5267418
410 2546947067 2546825537 Bacteria 5389291
411 2579747427 2576861822 Bacteria 5004595
412 2579857432 2579778521 Bacteria 7624758
413 2619853931 2619618881 Bacteria 7521104
414 2620353234 2619619003 Bacteria 7619552
415 2644017187 2643221601 Bacteria 7493239
416 2644173852 2643221631 Bacteria 8168043
417 2671835911 2671180195 Bacteria 9757215
418 2676201153 2675902999 Bacteria 9438463
419 2686539806 2684623035 Bacteria 8032739
420 2686543424 2684623036 Bacteria 5199090
421 2689959152 2687453737 Bacteria 11203906
422 2689992185 2687453743 Bacteria 8361025
423 2710603449 2710264753 Bacteria 5455564
424 2753070194 2751185734 Bacteria 8863695
425 2768644728 2767802112 Bacteria 6465194
426 2774845729 2773857921 Bacteria 9435764
427 2774854067 2773857922 Bacteria 9757215
428 2774867189 2773857924 Bacteria 5256821
429 2774904946 2773857933 Bacteria 5818019
430 2784588931 2784132148 Bacteria 8627943
431 2809232550 2808606448 Bacteria 8656184
432 2819741150 2818991472 Bacteria 10089953
433 2831938042 2831935698 Bacteria 5963223
434 2832007650 2832004796 Bacteria 6538017
435 2866065427 2866065130 Bacteria 6518152
436 2867507882 2867507094 Bacteria 6506033
437 2870730002 2870721527 Bacteria 9689237
438 2895885683 2895880812 Bacteria 11255272
439 2977251700 2977251589 Bacteria 2952848
440 2990047031 2990044586 Bacteria 6603797
441 2995465846 2995463766 Bacteria 8577691
442 2995466700 2995463766 Bacteria 8577691
443 637877755 637000116 Bacteria 5433628
444 8002782223 8002775197 Bacteria 10728764
445 8002789913 8002784119 Bacteria 9788632
446 8002813527 8002811521 Bacteria 2942897
447 8023624042 8023623736 Bacteria 8593882
448 8054914363 8054913762 Bacteria 7713009
449 8054923502 8054920844 Bacteria 7068637
450 8055037010 8055034563 Bacteria 3562128
451 8055040594 8055037949 Bacteria 3337834
452 8055160425 8055157932 Bacteria 6429399
453 8056451063 8056447290 Bacteria 7680491
454 Ga0496102_0194604
455 JGI25404J52841_10031930
456 Ga0058863_11339592
457 Ga0070658_10005443
458 Ga0070658_10089621
459 Ga0070683_100001875
460 Ga0070683_100357112
461 Ga0070683_100396684
462 Ga0070690_100010990
463 Ga0068869_100193756
464 Ga0070680_100623405
465 Ga0070682_100051547
466 Ga0070660_100104921
467 Ga0070689_100123031
468 Ga0070691_10021224
469 Ga0070687_100015933
470 Ga0070675_100067807
471 Ga0070671_100265649
472 Ga0070674_100066168
473 Ga0070674_100543176
474 Ga0070673_100096938
475 Ga0070659_100039456
476 Ga0070703_10111328
477 Ga0070705_100057677
478 Ga0070700_100205361
479 Ga0070663_100027325
480 Ga0070679_100086039
481 Ga0070684_100041323
482 Ga0070684_100047536
483 Ga0070684_100402146
484 Ga0070697_100326585
485 Ga0070672_100512343
486 Ga0070686_100207717
487 Ga0070695_100255925
488 Ga0070696_100079816
489 Ga0070693_100109559
490 Ga0068855_100008457
491 Ga0068855_100010104
492 Ga0070664_100078767
493 Ga0070664_100102069
494 Ga0068854_100183599
495 Ga0068852_100057763
496 Ga0068852_100112939
497 Ga0068859_100001508
498 Ga0068859_100057701
499 Ga0068864_100036663
500 Ga0068861_100101831
501 Ga0068851_10257126
502 Ga0068870_10012716
503 Ga0068863_100000643
504 Ga0068863_100111053
505 Ga0068863_100547759
506 Ga0068858_100000039
507 Ga0068858_100023937
508 Ga0068858_100114316
509 Ga0068860_100885230
510 Ga0068862_100000150
511 Ga0068862_100690648
512 Ga0081540_1000402
513 Ga0075428_100000807
514 Ga0075428_100031735
515 Ga0075428_100117825
516 Ga0075428_100158331
517 Ga0075430_100034469
518 Ga0075431_100011440
519 Ga0075434_100069387
520 Ga0075429_100003536
521 Ga0075436_100102838
522 Ga0097620_100001508
523 Ga0097620_100032460
524 Ga0097620_100057699
525 Ga0105251_10047697
526 Ga0105251_10069849
527 Ga0105250_10057791
528 Ga0105240_10003545
529 Ga0105240_10369693
530 Ga0105245_10308294
531 Ga0105247_10000519
532 Ga0105247_10021234
533 Ga0105247_10123486
534 Ga0114129_10000024
535 Ga0114129_10009554
536 Ga0114129_10104550
537 Ga0105243_10133515
538 Ga0105248_10000866
539 Ga0105248_10010791
540 Ga0105248_10121137
541 Ga0105237_10484272
542 Ga0105249_10187699
543 Ga0105249_10794378
544 Ga0105239_11191716
545 Ga0157320_1000419
546 Ga0157373_10074066
547 Ga0157371_10068701
548 Ga0157370_10016452
549 Ga0157370_10100953
550 Ga0157369_10044134
551 Ga0157369_10268831
552 Ga0157369_10339300
553 Ga0157369_10931984
554 Ga0157374_10695781
555 Ga0163162_10173003
556 Ga0163162_10859359
557 Ga0157372_10187206
558 Ga0157375_10087170
559 Ga0163163_10012689
560 Ga0163163_10076455
561 Ga0163163_10086098
562 Ga0157380_10043855
563 Ga0157379_10000288
564 Ga0157379_10029041
565 Ga0157379_10037097
566 Ga0163161_10035827
567 Ga0197907_10100242
568 Ga0206355_1618483
569 Ga0206350_10045767
570 Ga0206354_11503868
571 Ga0206353_11866792
572 Ga0213876_10002948
573 Ga0207656_10169553
574 Ga0207710_10000127
575 Ga0207710_10000366
576 Ga0207710_10315630
577 Ga0207688_10032138
578 Ga0207699_10051347
579 Ga0207645_10078645
580 Ga0207643_10053293
581 Ga0207705_10035474
582 Ga0207705_10071157
583 Ga0207705_10171797
584 Ga0207684_10848040
585 Ga0207654_10213409
586 Ga0207707_10566377
587 Ga0207695_10013572
588 Ga0207695_10722995
589 Ga0207693_10022418
590 Ga0207662_10003543
591 Ga0207657_10021811
592 Ga0207652_10103740
593 Ga0207681_10420262
594 Ga0207650_10670863
595 Ga0207659_10034914
596 Ga0207700_10050655
597 Ga0207664_10331528
598 Ga0207706_10069709
599 Ga0207709_10168382
600 Ga0207704_10027505
601 Ga0207691_10017441
602 Ga0207711_10000293
603 Ga0207711_10003201
604 Ga0207711_10550851
605 Ga0207689_10014481
606 Ga0207661_10166493
607 Ga0207679_10038099
608 Ga0207679_10040207
609 Ga0207667_10019922
610 Ga0207667_10071615
611 Ga0207667_10171454
612 Ga0207712_10116269
613 Ga0207668_10153327
614 Ga0207703_10000039
615 Ga0207703_10119978
616 Ga0207639_10129039
617 Ga0207678_10004697
618 Ga0207708_10054761
619 Ga0207702_10014473
620 Ga0207641_10010806
621 Ga0207648_10017887
622 Ga0207674_10021199
623 Ga0207675_100039165
624 Ga0207683_10004059
625 Ga0207698_10784137
626 Ga0268265_10000276
627 Ga0268265_10147593
628 Ga0268264_10170250
629 Ga0307515_10072815
630 Ga0265338_10026039
631 Ga0265325_10020066
632 Ga0265325_10051368
633 Ga0265340_10030553
634 Ga0265339_10035517
635 Ga0265316_10155051
636 Ga0307513_10007773
637 Ga0307408_100886120
638 Ga0265313_10111223
639 Ga0307508_10044053
640 Ga0307508_10081409
641 Ga0307508_10140724
642 Ga0265314_10020747
643 Ga0265342_10031223
644 Ga0307405_10345300
645 Ga0307406_10055962
646 Ga0307406_10547208
647 Ga0307407_10003495
648 Ga0307412_10011952
649 Ga0307409_100002991
650 Ga0307416_100000174
651 Ga0307416_100370578
652 Ga0307416_100410337
653 Ga0307416_100424972
654 Ga0307414_10325030
655 Ga0307415_100000183
656 Ga0307415_100032058
657 Ga0307415_100107078
658 Ga0373938_0003199
659 Ga0373926_0002798
660 Ga0373928_0003128
661 Ga0373934_0006688
662 Ga0373934_0235833
663 Ga0373940_0012766
664 Ga0373944_0006217
665 Ga0373949_0007038
666 Ga0373952_0059436
667 Ga0373923_0036531
668 Ga0373936_0000919
669 Ga0373945_0002162
670 Ga0373953_0004383
671 Ga0373957_0017869
672 Ga0373943_0002809
673 Ga0373946_0000154
674 Ga0373955_0002313
675 Ga0373961_0006511
676 Ga0373924_0054737
677 Ga0373931_0169766
678 Ga0373935_0012119
679 Ga0373927_0025005
680 Ga0373933_0005412
681 Ga0373947_0007978
682 Ga0373937_0449550
683 Ga0373937_0545253
684 Ga0372808_007129
685 Ga0373925_0008864
686 Ga0395899_0117863
687 Ga0395900_0437335
688 Ga0395898_0028177
689 Ga0436364_1540925
690 Ga0395901_0019156
691 Ga0436365_0067462
692 Ga0451853_0491630
693 Ga0450903_031831
694 Ga0466961_0072842
695 Ga0466961_0132824
696 Ga0466963_0081091
697 Ga0466963_0167112
698 Ga0466963_0511770
699 Ga0466971_0052718
700 Ga0466957_0235306
701 Ga0466958_0002916
702 Ga0466958_0060333
703 Ga0466967_0060270
704 Ga0466967_0061328
705 Ga0466967_0204220
706 Ga0495592_0098992
707 Ga0495603_0006626
708 Ga0495629_0000814
709 Ga0495641_0007645
710 Ga0495651_0141191
711 Ga0495651_0310591
712 Ga0495580_0005898
713 Ga0495582_0003160
714 Ga0495639_0000844
715 Ga0495662_0004738
716 Ga0495662_0014871
717 Ga0495664_0002002
718 Ga0495594_0055977
719 Ga0495594_0128545
720 Ga0495594_0188435
721 Ga0495608_0097091
722 Ga0495608_0301624
723 Ga0495628_0022606
724 Ga0495628_0550499
725 Ga0495630_0056074
726 Ga0495632_0075312
727 Ga0495648_0024376
728 Ga0495666_0003615
729 Ga0495652_0036153
730 Ga0495665_0007595
731 Ga0495640_0011073
732 Ga0495586_0007118
733 Ga0495645_0082377
734 Ga0495645_0473580
735 Ga0495657_0094660
736 Ga0495599_0017752
737 Ga0495623_0015738
738 Ga0495623_0073671
739 Ga0495646_0009951
740 Ga0495647_0024868
741 Ga0495658_0002286
742 Ga0495613_0002511
743 Ga0495624_0006156
744 Ga0495600_0006168
745 Ga0495581_0002875
746 Ga0495604_0001392
747 Ga0495604_0006758
748 Ga0495674_0033404
749 Ga0495676_0017126
750 Ga0495680_0070146
751 Ga0495675_0001113
752 Ga0495685_031843
753 Ga0495684_0024490
754 Ga0495593_0014307
755 Ga0495602_0079324
756 Ga0495602_0452050
757 Ga0496100_0032418
758 Ga0496100_0064273
759 Ga0496100_0071077
760 Ga0496102_0025371
761 Ga0496102_0168137
762 Ga0496102_0864216
763 Ga0496103_0224992
764 Ga0496104_0060208
765 Ga0496104_0153038
766 Ga0496104_0155313
767 Ga0496105_0025843
768 Ga0496105_0117184
769 Ga0496105_0496818
770 Ga0496105_0609843
771 Ga0496106_0225349
772 Ga0496107_0117969
773 Ga0496108_0036119
774 Ga0496108_0105545
775 Ga0496109_0112435
776 Ga0496110_0130899
777 Ga0496110_0693465
778 Ga0496111_0056839
779 Ga0496111_0061655
780 Ga0496112_0010964
781 Ga0496112_0040596
782 Ga0496112_0066055
783 Ga0496113_0163887
784 Ga0496114_0001036
785 Ga0496114_0025352
786 Ga0496114_0091474
787 Ga0496114_0196569
788 Ga0496115_0016582
789 Ga0496116_0000922
790 Ga0496117_0008325
791 Ga0496117_0095158
792 Ga0496118_0003795
793 Ga0496118_0004523
794 Ga0496119_0001025
795 Ga0496119_0020018
796 Ga0496119_0307543
797 Ga0496120_0000672
798 Ga0496121_0008952
799 Ga0496125_0366094
800 Ga0496126_0139448
801 Ga0501032_0007123
802 Ga0501034_0315259
803 Ga0501036_0010617
804 Ga0501036_0110539
805 Ga0501037_0015156
806 Ga0501039_0034996
807 Ga0501039_0158134
808 Ga0501039_0551180
809 Ga0501041_0075623
810 Ga0501043_0133103
811 Ga0501043_0164196
812 Ga0501043_0232362
813 Ga0501047_0106424
814 Ga0501048_0076095
815 Ga0501069_0013514
816 Ga0501069_0121681
817 Ga0501070_0002483
818 Ga0501070_0009284
819 Ga0501070_0026903
820 Ga0501070_0266581
821 Ga0501070_0500007
822 Ga0501071_0030420
823 Ga0501072_0019092
824 Ga0501074_0020237
825 Ga0501074_0057561
826 Ga0501075_0569121
827 Ga0501076_0041875
828 Ga0501079_0013828
829 Ga0501080_0013977
830 Ga0501080_0017570
831 Ga0501035_0003825
832 Ga0501035_0174597
833 Ga0501044_0009182
834 Ga0501044_0009930
835 Ga0501044_0077900
836 Ga0501045_0138646
837 nmdc:mga00v17_117663_c1
838 nmdc:mga05p37_1984_c1
839 nmdc:mga05p37_24_c1
840 nmdc:mga05p37_660750_c1
841 nmdc:mga05p37_82975_c1
842 nmdc:mga09592_205154_c1
843 nmdc:mga09592_2_c1
844 nmdc:mga0qj67_10_c1
845 nmdc:mga06r32_343_c1
846 nmdc:mga06r32_397929_c1
847 Ga0495601_0010597
848 Ga0495612_0006076
849 Ga0495619_0003152
850 Ga0500644_0056524
851 Ga0500583_0156958
852 Ga0500568_0001331
853 Ga0500616_0123294
854 Ga0501082_0438847
855 Ga0466962_0026437
856 Ga0530510_0116030
857 Ga0530510_0170537
858 2506864634
859 2508670829
860 2517762370
861 2528204172
862 2528214690
863 2546947067
864 2579747427
865 2579857432
866 2619853931
867 2620353234
868 2644017187
869 2644173852
870 2671835911
871 2676201153
872 2686539806
873 2686543424
874 2689959152
875 2689992185
876 2710603449
877 2753070194
878 2768644728
879 2774845729
880 2774854067
881 2774867189
882 2774904946
883 2784588931
884 2809232550
885 2819741150
886 2831938042
887 2832007650
888 2866065427
889 2867507882
890 2870730002
891 2895885683
892 2977251700
893 2990047031
894 2995465846
895 2995466700
896 637877755
897 8002782223
898 8002789913
899 8002813527
900 8023624042
901 8054914363
902 8054923502
903 8055037010
904 8055040594
905 8055160425
906 8056451063

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

92

161

0.99

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

30

89

0.97

PF04023

FeoA

FeoA domain

188

255

0.91

PF18357

DtxR

Diphteria toxin repressor SH3 domain

181

255

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b25-assembly1.cif.gz_D dtxr-like iron-dependent regulator ider (q43a variant) complexed with cobalt and its consensus dna-binding sequence 0.9809 6 143
7b1y-assembly1.cif.gz_A dtxr-like iron-dependent regulator ider complexed with cobalt and its consensus dna-binding sequence 0.9794 6 143
1f5t-assembly1.cif.gz_A diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence 0.9784 5 123
2tdx-assembly1.cif.gz_A-2 diphtheria tox repressor (c102d mutant) complexed with nickel 0.9767 5 142
2isz-assembly1.cif.gz_B crystal structure of a two-domain ider-dna complex crystal form i 0.9758 5 143
ID Description Score Start End Superfamily
2iszA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 1.001 79 138 1.10.60.10
2it0C02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9998 79 138 1.10.60.10
3glxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9971 9 75 1.10.10.10
1f5tA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.997 79 123 1.10.60.10
1ddnC02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9933 79 122 1.10.60.10
ID Description Score Start End GO Terms
AF-Q9F7T1-F1-model_v4 Iron dependent regulatory protein 1 9 111 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A358DE73-F1-model_v4 Dihydrofolate reductase 0.9911 5 107 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-Q9F7T1-F1-model_v4 Iron dependent regulatory protein 0.9904 9 111 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A7G2TG80-F1-model_v4 Transcriptional regulator MntR 0.9895 5 147 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A0D4DMW5-F1-model_v4 deleted 0.9733 7 229

Map