F447256

General Info

Members Datasets Scaffolds Average Seq Length
453 207 906 138

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0310073|Ga0495670_0310073_19_411
Length 130
Sequence MLRVSDPEATVAFFQLLGLEERRRMEVPEGKFTLIFLGVPGDEAEVELTHNWEESGYAGGRNFGHLAFRVDDIYATCRTLMDNGVTINRPPRDGHMAFVKSPDGISVELLQQGKLEPAEPWTSMPNIGSW

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
68 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 7.73
Rhizosphere 91.17
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0310073 3300046691 Bacteria 846
2 JGI24737J22298_10005581 3300001990 Bacteria 4334
3 JGI24737J22298_10029013 3300001990 Bacteria 1736
4 Ga0070658_10010980 3300005327 Bacteria 7259
5 Ga0070658_10037316 3300005327 Bacteria 3917
6 Ga0070658_10650014 3300005327 Bacteria 915
7 Ga0070658_10699940 3300005327 Bacteria 879
8 Ga0070676_10590953 3300005328 Bacteria 799
9 Ga0070683_100004192 3300005329 Bacteria 11822
10 Ga0070683_101668344 3300005329 Bacteria 613
11 Ga0070670_100001207 3300005331 Bacteria 20529
12 Ga0070670_100035076 3300005331 Bacteria 4317
13 Ga0070670_100827490 3300005331 Bacteria 837
14 Ga0068869_100306675 3300005334 Bacteria 1283
15 Ga0070666_10004685 3300005335 Bacteria 8356
16 Ga0070666_10157995 3300005335 Bacteria 1584
17 Ga0070666_10727192 3300005335 Bacteria 729
18 Ga0070682_100025051 3300005337 Bacteria 3558
19 Ga0068868_100006329 3300005338 Bacteria 8370
20 Ga0068868_100380829 3300005338 Bacteria 1214
21 Ga0070660_100000091 3300005339 Bacteria 54397
22 Ga0070660_100008889 3300005339 Bacteria 7044
23 Ga0070660_100107195 3300005339 Bacteria 2220
24 Ga0070660_100181320 3300005339 Bacteria 1704
25 Ga0070660_100779033 3300005339 Bacteria 804
26 Ga0070661_100019971 3300005344 Bacteria 4775
27 Ga0070661_100020645 3300005344 Bacteria 4698
28 Ga0070661_100284837 3300005344 Bacteria 1283
29 Ga0070668_100030234 3300005347 Bacteria 4118
30 Ga0070668_100909763 3300005347 Bacteria 787
31 Ga0070669_100162810 3300005353 Bacteria 1735
32 Ga0070669_100813426 3300005353 Bacteria 795
33 Ga0070669_101169783 3300005353 Bacteria 664
34 Ga0070675_100105073 3300005354 Bacteria 2383
35 Ga0070675_100652477 3300005354 Bacteria 956
36 Ga0070671_100000051 3300005355 Bacteria 79207
37 Ga0070671_100008986 3300005355 Bacteria 8019
38 Ga0070671_100086223 3300005355 Bacteria 2626
39 Ga0070671_100252280 3300005355 Bacteria 1499
40 Ga0070674_100343809 3300005356 Bacteria 1203
41 Ga0070673_100005552 3300005364 Bacteria 8088
42 Ga0070673_100061770 3300005364 Bacteria 2974
43 Ga0070673_100079505 3300005364 Bacteria 2655
44 Ga0070673_100083098 3300005364 Bacteria 2601
45 Ga0070659_100094657 3300005366 Bacteria 2399
46 Ga0070659_100121139 3300005366 Bacteria 2119
47 Ga0070659_100162614 3300005366 Bacteria 1826
48 Ga0070659_100371270 3300005366 Bacteria 1203
49 Ga0070659_101846799 3300005366 Bacteria 541
50 Ga0070667_100129169 3300005367 Bacteria 2204
51 Ga0070667_100182331 3300005367 Bacteria 1857
52 Ga0070667_100199455 3300005367 Bacteria 1775
53 Ga0070667_100535144 3300005367 Bacteria 1076
54 Ga0070667_100776619 3300005367 Bacteria 889
55 Ga0070709_10204612 3300005434 Bacteria 1400
56 Ga0070714_100345869 3300005435 Bacteria 1396
57 Ga0070713_100252079 3300005436 Bacteria 1610
58 Ga0070710_10523860 3300005437 Bacteria 815
59 Ga0070694_100097451 3300005444 Bacteria 2074
60 Ga0070694_100284530 3300005444 Bacteria 1262
61 Ga0070663_100039702 3300005455 Bacteria 3291
62 Ga0070678_100001370 3300005456 Bacteria 12966
63 Ga0070678_100001634 3300005456 Bacteria 11998
64 Ga0070662_100001687 3300005457 Bacteria 13593
65 Ga0070662_100017289 3300005457 Bacteria 4859
66 Ga0070662_100067138 3300005457 Bacteria 2633
67 Ga0070662_100086588 3300005457 Bacteria 2343
68 Ga0070662_100159729 3300005457 Bacteria 1762
69 Ga0070662_100430549 3300005457 Bacteria 1093
70 Ga0070681_10062700 3300005458 Bacteria 3691
71 Ga0070681_10100600 3300005458 Bacteria 2837
72 Ga0070681_10428462 3300005458 Bacteria 1235
73 Ga0070679_100163458 3300005530 Bacteria 2200
74 Ga0070684_100026091 3300005535 Bacteria 4918
75 Ga0070697_100654912 3300005536 Bacteria 925
76 Ga0068853_100494829 3300005539 Bacteria 1154
77 Ga0070672_100004562 3300005543 Bacteria 9070
78 Ga0070672_100065703 3300005543 Bacteria 2870
79 Ga0070672_100678969 3300005543 Bacteria 901
80 Ga0070672_102017756 3300005543 Bacteria 520
81 Ga0070695_100087712 3300005545 Bacteria 2070
82 Ga0070665_100004860 3300005548 Bacteria 13963
83 Ga0070665_100029457 3300005548 Bacteria 5525
84 Ga0070665_100109752 3300005548 Bacteria 2761
85 Ga0070665_101498949 3300005548 Bacteria 683
86 Ga0068855_100000129 3300005563 Bacteria 96519
87 Ga0068855_100091005 3300005563 Bacteria 3519
88 Ga0068855_100849341 3300005563 Bacteria 967
89 Ga0070664_100003755 3300005564 Bacteria 12249
90 Ga0070664_100396520 3300005564 Bacteria 1261
91 Ga0070664_100604548 3300005564 Bacteria 1017
92 Ga0070664_100642473 3300005564 Bacteria 986
93 Ga0068857_100030612 3300005577 Bacteria 4753
94 Ga0068857_100098701 3300005577 Bacteria 2619
95 Ga0068854_100003822 3300005578 Bacteria 9425
96 Ga0068854_101246236 3300005578 Bacteria 668
97 Ga0068856_100659819 3300005614 Bacteria 1067
98 Ga0068859_100563794 3300005617 Bacteria 1233
99 Ga0068859_100577812 3300005617 Bacteria 1217
100 Ga0068864_100008056 3300005618 Bacteria 8690
101 Ga0068864_100035162 3300005618 Bacteria 4265
102 Ga0068864_101648474 3300005618 Bacteria 646
103 Ga0068866_10129099 3300005718 Bacteria 1435
104 Ga0068866_10265583 3300005718 Bacteria 1057
105 Ga0068851_10691926 3300005834 Bacteria 627
106 Ga0068863_100009976 3300005841 Bacteria 9246
107 Ga0068863_100095885 3300005841 Bacteria 2816
108 Ga0068863_100239519 3300005841 Bacteria 1751
109 Ga0068858_100002934 3300005842 Bacteria 17162
110 Ga0068858_102213416 3300005842 Bacteria 543
111 Ga0068860_100048248 3300005843 Bacteria 4058
112 Ga0068860_101095283 3300005843 Bacteria 816
113 Ga0068862_100004852 3300005844 Bacteria 11319
114 Ga0068862_100218238 3300005844 Bacteria 1726
115 Ga0070712_100014354 3300006175 Bacteria 5085
116 Ga0070712_100179038 3300006175 Bacteria 1651
117 Ga0097621_100006802 3300006237 Bacteria 8126
118 Ga0097621_100024788 3300006237 Bacteria 4688
119 Ga0097621_100165964 3300006237 Bacteria 1901
120 Ga0068871_100026600 3300006358 Bacteria 4517
121 Ga0075428_102358895 3300006844 Bacteria 547
122 Ga0075431_100532293 3300006847 Bacteria 1164
123 Ga0068865_100131360 3300006881 Bacteria 1877
124 Ga0097620_100563787 3300006931 Bacteria 1233
125 Ga0097620_100577832 3300006931 Bacteria 1217
126 Ga0105240_10299536 3300009093 Bacteria 1840
127 Ga0111539_10010849 3300009094 Bacteria 11468
128 Ga0105245_10025012 3300009098 Bacteria 5248
129 Ga0105247_10111114 3300009101 Bacteria 1764
130 Ga0114129_11698418 3300009147 Bacteria 770
131 Ga0105241_10191322 3300009174 Bacteria 1703
132 Ga0105242_12708516 3300009176 Bacteria 546
133 Ga0105248_10008535 3300009177 Bacteria 11248
134 Ga0105248_10010453 3300009177 Bacteria 10221
135 Ga0105248_10011986 3300009177 Bacteria 9560
136 Ga0105248_10037148 3300009177 Bacteria 5447
137 Ga0105248_10242124 3300009177 Bacteria 2030
138 Ga0105248_10285227 3300009177 Bacteria 1859
139 Ga0105238_11721690 3300009551 Bacteria 658
140 Ga0105249_10037568 3300009553 Bacteria 4395
141 Ga0105249_11852546 3300009553 Bacteria 676
142 Ga0105032_109231 3300009979 Bacteria 807
143 Ga0105030_118217 3300009987 Bacteria 631
144 Ga0105239_10309344 3300010375 Bacteria 1781
145 Ga0157327_1028255 3300012512 Bacteria 683
146 Ga0157373_10419662 3300013100 Bacteria 960
147 Ga0157373_11033437 3300013100 Bacteria 614
148 Ga0157371_10003542 3300013102 Bacteria 14084
149 Ga0157371_10031719 3300013102 Bacteria 3806
150 Ga0157371_10047482 3300013102 Bacteria 3053
151 Ga0157371_10051752 3300013102 Bacteria 2918
152 Ga0157371_10223985 3300013102 Bacteria 1351
153 Ga0157371_10261703 3300013102 Bacteria 1247
154 Ga0157370_10061094 3300013104 Bacteria 3576
155 Ga0157370_10066706 3300013104 Bacteria 3402
156 Ga0157374_10011150 3300013296 Bacteria 7769
157 Ga0157374_11043477 3300013296 Bacteria 837
158 Ga0157374_11358321 3300013296 Bacteria 733
159 Ga0157378_10735693 3300013297 Bacteria 1008
160 Ga0163162_10006737 3300013306 Bacteria 11144
161 Ga0163162_10258811 3300013306 Bacteria 1872
162 Ga0163162_10262978 3300013306 Bacteria 1857
163 Ga0157372_10113320 3300013307 Bacteria 3108
164 Ga0157375_10003256 3300013308 Bacteria 14099
165 Ga0157375_10050373 3300013308 Bacteria 4085
166 Ga0157375_11154471 3300013308 Bacteria 908
167 Ga0157375_13354399 3300013308 Bacteria 534
168 Ga0157380_11329440 3300014326 Bacteria 767
169 Ga0207682_10052406 3300025893 Bacteria 1691
170 Ga0207682_10212297 3300025893 Bacteria 893
171 Ga0207688_10017938 3300025901 Bacteria 3851
172 Ga0207688_10029385 3300025901 Bacteria 3026
173 Ga0207688_10685688 3300025901 Bacteria 648
174 Ga0207680_10002185 3300025903 Bacteria 9167
175 Ga0207680_10459435 3300025903 Bacteria 904
176 Ga0207680_10957409 3300025903 Bacteria 613
177 Ga0207647_10011192 3300025904 Bacteria 6304
178 Ga0207647_10013059 3300025904 Bacteria 5771
179 Ga0207699_10122231 3300025906 Bacteria 1686
180 Ga0207645_10613797 3300025907 Bacteria 739
181 Ga0207643_11065695 3300025908 Bacteria 522
182 Ga0207705_10000091 3300025909 Bacteria 110768
183 Ga0207705_10127658 3300025909 Bacteria 1891
184 Ga0207654_10728912 3300025911 Bacteria 713
185 Ga0207707_10093215 3300025912 Bacteria 2631
186 Ga0207693_10009824 3300025915 Bacteria 7788
187 Ga0207693_10020646 3300025915 Bacteria 5238
188 Ga0207657_10000252 3300025919 Bacteria 57036
189 Ga0207657_10016875 3300025919 Bacteria 7027
190 Ga0207657_10023986 3300025919 Bacteria 5664
191 Ga0207657_10115120 3300025919 Bacteria 2216
192 Ga0207657_10148386 3300025919 Bacteria 1912
193 Ga0207657_10368292 3300025919 Bacteria 1132
194 Ga0207649_10073287 3300025920 Bacteria 2193
195 Ga0207649_10236500 3300025920 Bacteria 1309
196 Ga0207652_10181809 3300025921 Bacteria 1890
197 Ga0207652_10392674 3300025921 Bacteria 1252
198 Ga0207681_11122839 3300025923 Bacteria 660
199 Ga0207650_10048060 3300025925 Bacteria 3145
200 Ga0207659_10528023 3300025926 Bacteria 1001
201 Ga0207659_11009467 3300025926 Bacteria 716
202 Ga0207687_10079772 3300025927 Bacteria 2360
203 Ga0207687_10998272 3300025927 Bacteria 718
204 Ga0207687_11129462 3300025927 Bacteria 673
205 Ga0207700_10067520 3300025928 Bacteria 2737
206 Ga0207664_10173917 3300025929 Bacteria 1845
207 Ga0207664_10186671 3300025929 Bacteria 1783
208 Ga0207644_10001238 3300025931 Bacteria 16413
209 Ga0207644_10002715 3300025931 Bacteria 11405
210 Ga0207644_10004688 3300025931 Bacteria 8888
211 Ga0207644_10295223 3300025931 Bacteria 1304
212 Ga0207690_10061001 3300025932 Bacteria 2562
213 Ga0207690_10155868 3300025932 Bacteria 1697
214 Ga0207690_10175857 3300025932 Bacteria 1607
215 Ga0207690_10409982 3300025932 Bacteria 1082
216 Ga0207690_10458413 3300025932 Bacteria 1026
217 Ga0207690_10531064 3300025932 Bacteria 954
218 Ga0207690_10719674 3300025932 Unclassified 821
219 Ga0207690_10767073 3300025932 Bacteria 796
220 Ga0207690_11293389 3300025932 Bacteria 609
221 Ga0207706_10001743 3300025933 Bacteria 21360
222 Ga0207706_10015383 3300025933 Bacteria 6912
223 Ga0207706_10037497 3300025933 Bacteria 4304
224 Ga0207706_10916391 3300025933 Bacteria 740
225 Ga0207709_10427642 3300025935 Bacteria 1019
226 Ga0207709_11027737 3300025935 Bacteria 674
227 Ga0207669_11270725 3300025937 Bacteria 625
228 Ga0207669_11287767 3300025937 Bacteria 621
229 Ga0207665_10222911 3300025939 Bacteria 1382
230 Ga0207691_10008297 3300025940 Bacteria 9974
231 Ga0207691_10197995 3300025940 Bacteria 1749
232 Ga0207691_10975397 3300025940 Bacteria 708
233 Ga0207691_11736978 3300025940 Bacteria 504
234 Ga0207711_10001585 3300025941 Bacteria 20995
235 Ga0207711_10001689 3300025941 Bacteria 20332
236 Ga0207661_10062691 3300025944 Bacteria 3008
237 Ga0207679_10032405 3300025945 Bacteria 3668
238 Ga0207679_10072731 3300025945 Bacteria 2598
239 Ga0207679_10083585 3300025945 Bacteria 2447
240 Ga0207679_11125886 3300025945 Bacteria 720
241 Ga0207667_10001226 3300025949 Bacteria 32150
242 Ga0207667_10005995 3300025949 Bacteria 14785
243 Ga0207667_10632212 3300025949 Bacteria 1077
244 Ga0207651_10008681 3300025960 Bacteria 5506
245 Ga0207651_10368652 3300025960 Bacteria 1214
246 Ga0207651_10810749 3300025960 Bacteria 830
247 Ga0207712_10000819 3300025961 Bacteria 22891
248 Ga0207668_10021001 3300025972 Bacteria 4158
249 Ga0207668_11659686 3300025972 Bacteria 577
250 Ga0207640_11571091 3300025981 Bacteria 592
251 Ga0207658_10188744 3300025986 Bacteria 1711
252 Ga0207658_10414970 3300025986 Bacteria 1186
253 Ga0207658_10599525 3300025986 Bacteria 989
254 Ga0207658_10838333 3300025986 Bacteria 836
255 Ga0207658_10899547 3300025986 Bacteria 806
256 Ga0207658_11258447 3300025986 Bacteria 676
257 Ga0207703_10087044 3300026035 Bacteria 2618
258 Ga0207703_11118339 3300026035 Bacteria 757
259 Ga0207639_10241217 3300026041 Bacteria 1572
260 Ga0207639_11306478 3300026041 Bacteria 681
261 Ga0207678_10029713 3300026067 Bacteria 4772
262 Ga0207702_10008508 3300026078 Bacteria 8652
263 Ga0207702_10698919 3300026078 Bacteria 999
264 Ga0207641_10008581 3300026088 Bacteria 8437
265 Ga0207641_10036006 3300026088 Bacteria 4129
266 Ga0207641_10269953 3300026088 Bacteria 1596
267 Ga0207641_10353038 3300026088 Bacteria 1402
268 Ga0207676_10000253 3300026095 Bacteria 46261
269 Ga0207676_10006711 3300026095 Bacteria 8141
270 Ga0207676_10290400 3300026095 Bacteria 1488
271 Ga0207676_11125656 3300026095 Bacteria 777
272 Ga0207674_10005367 3300026116 Bacteria 15246
273 Ga0207674_10483105 3300026116 Bacteria 1197
274 Ga0207675_102482510 3300026118 Bacteria 529
275 Ga0207683_10002461 3300026121 Bacteria 16150
276 Ga0207683_10007674 3300026121 Bacteria 9235
277 Ga0207698_10340400 3300026142 Bacteria 1413
278 Ga0207698_10887168 3300026142 Bacteria 898
279 Ga0209974_10107873 3300027876 Bacteria 978
280 Ga0268266_10002799 3300028379 Bacteria 18189
281 Ga0268266_10060489 3300028379 Bacteria 3266
282 Ga0268266_10231322 3300028379 Bacteria 1703
283 Ga0268266_11108031 3300028379 Bacteria 766
284 Ga0268266_11242580 3300028379 Bacteria 720
285 Ga0268265_10005103 3300028380 Bacteria 9002
286 Ga0268264_10003670 3300028381 Bacteria 13190
287 Ga0316182_1013913 3300030745 Bacteria 690
288 Ga0307509_10969076 3300031507 Bacteria 517
289 Ga0307408_100060949 3300031548 Bacteria 2752
290 Ga0307408_100073956 3300031548 Bacteria 2527
291 Ga0307405_10427225 3300031731 Bacteria 1044
292 Ga0307413_10012493 3300031824 Bacteria 4229
293 Ga0307413_10079238 3300031824 Bacteria 2099
294 Ga0307413_10439023 3300031824 Bacteria 1033
295 Ga0307413_10749197 3300031824 Bacteria 816
296 Ga0307410_11114975 3300031852 Bacteria 684
297 Ga0307406_10367012 3300031901 Bacteria 1130
298 Ga0307406_10454944 3300031901 Bacteria 1028
299 Ga0307407_10161515 3300031903 Bacteria 1466
300 Ga0307412_10050476 3300031911 Bacteria 2745
301 Ga0307412_11090527 3300031911 Bacteria 710
302 Ga0307409_100029299 3300031995 Bacteria 3937
303 Ga0307409_100702650 3300031995 Bacteria 1010
304 Ga0307409_100832760 3300031995 Bacteria 932
305 Ga0307409_101537306 3300031995 Bacteria 693
306 Ga0307409_101963501 3300031995 Bacteria 615
307 Ga0307416_100004661 3300032002 Bacteria 8301
308 Ga0307416_100068774 3300032002 Bacteria 2927
309 Ga0307416_100284944 3300032002 Bacteria 1632
310 Ga0307416_102083139 3300032002 Bacteria 669
311 Ga0307414_10057479 3300032004 Bacteria 2734
312 Ga0307414_10536549 3300032004 Bacteria 1041
313 Ga0307414_11114750 3300032004 Bacteria 729
314 Ga0307414_11995548 3300032004 Bacteria 542
315 Ga0307411_10002297 3300032005 Bacteria 8376
316 Ga0307411_10834202 3300032005 Bacteria 814
317 Ga0307411_11095815 3300032005 Bacteria 717
318 Ga0307415_100183683 3300032126 Bacteria 1643
319 Ga0307415_100375590 3300032126 Bacteria 1205
320 Ga0373930_0082706 3300034816 Bacteria 744
321 Ga0395899_0037227 3300037312 Bacteria 3648
322 Ga0395899_0062521 3300037312 Bacteria 2742
323 Ga0395899_0085577 3300037312 Bacteria 2290
324 Ga0395899_0155970 3300037312 Bacteria 1615
325 Ga0395899_0620590 3300037312 Bacteria 686
326 Ga0395899_0748981 3300037312 Bacteria 608
327 Ga0395899_0900639 3300037312 Bacteria 539
328 Ga0395900_0014124 3300037418 Bacteria 8155
329 Ga0395900_0112900 3300037418 Bacteria 2789
330 Ga0395900_0194826 3300037418 Bacteria 2053
331 Ga0395900_0246338 3300037418 Bacteria 1790
332 Ga0395900_0321569 3300037418 Bacteria 1527
333 Ga0395900_0431228 3300037418 Bacteria 1277
334 Ga0395900_0468132 3300037418 Bacteria 1214
335 Ga0395900_0906827 3300037418 Bacteria 804
336 Ga0395900_0934647 3300037418 Bacteria 789
337 Ga0395900_1050037 3300037418 Bacteria 733
338 Ga0395900_1330519 3300037418 Bacteria 632
339 Ga0395898_0104395 3300037466 Bacteria 2718
340 Ga0395898_0129610 3300037466 Bacteria 2416
341 Ga0395898_0261582 3300037466 Bacteria 1650
342 Ga0395898_0418268 3300037466 Bacteria 1277
343 Ga0395905_0000226 3300037471 Bacteria 85938
344 Ga0395905_0033143 3300037471 Bacteria 4854
345 Ga0395905_0070725 3300037471 Bacteria 3270
346 Ga0395905_0189377 3300037471 Bacteria 1930
347 Ga0395905_0257554 3300037471 Bacteria 1629
348 Ga0395905_0301022 3300037471 Bacteria 1491
349 Ga0395905_0318994 3300037471 Bacteria 1443
350 Ga0395901_0158542 3300038443 Bacteria 2377
351 Ga0395901_0202485 3300038443 Bacteria 2080
352 Ga0395901_0327282 3300038443 Bacteria 1585
353 Ga0395901_0488075 3300038443 Bacteria 1255
354 Ga0395901_0798995 3300038443 Bacteria 932
355 Ga0395901_1020836 3300038443 Bacteria 802
356 Ga0395901_1090145 3300038443 Bacteria 769
357 Ga0439466_0043093 3300041411 Bacteria 1500
358 Ga0439449_0143584 3300042007 Bacteria 889
359 Ga0439462_0106438 3300042015 Bacteria 775
360 Ga0450889_000164 3300042144 Bacteria 6977
361 Ga0466969_0038004 3300044656 Unclassified 2425
362 Ga0466966_0000072 3300044684 Bacteria 65377
363 Ga0466966_0449933 3300044684 Bacteria 774
364 Ga0466961_0393591 3300044693 Unclassified 841
365 Ga0466963_0006830 3300044694 Bacteria 6791
366 Ga0466964_0196174 3300044706 Bacteria 966
367 Ga0466964_0693085 3300044706 Bacteria 567
368 Ga0453684_0041563 3300044712 Bacteria 6216
369 Ga0466971_0047696 3300044719 Bacteria 1926
370 Ga0466957_0015521 3300044842 Bacteria 4448
371 Ga0466957_0065771 3300044842 Bacteria 2234
372 Ga0466957_0081198 3300044842 Bacteria 2019
373 Ga0466957_0762526 3300044842 Bacteria 686
374 Ga0466959_0049106 3300045049 Unclassified 3100
375 Ga0451576_0008370 3300045051 Bacteria 12145
376 Ga0451576_0533205 3300045051 Bacteria 1233
377 Ga0466967_0008915 3300045976 Bacteria 7403
378 Ga0466967_0344139 3300045976 Bacteria 1442
379 Ga0466967_1575415 3300045976 Bacteria 654
380 Ga0466967_1719489 3300045976 Bacteria 625
381 Ga0495638_0098082 3300046460 Bacteria 1756
382 Ga0495580_0167890 3300046472 Bacteria 1518
383 Ga0495584_0291126 3300046491 Bacteria 830
384 Ga0495585_0202430 3300046492 Bacteria 1010
385 Ga0495616_0142931 3300046513 Bacteria 1088
386 Ga0495663_0022312 3300046525 Bacteria 1828
387 Ga0495663_0047236 3300046525 Bacteria 1325
388 Ga0495663_0176725 3300046525 Bacteria 738
389 Ga0495642_0009140 3300046528 Bacteria 3795
390 Ga0495642_0175105 3300046528 Bacteria 933
391 Ga0495633_0178798 3300046558 Bacteria 977
392 Ga0495668_0015863 3300046616 Bacteria 4388
393 Ga0495625_0214423 3300046660 Bacteria 1264
394 Ga0495659_0032301 3300046664 Bacteria 1832
395 Ga0495588_0357251 3300046674 Bacteria 768
396 Ga0495669_0000089 3300046684 Bacteria 60373
397 Ga0495669_0000774 3300046684 Bacteria 13678
398 Ga0495669_0167908 3300046684 Bacteria 1043
399 Ga0495669_0169665 3300046684 Bacteria 1037
400 Ga0495670_0136742 3300046691 Bacteria 1279
401 Ga0495670_0504283 3300046691 Bacteria 657
402 Ga0495672_0267167 3300047320 Bacteria 823
403 Ga0495677_0047483 3300047445 Bacteria 1576
404 Ga0495686_0047710 3300047472 Bacteria 2703
405 Ga0496100_0015385 3300048903 Bacteria 4467
406 Ga0496101_0024588 3300048904 Bacteria 4170
407 Ga0496101_0052174 3300048904 Bacteria 2948
408 Ga0496101_0542615 3300048904 Bacteria 919
409 Ga0496102_1103969 3300048905 Bacteria 713
410 Ga0496104_1268136 3300048907 Bacteria 640
411 Ga0496106_0022876 3300048909 Bacteria 4642
412 Ga0496106_0084708 3300048909 Bacteria 2439
413 Ga0496107_0007688 3300048910 Bacteria 7443
414 Ga0496108_0040369 3300048911 Bacteria 3890
415 Ga0496108_0291213 3300048911 Bacteria 1421
416 Ga0496108_0424172 3300048911 Bacteria 1162
417 Ga0496109_0025297 3300048912 Bacteria 5288
418 Ga0496109_0034767 3300048912 Bacteria 4541
419 Ga0496109_0072665 3300048912 Bacteria 3160
420 Ga0496109_0224318 3300048912 Bacteria 1768
421 Ga0496109_1062352 3300048912 Bacteria 747
422 Ga0496110_0009415 3300048913 Bacteria 7912
423 Ga0496110_0108761 3300048913 Bacteria 2489
424 Ga0496110_0444107 3300048913 Bacteria 1182
425 Ga0496110_1894574 3300048913 Bacteria 506
426 Ga0496111_0000420 3300048914 Bacteria 21379
427 Ga0496111_0007261 3300048914 Bacteria 7250
428 Ga0496111_0808977 3300048914 Bacteria 678
429 Ga0496112_0003824 3300048915 Bacteria 12577
430 Ga0496112_0035574 3300048915 Bacteria 4852
431 Ga0496112_0354392 3300048915 Bacteria 1410
432 Ga0496113_0003648 3300048916 Bacteria 9260
433 Ga0496113_0102886 3300048916 Bacteria 2215
434 Ga0496114_0000016 3300048917 Bacteria 274656
435 Ga0496114_0020148 3300048917 Bacteria 5411
436 Ga0496114_0678370 3300048917 Bacteria 905
437 Ga0496114_1033778 3300048917 Bacteria 705
438 Ga0496114_1067431 3300048917 Bacteria 692
439 Ga0496115_0063511 3300048918 Bacteria 2979
440 Ga0501067_0205346 3300049583 Bacteria 1097
441 Ga0501068_0460703 3300049584 Bacteria 823
442 Ga0501069_0430610 3300049585 Bacteria 783
443 Ga0501071_1045978 3300049587 Bacteria 631
444 Ga0501235_021726 3300049669 Bacteria 1427
445 Ga0501080_0011952 3300049742 Bacteria 7953
446 nmdc:mga08y16_132594_c1 3300050511 Bacteria 2590
447 Ga0495655_0001821 3300053083 Bacteria 3322
448 Ga0500618_010693 3300053125 Bacteria 2454
449 Ga0500559_0002914 3300053136 Bacteria 8606
450 Ga0500624_000236 3300053157 Bacteria 20013
451 Ga0500636_0008448 3300053177 Bacteria 5972
452 Ga0466962_0049638 3300061719 Bacteria 2006
453 Ga0466962_0159321 3300061719 Bacteria 1097
454 Ga0495670_0310073
455 JGI24737J22298_10005581
456 JGI24737J22298_10029013
457 Ga0070658_10010980
458 Ga0070658_10037316
459 Ga0070658_10650014
460 Ga0070658_10699940
461 Ga0070676_10590953
462 Ga0070683_100004192
463 Ga0070683_101668344
464 Ga0070670_100001207
465 Ga0070670_100035076
466 Ga0070670_100827490
467 Ga0068869_100306675
468 Ga0070666_10004685
469 Ga0070666_10157995
470 Ga0070666_10727192
471 Ga0070682_100025051
472 Ga0068868_100006329
473 Ga0068868_100380829
474 Ga0070660_100000091
475 Ga0070660_100008889
476 Ga0070660_100107195
477 Ga0070660_100181320
478 Ga0070660_100779033
479 Ga0070661_100019971
480 Ga0070661_100020645
481 Ga0070661_100284837
482 Ga0070668_100030234
483 Ga0070668_100909763
484 Ga0070669_100162810
485 Ga0070669_100813426
486 Ga0070669_101169783
487 Ga0070675_100105073
488 Ga0070675_100652477
489 Ga0070671_100000051
490 Ga0070671_100008986
491 Ga0070671_100086223
492 Ga0070671_100252280
493 Ga0070674_100343809
494 Ga0070673_100005552
495 Ga0070673_100061770
496 Ga0070673_100079505
497 Ga0070673_100083098
498 Ga0070659_100094657
499 Ga0070659_100121139
500 Ga0070659_100162614
501 Ga0070659_100371270
502 Ga0070659_101846799
503 Ga0070667_100129169
504 Ga0070667_100182331
505 Ga0070667_100199455
506 Ga0070667_100535144
507 Ga0070667_100776619
508 Ga0070709_10204612
509 Ga0070714_100345869
510 Ga0070713_100252079
511 Ga0070710_10523860
512 Ga0070694_100097451
513 Ga0070694_100284530
514 Ga0070663_100039702
515 Ga0070678_100001370
516 Ga0070678_100001634
517 Ga0070662_100001687
518 Ga0070662_100017289
519 Ga0070662_100067138
520 Ga0070662_100086588
521 Ga0070662_100159729
522 Ga0070662_100430549
523 Ga0070681_10062700
524 Ga0070681_10100600
525 Ga0070681_10428462
526 Ga0070679_100163458
527 Ga0070684_100026091
528 Ga0070697_100654912
529 Ga0068853_100494829
530 Ga0070672_100004562
531 Ga0070672_100065703
532 Ga0070672_100678969
533 Ga0070672_102017756
534 Ga0070695_100087712
535 Ga0070665_100004860
536 Ga0070665_100029457
537 Ga0070665_100109752
538 Ga0070665_101498949
539 Ga0068855_100000129
540 Ga0068855_100091005
541 Ga0068855_100849341
542 Ga0070664_100003755
543 Ga0070664_100396520
544 Ga0070664_100604548
545 Ga0070664_100642473
546 Ga0068857_100030612
547 Ga0068857_100098701
548 Ga0068854_100003822
549 Ga0068854_101246236
550 Ga0068856_100659819
551 Ga0068859_100563794
552 Ga0068859_100577812
553 Ga0068864_100008056
554 Ga0068864_100035162
555 Ga0068864_101648474
556 Ga0068866_10129099
557 Ga0068866_10265583
558 Ga0068851_10691926
559 Ga0068863_100009976
560 Ga0068863_100095885
561 Ga0068863_100239519
562 Ga0068858_100002934
563 Ga0068858_102213416
564 Ga0068860_100048248
565 Ga0068860_101095283
566 Ga0068862_100004852
567 Ga0068862_100218238
568 Ga0070712_100014354
569 Ga0070712_100179038
570 Ga0097621_100006802
571 Ga0097621_100024788
572 Ga0097621_100165964
573 Ga0068871_100026600
574 Ga0075428_102358895
575 Ga0075431_100532293
576 Ga0068865_100131360
577 Ga0097620_100563787
578 Ga0097620_100577832
579 Ga0105240_10299536
580 Ga0111539_10010849
581 Ga0105245_10025012
582 Ga0105247_10111114
583 Ga0114129_11698418
584 Ga0105241_10191322
585 Ga0105242_12708516
586 Ga0105248_10008535
587 Ga0105248_10010453
588 Ga0105248_10011986
589 Ga0105248_10037148
590 Ga0105248_10242124
591 Ga0105248_10285227
592 Ga0105238_11721690
593 Ga0105249_10037568
594 Ga0105249_11852546
595 Ga0105032_109231
596 Ga0105030_118217
597 Ga0105239_10309344
598 Ga0157327_1028255
599 Ga0157373_10419662
600 Ga0157373_11033437
601 Ga0157371_10003542
602 Ga0157371_10031719
603 Ga0157371_10047482
604 Ga0157371_10051752
605 Ga0157371_10223985
606 Ga0157371_10261703
607 Ga0157370_10061094
608 Ga0157370_10066706
609 Ga0157374_10011150
610 Ga0157374_11043477
611 Ga0157374_11358321
612 Ga0157378_10735693
613 Ga0163162_10006737
614 Ga0163162_10258811
615 Ga0163162_10262978
616 Ga0157372_10113320
617 Ga0157375_10003256
618 Ga0157375_10050373
619 Ga0157375_11154471
620 Ga0157375_13354399
621 Ga0157380_11329440
622 Ga0207682_10052406
623 Ga0207682_10212297
624 Ga0207688_10017938
625 Ga0207688_10029385
626 Ga0207688_10685688
627 Ga0207680_10002185
628 Ga0207680_10459435
629 Ga0207680_10957409
630 Ga0207647_10011192
631 Ga0207647_10013059
632 Ga0207699_10122231
633 Ga0207645_10613797
634 Ga0207643_11065695
635 Ga0207705_10000091
636 Ga0207705_10127658
637 Ga0207654_10728912
638 Ga0207707_10093215
639 Ga0207693_10009824
640 Ga0207693_10020646
641 Ga0207657_10000252
642 Ga0207657_10016875
643 Ga0207657_10023986
644 Ga0207657_10115120
645 Ga0207657_10148386
646 Ga0207657_10368292
647 Ga0207649_10073287
648 Ga0207649_10236500
649 Ga0207652_10181809
650 Ga0207652_10392674
651 Ga0207681_11122839
652 Ga0207650_10048060
653 Ga0207659_10528023
654 Ga0207659_11009467
655 Ga0207687_10079772
656 Ga0207687_10998272
657 Ga0207687_11129462
658 Ga0207700_10067520
659 Ga0207664_10173917
660 Ga0207664_10186671
661 Ga0207644_10001238
662 Ga0207644_10002715
663 Ga0207644_10004688
664 Ga0207644_10295223
665 Ga0207690_10061001
666 Ga0207690_10155868
667 Ga0207690_10175857
668 Ga0207690_10409982
669 Ga0207690_10458413
670 Ga0207690_10531064
671 Ga0207690_10719674
672 Ga0207690_10767073
673 Ga0207690_11293389
674 Ga0207706_10001743
675 Ga0207706_10015383
676 Ga0207706_10037497
677 Ga0207706_10916391
678 Ga0207709_10427642
679 Ga0207709_11027737
680 Ga0207669_11270725
681 Ga0207669_11287767
682 Ga0207665_10222911
683 Ga0207691_10008297
684 Ga0207691_10197995
685 Ga0207691_10975397
686 Ga0207691_11736978
687 Ga0207711_10001585
688 Ga0207711_10001689
689 Ga0207661_10062691
690 Ga0207679_10032405
691 Ga0207679_10072731
692 Ga0207679_10083585
693 Ga0207679_11125886
694 Ga0207667_10001226
695 Ga0207667_10005995
696 Ga0207667_10632212
697 Ga0207651_10008681
698 Ga0207651_10368652
699 Ga0207651_10810749
700 Ga0207712_10000819
701 Ga0207668_10021001
702 Ga0207668_11659686
703 Ga0207640_11571091
704 Ga0207658_10188744
705 Ga0207658_10414970
706 Ga0207658_10599525
707 Ga0207658_10838333
708 Ga0207658_10899547
709 Ga0207658_11258447
710 Ga0207703_10087044
711 Ga0207703_11118339
712 Ga0207639_10241217
713 Ga0207639_11306478
714 Ga0207678_10029713
715 Ga0207702_10008508
716 Ga0207702_10698919
717 Ga0207641_10008581
718 Ga0207641_10036006
719 Ga0207641_10269953
720 Ga0207641_10353038
721 Ga0207676_10000253
722 Ga0207676_10006711
723 Ga0207676_10290400
724 Ga0207676_11125656
725 Ga0207674_10005367
726 Ga0207674_10483105
727 Ga0207675_102482510
728 Ga0207683_10002461
729 Ga0207683_10007674
730 Ga0207698_10340400
731 Ga0207698_10887168
732 Ga0209974_10107873
733 Ga0268266_10002799
734 Ga0268266_10060489
735 Ga0268266_10231322
736 Ga0268266_11108031
737 Ga0268266_11242580
738 Ga0268265_10005103
739 Ga0268264_10003670
740 Ga0316182_1013913
741 Ga0307509_10969076
742 Ga0307408_100060949
743 Ga0307408_100073956
744 Ga0307405_10427225
745 Ga0307413_10012493
746 Ga0307413_10079238
747 Ga0307413_10439023
748 Ga0307413_10749197
749 Ga0307410_11114975
750 Ga0307406_10367012
751 Ga0307406_10454944
752 Ga0307407_10161515
753 Ga0307412_10050476
754 Ga0307412_11090527
755 Ga0307409_100029299
756 Ga0307409_100702650
757 Ga0307409_100832760
758 Ga0307409_101537306
759 Ga0307409_101963501
760 Ga0307416_100004661
761 Ga0307416_100068774
762 Ga0307416_100284944
763 Ga0307416_102083139
764 Ga0307414_10057479
765 Ga0307414_10536549
766 Ga0307414_11114750
767 Ga0307414_11995548
768 Ga0307411_10002297
769 Ga0307411_10834202
770 Ga0307411_11095815
771 Ga0307415_100183683
772 Ga0307415_100375590
773 Ga0373930_0082706
774 Ga0395899_0037227
775 Ga0395899_0062521
776 Ga0395899_0085577
777 Ga0395899_0155970
778 Ga0395899_0620590
779 Ga0395899_0748981
780 Ga0395899_0900639
781 Ga0395900_0014124
782 Ga0395900_0112900
783 Ga0395900_0194826
784 Ga0395900_0246338
785 Ga0395900_0321569
786 Ga0395900_0431228
787 Ga0395900_0468132
788 Ga0395900_0906827
789 Ga0395900_0934647
790 Ga0395900_1050037
791 Ga0395900_1330519
792 Ga0395898_0104395
793 Ga0395898_0129610
794 Ga0395898_0261582
795 Ga0395898_0418268
796 Ga0395905_0000226
797 Ga0395905_0033143
798 Ga0395905_0070725
799 Ga0395905_0189377
800 Ga0395905_0257554
801 Ga0395905_0301022
802 Ga0395905_0318994
803 Ga0395901_0158542
804 Ga0395901_0202485
805 Ga0395901_0327282
806 Ga0395901_0488075
807 Ga0395901_0798995
808 Ga0395901_1020836
809 Ga0395901_1090145
810 Ga0439466_0043093
811 Ga0439449_0143584
812 Ga0439462_0106438
813 Ga0450889_000164
814 Ga0466969_0038004
815 Ga0466966_0000072
816 Ga0466966_0449933
817 Ga0466961_0393591
818 Ga0466963_0006830
819 Ga0466964_0196174
820 Ga0466964_0693085
821 Ga0453684_0041563
822 Ga0466971_0047696
823 Ga0466957_0015521
824 Ga0466957_0065771
825 Ga0466957_0081198
826 Ga0466957_0762526
827 Ga0466959_0049106
828 Ga0451576_0008370
829 Ga0451576_0533205
830 Ga0466967_0008915
831 Ga0466967_0344139
832 Ga0466967_1575415
833 Ga0466967_1719489
834 Ga0495638_0098082
835 Ga0495580_0167890
836 Ga0495584_0291126
837 Ga0495585_0202430
838 Ga0495616_0142931
839 Ga0495663_0022312
840 Ga0495663_0047236
841 Ga0495663_0176725
842 Ga0495642_0009140
843 Ga0495642_0175105
844 Ga0495633_0178798
845 Ga0495668_0015863
846 Ga0495625_0214423
847 Ga0495659_0032301
848 Ga0495588_0357251
849 Ga0495669_0000089
850 Ga0495669_0000774
851 Ga0495669_0167908
852 Ga0495669_0169665
853 Ga0495670_0136742
854 Ga0495670_0504283
855 Ga0495672_0267167
856 Ga0495677_0047483
857 Ga0495686_0047710
858 Ga0496100_0015385
859 Ga0496101_0024588
860 Ga0496101_0052174
861 Ga0496101_0542615
862 Ga0496102_1103969
863 Ga0496104_1268136
864 Ga0496106_0022876
865 Ga0496106_0084708
866 Ga0496107_0007688
867 Ga0496108_0040369
868 Ga0496108_0291213
869 Ga0496108_0424172
870 Ga0496109_0025297
871 Ga0496109_0034767
872 Ga0496109_0072665
873 Ga0496109_0224318
874 Ga0496109_1062352
875 Ga0496110_0009415
876 Ga0496110_0108761
877 Ga0496110_0444107
878 Ga0496110_1894574
879 Ga0496111_0000420
880 Ga0496111_0007261
881 Ga0496111_0808977
882 Ga0496112_0003824
883 Ga0496112_0035574
884 Ga0496112_0354392
885 Ga0496113_0003648
886 Ga0496113_0102886
887 Ga0496114_0000016
888 Ga0496114_0020148
889 Ga0496114_0678370
890 Ga0496114_1033778
891 Ga0496114_1067431
892 Ga0496115_0063511
893 Ga0501067_0205346
894 Ga0501068_0460703
895 Ga0501069_0430610
896 Ga0501071_1045978
897 Ga0501235_021726
898 Ga0501080_0011952
899 nmdc:mga08y16_132594_c1
900 Ga0495655_0001821
901 Ga0500618_010693
902 Ga0500559_0002914
903 Ga0500624_000236
904 Ga0500636_0008448
905 Ga0466962_0049638
906 Ga0466962_0159321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

109

0.94

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

96

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.8484 1 118
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8455 1 120
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8388 1 120
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8333 1 119
4mts-assembly1.cif.gz_B ni- and zn-bound gloa2 at high resolution 0.8306 1 119
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8592 1 56 3.10.180.10
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8581 1 118 3.10.180.10
af_Q09751_155_302_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8341 1 119 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8333 1 119 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8271 1 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.994 80 137 GO:0016829
AF-A0A3B8WFH9-F1-model_v4 Lactoylglutathione lyase 0.9912 83 137 GO:0016829
AF-A0A3D2GKL9-F1-model_v4 Lactoylglutathione lyase 0.9803 68 137 GO:0016829
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.9772 80 137 GO:0016829
AF-A0A3C7W1R9-F1-model_v4 Lactoylglutathione lyase 0.9684 86 137 GO:0016829

Map