F447187

General Info

Members Datasets Scaffolds Average Seq Length
453 269 906 327

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10179845|Ga0163163_101798453
Length 381
Sequence LLPKEIHPIADRHILHSIFAFSRLASQPLLYGLSKAFIVTHSKSQGLLPMEYVSFGSTGLKVSRLALGTMGFGSKTWRKWALDEEESRPIIRRALELGIRFFDTADMYSLGRSEEILGQALKDFGGSRESVVIATKAWSPMSADPNDRGLSRKHLLSAIDKSLKRLGTDYVDLFQMHRWDPTTPVEETLLAMHEIVKAGKALYIGASTMAAWQFAKLVYTADRLGVTRPVSMQPYYNLLYREEEHEMIPLCRAEGIAVIPYSPIARGFVTGERRKGDFGDTVRAKTDDYMKKLYYTDPDFAIVEKITEVARARGIPNVQVALAWVLQQPGITSPIIGVTKIEQLGPLVGALDIELDDSELSMLSAAYRPHEVVSDMPRPKS

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 1.55
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10179845 3300014325 Bacteria 2162
2 JGI24737J22298_10042106 3300001990 Bacteria 1400
3 rootH2_10002383 3300003320 Bacteria 53226
4 JGI25160J50197_1001198 3300003354 Bacteria 13174
5 Ga0065707_10218399 3300005295 Bacteria 1235
6 Ga0070676_10105242 3300005328 Bacteria 1749
7 Ga0070690_100036452 3300005330 Bacteria 3090
8 Ga0070670_100006186 3300005331 Bacteria 10119
9 Ga0070670_100006518 3300005331 Bacteria 9884
10 Ga0070670_100200526 3300005331 Bacteria 1734
11 Ga0070670_100228300 3300005331 Bacteria 1620
12 Ga0068869_100103548 3300005334 Bacteria 2157
13 Ga0068869_100129778 3300005334 Bacteria 1936
14 Ga0070666_10015617 3300005335 Unclassified 4845
15 Ga0070666_10054650 3300005335 Bacteria 2694
16 Ga0070680_100418082 3300005336 Bacteria 1144
17 Ga0070682_100178558 3300005337 Bacteria 1481
18 Ga0068868_100007215 3300005338 Bacteria 7899
19 Ga0068868_100067762 3300005338 Bacteria 2841
20 Ga0070660_100347673 3300005339 Bacteria 1221
21 Ga0070689_100037946 3300005340 Bacteria 3685
22 Ga0070687_100011780 3300005343 Bacteria 3838
23 Ga0070687_100094275 3300005343 Bacteria 1662
24 Ga0070669_100020900 3300005353 Bacteria 4676
25 Ga0070675_100000703 3300005354 Bacteria 23209
26 Ga0070675_100001042 3300005354 Bacteria 19948
27 Ga0070675_100039175 3300005354 Bacteria 3866
28 Ga0070675_100099155 3300005354 Bacteria 2452
29 Ga0070675_100240699 3300005354 Bacteria 1581
30 Ga0070671_100002088 3300005355 Bacteria 15388
31 Ga0070671_100005001 3300005355 Bacteria 10564
32 Ga0070671_100017371 3300005355 Bacteria 5827
33 Ga0070671_100054249 3300005355 Bacteria 3332
34 Ga0070671_100069205 3300005355 Bacteria 2944
35 Ga0070674_100082255 3300005356 Bacteria 2303
36 Ga0070673_100002713 3300005364 Bacteria 10854
37 Ga0070673_100005527 3300005364 Bacteria 8100
38 Ga0070673_100011382 3300005364 Bacteria 6070
39 Ga0070673_100288258 3300005364 Bacteria 1442
40 Ga0070688_100011919 3300005365 Bacteria 4854
41 Ga0070688_100027845 3300005365 Bacteria 3368
42 Ga0070688_100038860 3300005365 Bacteria 2909
43 Ga0070659_100184488 3300005366 Bacteria 1713
44 Ga0070667_100005729 3300005367 Bacteria 10380
45 Ga0070667_100033879 3300005367 Unclassified 4272
46 Ga0070667_100110140 3300005367 Bacteria 2387
47 Ga0070713_100325383 3300005436 Bacteria 1421
48 Ga0070701_10042665 3300005438 Bacteria 2317
49 Ga0070694_100291315 3300005444 Bacteria 1248
50 Ga0070663_100168484 3300005455 Bacteria 1691
51 Ga0070678_100002125 3300005456 Bacteria 10738
52 Ga0068867_100006316 3300005459 Bacteria 8384
53 Ga0068867_100104546 3300005459 Bacteria 2167
54 Ga0068867_100196526 3300005459 Bacteria 1612
55 Ga0068867_100300321 3300005459 Bacteria 1323
56 Ga0070685_10016309 3300005466 Bacteria 3957
57 Ga0070685_10057791 3300005466 Bacteria 2258
58 Ga0070685_10063211 3300005466 Bacteria 2173
59 Ga0070706_100001825 3300005467 Bacteria 22059
60 Ga0070706_100160956 3300005467 Bacteria 2096
61 Ga0070707_100160022 3300005468 Bacteria 2194
62 Ga0070707_100180454 3300005468 Bacteria 2058
63 Ga0070707_100197792 3300005468 Bacteria 1960
64 Ga0070698_100065491 3300005471 Bacteria 3659
65 Ga0070698_100104618 3300005471 Bacteria 2800
66 Ga0070698_100130563 3300005471 Bacteria 2468
67 Ga0070684_100206558 3300005535 Bacteria 1790
68 Ga0070697_100158097 3300005536 Bacteria 1914
69 Ga0068853_100175449 3300005539 Bacteria 1941
70 Ga0070672_100003806 3300005543 Bacteria 9824
71 Ga0070672_100030288 3300005543 Unclassified 4064
72 Ga0070686_100021193 3300005544 Bacteria 3859
73 Ga0070686_100037913 3300005544 Bacteria 2993
74 Ga0070686_100069892 3300005544 Bacteria 2295
75 Ga0070695_100004534 3300005545 Bacteria 8156
76 Ga0070696_100033810 3300005546 Bacteria 3515
77 Ga0070696_100221262 3300005546 Bacteria 1421
78 Ga0070696_100272711 3300005546 Bacteria 1287
79 Ga0070693_100047848 3300005547 Bacteria 2434
80 Ga0070704_100046324 3300005549 Bacteria 3032
81 Ga0070704_100077240 3300005549 Bacteria 2439
82 Ga0070664_100001528 3300005564 Bacteria 18477
83 Ga0070664_100008090 3300005564 Bacteria 8498
84 Ga0070664_100077975 3300005564 Bacteria 2849
85 Ga0068857_100061222 3300005577 Bacteria 3344
86 Ga0068854_100011163 3300005578 Bacteria 5835
87 Ga0068854_100052968 3300005578 Bacteria 2912
88 Ga0068854_100153778 3300005578 Bacteria 1776
89 Ga0068852_100395758 3300005616 Bacteria 1358
90 Ga0068859_100003986 3300005617 Bacteria 15055
91 Ga0068859_100008439 3300005617 Bacteria 10433
92 Ga0068859_100125810 3300005617 Unclassified 2632
93 Ga0068864_100001748 3300005618 Bacteria 17856
94 Ga0068864_100122472 3300005618 Unclassified 2327
95 Ga0068863_100001984 3300005841 Bacteria 20337
96 Ga0068863_100022202 3300005841 Bacteria 6060
97 Ga0068858_100000622 3300005842 Bacteria 36875
98 Ga0068858_100088735 3300005842 Unclassified 2877
99 Ga0068860_100033251 3300005843 Bacteria 4949
100 Ga0068862_100057152 3300005844 Bacteria 3344
101 Ga0081538_10007745 3300005981 Bacteria 9239
102 Ga0081538_10023395 3300005981 Bacteria 4443
103 Ga0075363_100056394 3300006048 Bacteria 2106
104 Ga0075364_10055248 3300006051 Bacteria 2598
105 Ga0075362_10024698 3300006177 Bacteria 2551
106 Ga0075367_10004522 3300006178 Bacteria 6800
107 Ga0075367_10065478 3300006178 Bacteria 2176
108 Ga0075369_10055518 3300006186 Bacteria 1721
109 Ga0075369_10066326 3300006186 Bacteria 1583
110 Ga0075366_10012235 3300006195 Bacteria 4865
111 Ga0075366_10032090 3300006195 Bacteria 3092
112 Ga0097621_100000508 3300006237 Bacteria 27247
113 Ga0097621_100055030 3300006237 Unclassified 3248
114 Ga0097621_100080912 3300006237 Unclassified 2703
115 Ga0097621_100377556 3300006237 Bacteria 1265
116 Ga0075370_10018102 3300006353 Bacteria 3817
117 Ga0068871_100000891 3300006358 Bacteria 19913
118 Ga0068871_100014803 3300006358 Bacteria 5823
119 Ga0068871_100370173 3300006358 Unclassified 1271
120 Ga0075428_100003948 3300006844 Bacteria 16271
121 Ga0075428_100030983 3300006844 Bacteria 5914
122 Ga0075430_100024712 3300006846 Bacteria 5110
123 Ga0075431_100124284 3300006847 Bacteria 2662
124 Ga0075431_100453314 3300006847 Bacteria 1278
125 Ga0075429_100147110 3300006880 Bacteria 2062
126 Ga0068865_100017063 3300006881 Bacteria 4661
127 Ga0068865_100059477 3300006881 Bacteria 2673
128 Ga0068865_100297299 3300006881 Bacteria 1291
129 Ga0097620_100003986 3300006931 Bacteria 15055
130 Ga0097620_100008439 3300006931 Bacteria 10433
131 Ga0097620_100125814 3300006931 Unclassified 2632
132 Ga0099794_10009174 3300007265 Bacteria 4142
133 Ga0105240_10000009 3300009093 Bacteria 591332
134 Ga0105240_10086857 3300009093 Bacteria 3831
135 Ga0105240_10181914 3300009093 Bacteria 2480
136 Ga0105240_10313134 3300009093 Bacteria 1792
137 Ga0105240_10525313 3300009093 Bacteria 1313
138 Ga0111539_10023317 3300009094 Bacteria 7604
139 Ga0111539_10030011 3300009094 Bacteria 6615
140 Ga0111539_10158071 3300009094 Bacteria 2652
141 Ga0111539_10469187 3300009094 Bacteria 1466
142 Ga0105245_10003987 3300009098 Bacteria 13127
143 Ga0105243_10080524 3300009148 Bacteria 2657
144 Ga0105243_10130639 3300009148 Bacteria 2130
145 Ga0105242_10012240 3300009176 Bacteria 6603
146 Ga0105242_10044982 3300009176 Bacteria 3576
147 Ga0105242_10060032 3300009176 Bacteria 3122
148 Ga0105242_10153564 3300009176 Bacteria 2009
149 Ga0105248_10003621 3300009177 Bacteria 17140
150 Ga0105248_10023425 3300009177 Bacteria 6859
151 Ga0105248_10191963 3300009177 Bacteria 2301
152 Ga0105248_10386077 3300009177 Bacteria 1577
153 Ga0105237_10032180 3300009545 Bacteria 5311
154 Ga0105238_10022913 3300009551 Bacteria 6366
155 Ga0105249_10050899 3300009553 Bacteria 3777
156 Ga0105249_10343288 3300009553 Bacteria 1510
157 Ga0105249_10581307 3300009553 Bacteria 1173
158 Ga0105239_10077658 3300010375 Bacteria 3654
159 Ga0105239_10158885 3300010375 Bacteria 2525
160 Ga0157371_10041151 3300013102 Bacteria 3299
161 Ga0157374_10030871 3300013296 Bacteria 4867
162 Ga0157374_10039738 3300013296 Bacteria 4330
163 Ga0157374_10150504 3300013296 Bacteria 2262
164 Ga0157374_10276007 3300013296 Bacteria 1658
165 Ga0157378_10053463 3300013297 Bacteria 3595
166 Ga0157378_10232727 3300013297 Bacteria 1757
167 Ga0157378_10255311 3300013297 Bacteria 1680
168 Ga0163162_10004945 3300013306 Bacteria 12845
169 Ga0163162_10316933 3300013306 Bacteria 1692
170 Ga0163162_10355159 3300013306 Bacteria 1598
171 Ga0163162_10616500 3300013306 Bacteria 1210
172 Ga0157372_10014953 3300013307 Bacteria 8308
173 Ga0157375_10000556 3300013308 Bacteria 33512
174 Ga0157375_10003042 3300013308 Bacteria 14563
175 Ga0157375_10329239 3300013308 Bacteria 1692
176 Ga0163163_10002554 3300014325 Bacteria 15423
177 Ga0163163_10008411 3300014325 Bacteria 9168
178 Ga0163163_10018747 3300014325 Bacteria 6486
179 Ga0163163_10030399 3300014325 Bacteria 5205
180 Ga0157380_10055029 3300014326 Bacteria 3158
181 Ga0157380_10132014 3300014326 Bacteria 2132
182 Ga0157377_10232289 3300014745 Bacteria 1187
183 Ga0157379_10000180 3300014968 Bacteria 47884
184 Ga0157379_10128588 3300014968 Bacteria 2280
185 Ga0157376_10053526 3300014969 Unclassified 3361
186 Ga0163161_10028738 3300017792 Bacteria 3950
187 Ga0163161_10362638 3300017792 Bacteria 1154
188 Ga0213872_10001348 3300021361 Bacteria 16206
189 Ga0213876_10034741 3300021384 Bacteria 2659
190 Ga0224572_1017425 3300024225 Bacteria 1379
191 Ga0207697_10032159 3300025315 Bacteria 2147
192 Ga0207682_10016095 3300025893 Bacteria 2915
193 Ga0207680_10036625 3300025903 Bacteria 2827
194 Ga0207645_10002792 3300025907 Bacteria 13590
195 Ga0207645_10111734 3300025907 Bacteria 1769
196 Ga0207643_10213256 3300025908 Bacteria 1179
197 Ga0207695_10000315 3300025913 Bacteria 116387
198 Ga0207695_10002524 3300025913 Bacteria 26889
199 Ga0207695_10064497 3300025913 Bacteria 3771
200 Ga0207695_10115862 3300025913 Bacteria 2654
201 Ga0207695_10252163 3300025913 Bacteria 1664
202 Ga0207660_10258075 3300025917 Bacteria 1377
203 Ga0207662_10053953 3300025918 Bacteria 2395
204 Ga0207652_10292490 3300025921 Bacteria 1470
205 Ga0207646_10162310 3300025922 Bacteria 2017
206 Ga0207646_10170921 3300025922 Bacteria 1963
207 Ga0207681_10016592 3300025923 Bacteria 4609
208 Ga0207681_10020693 3300025923 Bacteria 4173
209 Ga0207681_10314230 3300025923 Bacteria 1244
210 Ga0207694_10036146 3300025924 Bacteria 3790
211 Ga0207650_10000878 3300025925 Bacteria 22741
212 Ga0207650_10011255 3300025925 Bacteria 6154
213 Ga0207659_10000207 3300025926 Bacteria 35338
214 Ga0207659_10000645 3300025926 Bacteria 20733
215 Ga0207659_10000818 3300025926 Bacteria 18436
216 Ga0207659_10006230 3300025926 Bacteria 7296
217 Ga0207659_10254936 3300025926 Bacteria 1425
218 Ga0207687_10058830 3300025927 Bacteria 2705
219 Ga0207700_10152894 3300025928 Bacteria 1909
220 Ga0207644_10001228 3300025931 Bacteria 16510
221 Ga0207644_10015069 3300025931 Bacteria 5186
222 Ga0207644_10019093 3300025931 Bacteria 4647
223 Ga0207644_10050256 3300025931 Bacteria 2988
224 Ga0207690_10123407 3300025932 Bacteria 1885
225 Ga0207706_10331918 3300025933 Bacteria 1323
226 Ga0207686_10006707 3300025934 Bacteria 6203
227 Ga0207686_10259222 3300025934 Bacteria 1274
228 Ga0207669_10065354 3300025937 Bacteria 2256
229 Ga0207669_10286883 3300025937 Bacteria 1244
230 Ga0207669_10287352 3300025937 Bacteria 1243
231 Ga0207704_10037991 3300025938 Bacteria 2787
232 Ga0207691_10001187 3300025940 Bacteria 25907
233 Ga0207691_10006286 3300025940 Bacteria 11467
234 Ga0207691_10007831 3300025940 Bacteria 10292
235 Ga0207711_10019607 3300025941 Bacteria 5630
236 Ga0207679_10054048 3300025945 Unclassified 2955
237 Ga0207679_10096022 3300025945 Bacteria 2305
238 Ga0207679_10279733 3300025945 Bacteria 1431
239 Ga0207667_10202428 3300025949 Bacteria 2036
240 Ga0207651_10000798 3300025960 Bacteria 13560
241 Ga0207651_10010915 3300025960 Bacteria 5057
242 Ga0207651_10054264 3300025960 Unclassified 2745
243 Ga0207668_10059862 3300025972 Bacteria 2671
244 Ga0207658_10325635 3300025986 Bacteria 1331
245 Ga0207677_10003494 3300026023 Bacteria 8327
246 Ga0207677_10015442 3300026023 Bacteria 4492
247 Ga0207703_10012973 3300026035 Bacteria 6494
248 Ga0207703_10025729 3300026035 Unclassified 4630
249 Ga0207678_10254735 3300026067 Bacteria 1504
250 Ga0207708_10229602 3300026075 Bacteria 1490
251 Ga0207641_10000841 3300026088 Bacteria 32663
252 Ga0207641_10023130 3300026088 Bacteria 5120
253 Ga0207641_10230240 3300026088 Bacteria 1722
254 Ga0207641_10407838 3300026088 Bacteria 1306
255 Ga0207648_10005766 3300026089 Bacteria 12405
256 Ga0207648_10007879 3300026089 Bacteria 10392
257 Ga0207648_10035124 3300026089 Bacteria 4418
258 Ga0207648_10244258 3300026089 Bacteria 1599
259 Ga0207676_10021623 3300026095 Unclassified 4721
260 Ga0207674_10171320 3300026116 Unclassified 2124
261 Ga0207674_10250375 3300026116 Bacteria 1719
262 Ga0207675_100055935 3300026118 Bacteria 3681
263 Ga0207683_10010494 3300026121 Bacteria 7903
264 Ga0207698_10069165 3300026142 Bacteria 2791
265 Ga0207428_10006278 3300027907 Bacteria 10989
266 Ga0207428_10073294 3300027907 Bacteria 2687
267 Ga0268266_10093923 3300028379 Bacteria 2632
268 Ga0268264_10012401 3300028381 Bacteria 7015
269 Ga0307515_10098791 3300028794 Bacteria 3551
270 Ga0307515_10166577 3300028794 Bacteria 2218
271 Ga0265325_10033423 3300031241 Bacteria 2742
272 Ga0307513_10157204 3300031456 Bacteria 2171
273 Ga0307408_100016883 3300031548 Bacteria 4880
274 Ga0307408_100025292 3300031548 Bacteria 4066
275 Ga0265313_10012521 3300031595 Bacteria 5169
276 Ga0307508_10001494 3300031616 Bacteria 26240
277 Ga0307508_10040544 3300031616 Bacteria 4181
278 Ga0265314_10002244 3300031711 Bacteria 20023
279 Ga0265342_10207537 3300031712 Bacteria 1061
280 Ga0316576_10052075 3300031727 Bacteria 2981
281 Ga0307516_10014503 3300031730 Bacteria 8332
282 Ga0307516_10107846 3300031730 Bacteria 2593
283 Ga0307516_10202321 3300031730 Bacteria 1705
284 Ga0307405_10006965 3300031731 Bacteria 5614
285 Ga0307405_10227453 3300031731 Bacteria 1373
286 Ga0307413_10012807 3300031824 Bacteria 4188
287 Ga0307410_10061283 3300031852 Bacteria 2574
288 Ga0307406_10003882 3300031901 Bacteria 8142
289 Ga0307409_100004771 3300031995 Bacteria 7684
290 Ga0307416_100013163 3300032002 Bacteria 5613
291 Ga0307414_10183546 3300032004 Bacteria 1685
292 Ga0307411_10014448 3300032005 Bacteria 4393
293 Ga0373943_0032904 3300035170 Bacteria 2467
294 Ga0373931_0080892 3300035691 Bacteria 1793
295 Ga0373933_0186293 3300035724 Bacteria 1325
296 Ga0316584_0034328 3300036712 Bacteria 3761
297 Ga0395905_0349368 3300037471 Bacteria 1371
298 Ga0436364_0781617 3300037853 Bacteria 7762
299 Ga0436364_1109641 3300037853 Bacteria 2356
300 Ga0400483_216991 3300039062 Bacteria 3145
301 Ga0436365_0228623 3300039437 Bacteria 4299
302 Ga0436365_0897697 3300039437 Bacteria 4695
303 Ga0436361_0716290 3300039447 Bacteria 39995
304 Ga0439433_0017551 3300041999 Bacteria 1590
305 Ga0439445_0042039 3300042004 Bacteria 1217
306 Ga0439446_0011002 3300042156 Bacteria 2447
307 Ga0439435_0006324 3300042436 Bacteria 2656
308 Ga0451577_0008452 3300042876 Bacteria 10018
309 Ga0453684_0501426 3300044712 Bacteria 1344
310 Ga0451576_0057042 3300045051 Bacteria 4083
311 Ga0495617_058658 3300046452 Bacteria 1275
312 Ga0495592_0009272 3300046454 Bacteria 7403
313 Ga0495603_0004479 3300046455 Bacteria 8338
314 Ga0495603_0029259 3300046455 Bacteria 3321
315 Ga0495603_0080484 3300046455 Bacteria 1909
316 Ga0495590_0008053 3300046457 Bacteria 4041
317 Ga0495629_0047314 3300046459 Bacteria 3017
318 Ga0495629_0173303 3300046459 Bacteria 1496
319 Ga0495638_0079960 3300046460 Bacteria 1987
320 Ga0495638_0110823 3300046460 Bacteria 1631
321 Ga0495582_0169194 3300046473 Bacteria 1244
322 Ga0495605_0037883 3300046474 Bacteria 2422
323 Ga0495639_0074592 3300046475 Bacteria 1572
324 Ga0495585_0030032 3300046492 Bacteria 3092
325 Ga0495594_0011804 3300046499 Bacteria 4543
326 Ga0495607_0081120 3300046501 Bacteria 1782
327 Ga0495606_0081034 3300046507 Bacteria 2018
328 Ga0495608_0156484 3300046511 Bacteria 1450
329 Ga0495610_0015946 3300046512 Bacteria 4345
330 Ga0495616_0048265 3300046513 Bacteria 2140
331 Ga0495620_0029839 3300046515 Bacteria 2518
332 Ga0495628_0188640 3300046516 Bacteria 1557
333 Ga0495630_0098981 3300046517 Bacteria 2206
334 Ga0495630_0359708 3300046517 Bacteria 1114
335 Ga0495631_0018769 3300046518 Bacteria 3252
336 Ga0495666_0011310 3300046526 Bacteria 4450
337 Ga0495666_0016770 3300046526 Bacteria 3647
338 Ga0495652_0394278 3300046529 Bacteria 982
339 Ga0495597_0009555 3300046542 Bacteria 4783
340 Ga0495597_0039295 3300046542 Bacteria 2119
341 Ga0495622_0015614 3300046557 Bacteria 3529
342 Ga0495622_0054201 3300046557 Bacteria 1860
343 Ga0495667_0000663 3300046559 Bacteria 21978
344 Ga0495668_0031583 3300046616 Bacteria 2984
345 Ga0495668_0059289 3300046616 Bacteria 2112
346 Ga0495634_0319951 3300046642 Bacteria 934
347 Ga0495611_0004685 3300046648 Bacteria 5874
348 Ga0495625_0059157 3300046660 Bacteria 2720
349 Ga0495635_0164705 3300046663 Bacteria 1509
350 Ga0495657_0007895 3300046675 Bacteria 8165
351 Ga0495599_0076320 3300046678 Bacteria 2092
352 Ga0495623_0074551 3300046679 Bacteria 2108
353 Ga0495658_0054524 3300046683 Bacteria 2275
354 Ga0495613_0015027 3300046689 Bacteria 5747
355 Ga0495649_0000541 3300046694 Bacteria 32077
356 Ga0495649_0061686 3300046694 Bacteria 2016
357 Ga0495589_0063632 3300046794 Bacteria 1809
358 Ga0495660_0005435 3300046810 Bacteria 7629
359 Ga0495604_0006845 3300047317 Bacteria 9032
360 Ga0495674_0028266 3300047319 Bacteria 5117
361 Ga0495676_0025495 3300047321 Bacteria 5104
362 Ga0495683_0021499 3300047323 Bacteria 3324
363 Ga0495683_0058105 3300047323 Bacteria 1921
364 Ga0495687_000174 3300047443 Bacteria 95031
365 Ga0495687_055390 3300047443 Bacteria 1658
366 Ga0495687_058818 3300047443 Bacteria 1593
367 Ga0495675_0257174 3300047444 Bacteria 1047
368 Ga0495685_015986 3300047447 Bacteria 2563
369 Ga0495673_0025477 3300047469 Bacteria 2839
370 Ga0495602_0029732 3300048088 Bacteria 5194
371 Ga0496102_0011492 3300048905 Bacteria 7635
372 Ga0496104_0089136 3300048907 Bacteria 2947
373 Ga0496104_0236646 3300048907 Bacteria 1738
374 Ga0496106_0017081 3300048909 Bacteria 5371
375 Ga0496112_0013757 3300048915 Bacteria 7483
376 Ga0496112_0251361 3300048915 Bacteria 1719
377 Ga0496113_0050610 3300048916 Bacteria 3098
378 Ga0496121_0004975 3300048924 Bacteria 17414
379 Ga0501031_0000072 3300049568 Bacteria 53648
380 Ga0501032_0000110 3300049569 Bacteria 70189
381 Ga0501032_0015754 3300049569 Bacteria 5331
382 Ga0501033_0002581 3300049570 Bacteria 15267
383 Ga0501034_0000181 3300049571 Bacteria 117767
384 Ga0501034_0005957 3300049571 Bacteria 13197
385 Ga0501034_0084036 3300049571 Bacteria 3185
386 Ga0501034_0084062 3300049571 Bacteria 3185
387 Ga0501034_0153166 3300049571 Bacteria 2281
388 Ga0501034_0252916 3300049571 Bacteria 1706
389 Ga0501034_0300222 3300049571 Bacteria 1543
390 Ga0501036_0002039 3300049572 Bacteria 15744
391 Ga0501037_0000059 3300049573 Bacteria 101459
392 Ga0501037_0035557 3300049573 Bacteria 3673
393 Ga0501038_0000143 3300049574 Bacteria 61292
394 Ga0501039_0000069 3300049575 Bacteria 78211
395 Ga0501042_0003557 3300049578 Bacteria 9809
396 Ga0501042_0035422 3300049578 Bacteria 3541
397 Ga0501043_0001060 3300049579 Bacteria 24164
398 Ga0501043_0066243 3300049579 Bacteria 2836
399 Ga0501046_0001007 3300049580 Bacteria 27552
400 Ga0501047_0000149 3300049581 Bacteria 85138
401 Ga0501047_0034650 3300049581 Bacteria 4875
402 Ga0501047_0190544 3300049581 Bacteria 1914
403 Ga0501048_0000328 3300049582 Bacteria 32753
404 Ga0501067_0000496 3300049583 Bacteria 21586
405 Ga0501068_0000624 3300049584 Bacteria 18056
406 Ga0501069_0017793 3300049585 Bacteria 3831
407 Ga0501070_0012041 3300049586 Bacteria 7299
408 Ga0501070_0026504 3300049586 Bacteria 4861
409 Ga0501072_0005823 3300049588 Bacteria 9388
410 Ga0501072_0529902 3300049588 Bacteria 931
411 Ga0501073_0005332 3300049589 Bacteria 9641
412 Ga0501074_0000281 3300049590 Bacteria 29337
413 Ga0501079_0006075 3300049741 Bacteria 9049
414 Ga0501079_0232866 3300049741 Bacteria 1439
415 Ga0501080_0000277 3300049742 Bacteria 38616
416 Ga0501080_0060462 3300049742 Bacteria 3527
417 Ga0501083_0000244 3300049744 Bacteria 34784
418 Ga0501083_0036731 3300049744 Bacteria 3340
419 Ga0501035_0000383 3300049822 Bacteria 50837
420 Ga0501035_0006055 3300049822 Bacteria 11391
421 Ga0501044_0000443 3300049823 Bacteria 50672
422 Ga0501044_0002731 3300049823 Bacteria 20077
423 Ga0501044_0005588 3300049823 Bacteria 13958
424 Ga0501044_0099749 3300049823 Bacteria 2922
425 Ga0501044_0422029 3300049823 Bacteria 1244
426 Ga0501045_0007601 3300049824 Bacteria 7534
427 nmdc:mga03683_95067_c1 3300050489 Bacteria 1304
428 nmdc:mga0yw44_155928_c1 3300050492 Bacteria 1492
429 nmdc:mga0yw44_87570_c1 3300050492 Bacteria 1963
430 nmdc:mga0k408_27664_c1 3300050493 Bacteria 3222
431 nmdc:mga0k408_5135_c2 3300050493 Bacteria 3162
432 nmdc:mga0k408_909_c1 3300050493 Bacteria 16163
433 nmdc:mga06z11_71956_c1 3300050494 Bacteria 1832
434 nmdc:mga07m45_27508_c1 3300050496 Bacteria 3134
435 nmdc:mga07m45_309_c1 3300050496 Bacteria 19711
436 nmdc:mga05p37_65764_c1 3300050507 Bacteria 4461
437 nmdc:mga05p37_91506_c1 3300050507 Bacteria 3748
438 nmdc:mga09592_53750_c1 3300050508 Bacteria 3401
439 nmdc:mga0qj67_292841_c1 3300050509 Bacteria 1319
440 nmdc:mga06r32_439762_c1 3300050510 Bacteria 1284
441 nmdc:mga08y16_328901_c1 3300050511 Bacteria 1573
442 nmdc:mga08y16_36991_c1 3300050511 Bacteria 5127
443 nmdc:mga08y16_58305_c1 3300050511 Bacteria 4034
444 nmdc:mga0n895_167761_c1 3300050512 Bacteria 2227
445 nmdc:mga0sz30_74877_c1 3300050516 Bacteria 1461
446 Ga0495601_0269482 3300053077 Bacteria 1111
447 Ga0500658_0010057 3300053134 Bacteria 3491
448 Ga0500568_0074284 3300053139 Bacteria 1297
449 Ga0500645_032187 3300053730 Bacteria 1573
450 Ga0501084_0000558 3300054114 Bacteria 28461
451 Ga0501084_0358632 3300054114 Bacteria 1232
452 Ga0501082_0005906 3300060353 Bacteria 10616
453 2996314991 2996310559 Bacteria 6357320
454 Ga0163163_10179845
455 JGI24737J22298_10042106
456 rootH2_10002383
457 JGI25160J50197_1001198
458 Ga0065707_10218399
459 Ga0070676_10105242
460 Ga0070690_100036452
461 Ga0070670_100006186
462 Ga0070670_100006518
463 Ga0070670_100200526
464 Ga0070670_100228300
465 Ga0068869_100103548
466 Ga0068869_100129778
467 Ga0070666_10015617
468 Ga0070666_10054650
469 Ga0070680_100418082
470 Ga0070682_100178558
471 Ga0068868_100007215
472 Ga0068868_100067762
473 Ga0070660_100347673
474 Ga0070689_100037946
475 Ga0070687_100011780
476 Ga0070687_100094275
477 Ga0070669_100020900
478 Ga0070675_100000703
479 Ga0070675_100001042
480 Ga0070675_100039175
481 Ga0070675_100099155
482 Ga0070675_100240699
483 Ga0070671_100002088
484 Ga0070671_100005001
485 Ga0070671_100017371
486 Ga0070671_100054249
487 Ga0070671_100069205
488 Ga0070674_100082255
489 Ga0070673_100002713
490 Ga0070673_100005527
491 Ga0070673_100011382
492 Ga0070673_100288258
493 Ga0070688_100011919
494 Ga0070688_100027845
495 Ga0070688_100038860
496 Ga0070659_100184488
497 Ga0070667_100005729
498 Ga0070667_100033879
499 Ga0070667_100110140
500 Ga0070713_100325383
501 Ga0070701_10042665
502 Ga0070694_100291315
503 Ga0070663_100168484
504 Ga0070678_100002125
505 Ga0068867_100006316
506 Ga0068867_100104546
507 Ga0068867_100196526
508 Ga0068867_100300321
509 Ga0070685_10016309
510 Ga0070685_10057791
511 Ga0070685_10063211
512 Ga0070706_100001825
513 Ga0070706_100160956
514 Ga0070707_100160022
515 Ga0070707_100180454
516 Ga0070707_100197792
517 Ga0070698_100065491
518 Ga0070698_100104618
519 Ga0070698_100130563
520 Ga0070684_100206558
521 Ga0070697_100158097
522 Ga0068853_100175449
523 Ga0070672_100003806
524 Ga0070672_100030288
525 Ga0070686_100021193
526 Ga0070686_100037913
527 Ga0070686_100069892
528 Ga0070695_100004534
529 Ga0070696_100033810
530 Ga0070696_100221262
531 Ga0070696_100272711
532 Ga0070693_100047848
533 Ga0070704_100046324
534 Ga0070704_100077240
535 Ga0070664_100001528
536 Ga0070664_100008090
537 Ga0070664_100077975
538 Ga0068857_100061222
539 Ga0068854_100011163
540 Ga0068854_100052968
541 Ga0068854_100153778
542 Ga0068852_100395758
543 Ga0068859_100003986
544 Ga0068859_100008439
545 Ga0068859_100125810
546 Ga0068864_100001748
547 Ga0068864_100122472
548 Ga0068863_100001984
549 Ga0068863_100022202
550 Ga0068858_100000622
551 Ga0068858_100088735
552 Ga0068860_100033251
553 Ga0068862_100057152
554 Ga0081538_10007745
555 Ga0081538_10023395
556 Ga0075363_100056394
557 Ga0075364_10055248
558 Ga0075362_10024698
559 Ga0075367_10004522
560 Ga0075367_10065478
561 Ga0075369_10055518
562 Ga0075369_10066326
563 Ga0075366_10012235
564 Ga0075366_10032090
565 Ga0097621_100000508
566 Ga0097621_100055030
567 Ga0097621_100080912
568 Ga0097621_100377556
569 Ga0075370_10018102
570 Ga0068871_100000891
571 Ga0068871_100014803
572 Ga0068871_100370173
573 Ga0075428_100003948
574 Ga0075428_100030983
575 Ga0075430_100024712
576 Ga0075431_100124284
577 Ga0075431_100453314
578 Ga0075429_100147110
579 Ga0068865_100017063
580 Ga0068865_100059477
581 Ga0068865_100297299
582 Ga0097620_100003986
583 Ga0097620_100008439
584 Ga0097620_100125814
585 Ga0099794_10009174
586 Ga0105240_10000009
587 Ga0105240_10086857
588 Ga0105240_10181914
589 Ga0105240_10313134
590 Ga0105240_10525313
591 Ga0111539_10023317
592 Ga0111539_10030011
593 Ga0111539_10158071
594 Ga0111539_10469187
595 Ga0105245_10003987
596 Ga0105243_10080524
597 Ga0105243_10130639
598 Ga0105242_10012240
599 Ga0105242_10044982
600 Ga0105242_10060032
601 Ga0105242_10153564
602 Ga0105248_10003621
603 Ga0105248_10023425
604 Ga0105248_10191963
605 Ga0105248_10386077
606 Ga0105237_10032180
607 Ga0105238_10022913
608 Ga0105249_10050899
609 Ga0105249_10343288
610 Ga0105249_10581307
611 Ga0105239_10077658
612 Ga0105239_10158885
613 Ga0157371_10041151
614 Ga0157374_10030871
615 Ga0157374_10039738
616 Ga0157374_10150504
617 Ga0157374_10276007
618 Ga0157378_10053463
619 Ga0157378_10232727
620 Ga0157378_10255311
621 Ga0163162_10004945
622 Ga0163162_10316933
623 Ga0163162_10355159
624 Ga0163162_10616500
625 Ga0157372_10014953
626 Ga0157375_10000556
627 Ga0157375_10003042
628 Ga0157375_10329239
629 Ga0163163_10002554
630 Ga0163163_10008411
631 Ga0163163_10018747
632 Ga0163163_10030399
633 Ga0157380_10055029
634 Ga0157380_10132014
635 Ga0157377_10232289
636 Ga0157379_10000180
637 Ga0157379_10128588
638 Ga0157376_10053526
639 Ga0163161_10028738
640 Ga0163161_10362638
641 Ga0213872_10001348
642 Ga0213876_10034741
643 Ga0224572_1017425
644 Ga0207697_10032159
645 Ga0207682_10016095
646 Ga0207680_10036625
647 Ga0207645_10002792
648 Ga0207645_10111734
649 Ga0207643_10213256
650 Ga0207695_10000315
651 Ga0207695_10002524
652 Ga0207695_10064497
653 Ga0207695_10115862
654 Ga0207695_10252163
655 Ga0207660_10258075
656 Ga0207662_10053953
657 Ga0207652_10292490
658 Ga0207646_10162310
659 Ga0207646_10170921
660 Ga0207681_10016592
661 Ga0207681_10020693
662 Ga0207681_10314230
663 Ga0207694_10036146
664 Ga0207650_10000878
665 Ga0207650_10011255
666 Ga0207659_10000207
667 Ga0207659_10000645
668 Ga0207659_10000818
669 Ga0207659_10006230
670 Ga0207659_10254936
671 Ga0207687_10058830
672 Ga0207700_10152894
673 Ga0207644_10001228
674 Ga0207644_10015069
675 Ga0207644_10019093
676 Ga0207644_10050256
677 Ga0207690_10123407
678 Ga0207706_10331918
679 Ga0207686_10006707
680 Ga0207686_10259222
681 Ga0207669_10065354
682 Ga0207669_10286883
683 Ga0207669_10287352
684 Ga0207704_10037991
685 Ga0207691_10001187
686 Ga0207691_10006286
687 Ga0207691_10007831
688 Ga0207711_10019607
689 Ga0207679_10054048
690 Ga0207679_10096022
691 Ga0207679_10279733
692 Ga0207667_10202428
693 Ga0207651_10000798
694 Ga0207651_10010915
695 Ga0207651_10054264
696 Ga0207668_10059862
697 Ga0207658_10325635
698 Ga0207677_10003494
699 Ga0207677_10015442
700 Ga0207703_10012973
701 Ga0207703_10025729
702 Ga0207678_10254735
703 Ga0207708_10229602
704 Ga0207641_10000841
705 Ga0207641_10023130
706 Ga0207641_10230240
707 Ga0207641_10407838
708 Ga0207648_10005766
709 Ga0207648_10007879
710 Ga0207648_10035124
711 Ga0207648_10244258
712 Ga0207676_10021623
713 Ga0207674_10171320
714 Ga0207674_10250375
715 Ga0207675_100055935
716 Ga0207683_10010494
717 Ga0207698_10069165
718 Ga0207428_10006278
719 Ga0207428_10073294
720 Ga0268266_10093923
721 Ga0268264_10012401
722 Ga0307515_10098791
723 Ga0307515_10166577
724 Ga0265325_10033423
725 Ga0307513_10157204
726 Ga0307408_100016883
727 Ga0307408_100025292
728 Ga0265313_10012521
729 Ga0307508_10001494
730 Ga0307508_10040544
731 Ga0265314_10002244
732 Ga0265342_10207537
733 Ga0316576_10052075
734 Ga0307516_10014503
735 Ga0307516_10107846
736 Ga0307516_10202321
737 Ga0307405_10006965
738 Ga0307405_10227453
739 Ga0307413_10012807
740 Ga0307410_10061283
741 Ga0307406_10003882
742 Ga0307409_100004771
743 Ga0307416_100013163
744 Ga0307414_10183546
745 Ga0307411_10014448
746 Ga0373943_0032904
747 Ga0373931_0080892
748 Ga0373933_0186293
749 Ga0316584_0034328
750 Ga0395905_0349368
751 Ga0436364_0781617
752 Ga0436364_1109641
753 Ga0400483_216991
754 Ga0436365_0228623
755 Ga0436365_0897697
756 Ga0436361_0716290
757 Ga0439433_0017551
758 Ga0439445_0042039
759 Ga0439446_0011002
760 Ga0439435_0006324
761 Ga0451577_0008452
762 Ga0453684_0501426
763 Ga0451576_0057042
764 Ga0495617_058658
765 Ga0495592_0009272
766 Ga0495603_0004479
767 Ga0495603_0029259
768 Ga0495603_0080484
769 Ga0495590_0008053
770 Ga0495629_0047314
771 Ga0495629_0173303
772 Ga0495638_0079960
773 Ga0495638_0110823
774 Ga0495582_0169194
775 Ga0495605_0037883
776 Ga0495639_0074592
777 Ga0495585_0030032
778 Ga0495594_0011804
779 Ga0495607_0081120
780 Ga0495606_0081034
781 Ga0495608_0156484
782 Ga0495610_0015946
783 Ga0495616_0048265
784 Ga0495620_0029839
785 Ga0495628_0188640
786 Ga0495630_0098981
787 Ga0495630_0359708
788 Ga0495631_0018769
789 Ga0495666_0011310
790 Ga0495666_0016770
791 Ga0495652_0394278
792 Ga0495597_0009555
793 Ga0495597_0039295
794 Ga0495622_0015614
795 Ga0495622_0054201
796 Ga0495667_0000663
797 Ga0495668_0031583
798 Ga0495668_0059289
799 Ga0495634_0319951
800 Ga0495611_0004685
801 Ga0495625_0059157
802 Ga0495635_0164705
803 Ga0495657_0007895
804 Ga0495599_0076320
805 Ga0495623_0074551
806 Ga0495658_0054524
807 Ga0495613_0015027
808 Ga0495649_0000541
809 Ga0495649_0061686
810 Ga0495589_0063632
811 Ga0495660_0005435
812 Ga0495604_0006845
813 Ga0495674_0028266
814 Ga0495676_0025495
815 Ga0495683_0021499
816 Ga0495683_0058105
817 Ga0495687_000174
818 Ga0495687_055390
819 Ga0495687_058818
820 Ga0495675_0257174
821 Ga0495685_015986
822 Ga0495673_0025477
823 Ga0495602_0029732
824 Ga0496102_0011492
825 Ga0496104_0089136
826 Ga0496104_0236646
827 Ga0496106_0017081
828 Ga0496112_0013757
829 Ga0496112_0251361
830 Ga0496113_0050610
831 Ga0496121_0004975
832 Ga0501031_0000072
833 Ga0501032_0000110
834 Ga0501032_0015754
835 Ga0501033_0002581
836 Ga0501034_0000181
837 Ga0501034_0005957
838 Ga0501034_0084036
839 Ga0501034_0084062
840 Ga0501034_0153166
841 Ga0501034_0252916
842 Ga0501034_0300222
843 Ga0501036_0002039
844 Ga0501037_0000059
845 Ga0501037_0035557
846 Ga0501038_0000143
847 Ga0501039_0000069
848 Ga0501042_0003557
849 Ga0501042_0035422
850 Ga0501043_0001060
851 Ga0501043_0066243
852 Ga0501046_0001007
853 Ga0501047_0000149
854 Ga0501047_0034650
855 Ga0501047_0190544
856 Ga0501048_0000328
857 Ga0501067_0000496
858 Ga0501068_0000624
859 Ga0501069_0017793
860 Ga0501070_0012041
861 Ga0501070_0026504
862 Ga0501072_0005823
863 Ga0501072_0529902
864 Ga0501073_0005332
865 Ga0501074_0000281
866 Ga0501079_0006075
867 Ga0501079_0232866
868 Ga0501080_0000277
869 Ga0501080_0060462
870 Ga0501083_0000244
871 Ga0501083_0036731
872 Ga0501035_0000383
873 Ga0501035_0006055
874 Ga0501044_0000443
875 Ga0501044_0002731
876 Ga0501044_0005588
877 Ga0501044_0099749
878 Ga0501044_0422029
879 Ga0501045_0007601
880 nmdc:mga03683_95067_c1
881 nmdc:mga0yw44_155928_c1
882 nmdc:mga0yw44_87570_c1
883 nmdc:mga0k408_27664_c1
884 nmdc:mga0k408_5135_c2
885 nmdc:mga0k408_909_c1
886 nmdc:mga06z11_71956_c1
887 nmdc:mga07m45_27508_c1
888 nmdc:mga07m45_309_c1
889 nmdc:mga05p37_65764_c1
890 nmdc:mga05p37_91506_c1
891 nmdc:mga09592_53750_c1
892 nmdc:mga0qj67_292841_c1
893 nmdc:mga06r32_439762_c1
894 nmdc:mga08y16_328901_c1
895 nmdc:mga08y16_36991_c1
896 nmdc:mga08y16_58305_c1
897 nmdc:mga0n895_167761_c1
898 nmdc:mga0sz30_74877_c1
899 Ga0495601_0269482
900 Ga0500658_0010057
901 Ga0500568_0074284
902 Ga0500645_032187
903 Ga0501084_0000558
904 Ga0501084_0358632
905 Ga0501082_0005906
906 2996314991

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

64

368

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9537 1 319
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9507 1 319
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9484 1 322
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9446 1 322
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.938 1 316
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9872 1 324 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9841 1 324 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9521 1 319 3.20.20.100
af_G2TRN6_1_317_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9454 23 318 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9295 1 319 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9985 1 212 GO:0005829
GO:0016491
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9974 113 213 GO:0005829
GO:0016491
AF-A0A817MNW5-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9956 1 156 GO:0005829
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9937 1 212 GO:0005829
GO:0016491
AF-A0A257RV75-F1-model_v4 Alcohol dehydrogenase 0.9932 1 132 GO:0005829

Map