F447102

General Info

Members Datasets Scaffolds Average Seq Length
452 288 393 424

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8020953355|8020953446
Length 458
Sequence VLGAGVIGVTTAWHLREAGCDVTVIEREADVAQATSLGNAGVIAPGYVTPWAAPGMPGKILKYLFKPASPLIFRPTLDAAQWRWIARWLRECEFERFRVNKQRMQRIAYYSRACLRAFRDRHPFDYGASRGYLQLLRGAFDVEMVQPALKVLRDAGIAFRELDAAGCTAIEPGLRWARQAPVGGIYLPDDEAGDCARFTRELRSLCEANGVTFRFRTEIRALDVAGGKVRGVRVSATGTDGRSPRDEGTGIDTPDIDLRGAGQPGRPAAGRAASSATKPRDVLLEADAVVVALGVDSAGLLRPHGIDVPLYPVKGYSATLTVVDDEKAPHAALMDESLKTAITRFGPTLRVAGTAELGNRHAALRQQALDTLMKVLDDWFPHAAERASARFWVGRRPMTPDGPPLLGASHIDGLWLNVGHGSTGWAMSMGSGKVLADLVTGREPEIDLSGLTLARYER

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
13 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
14 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
15 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
19 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
20 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
21 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
22 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
23 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
24 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
25 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
26 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
27 2818991452 Burkholderia cepacia 561 Isolate Unclassified
28 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
29 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
30 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
31 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
32 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
33 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
34 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
35 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
36 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
37 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
38 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
39 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
40 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
41 2904564687 Burkholderia sp. 571 Isolate Unclassified
42 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
43 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
44 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
45 2928170801 Burkholderia sp. 572 Isolate Unclassified
46 2928536128 Burkholderia sola 565 Isolate Unclassified
47 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
48 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
51 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
52 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
59 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
60 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
61 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
69 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
70 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
71 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
72 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
101 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
162 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
163 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
279 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
280 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
281 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
282 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
283 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
284 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
285 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
286 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
287 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
288 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.95
Metatranscriptomes 0
Isolates 13.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.82
Nodule 2.88
Rhizoplane 3.1
Rhizosphere 64.82
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001324 3300001979 Bacteria 11257
2 JGI24737J22298_10020367 3300001990 Bacteria 2117
3 JGI24735J21928_10000155 3300002067 Bacteria 24058
4 JGI24735J21928_10001750 3300002067 Bacteria 7658
5 JGI25156J39149_1000418 3300002705 Bacteria 26417
6 JGI25156J39149_1001488 3300002705 Bacteria 9800
7 JGI25156J39149_1005143 3300002705 Bacteria 3843
8 JGI25151J46595_10001148 3300003187 Bacteria 19196
9 JGI25151J46595_10001220 3300003187 Bacteria 18383
10 JGI25165J46597_1002446 3300003214 Bacteria 5979
11 rootH2_10079005 3300003320 Bacteria 7297
12 rootH2_10129063 3300003320 Bacteria 2923
13 rootL2_10146905 3300003322 Bacteria 2994
14 rootH1_10196331 3300003323 Bacteria 2752
15 JGI25160J50197_1001789 3300003354 Bacteria 10401
16 Ga0055533_1000529 3300003756 Bacteria 13667
17 Ga0055533_1003739 3300003756 Bacteria 2952
18 Ga0055532_1000092 3300003758 Bacteria 103243
19 Ga0055532_1001701 3300003758 Bacteria 5663
20 Ga0055532_1001763 3300003758 Bacteria 5444
21 Ga0055527_1000035 3300003760 Bacteria 138481
22 Ga0055535_1000050 3300003761 Bacteria 138481
23 Ga0055535_1001431 3300003761 Bacteria 12173
24 Ga0055542_1000120 3300003762 Bacteria 103243
25 Ga0055542_1001129 3300003762 Bacteria 15863
26 Ga0055529_1000089 3300003763 Bacteria 138481
27 Ga0055529_1000948 3300003763 Bacteria 15232
28 Ga0055526_1002549 3300003771 Bacteria 12236
29 Ga0055526_1002553 3300003771 Bacteria 12225
30 Ga0055524_1000401 3300003775 Bacteria 37009
31 Ga0055536_1000365 3300003781 Bacteria 33614
32 Ga0055534_1001121 3300003784 Bacteria 11364
33 Ga0055528_1011117 3300003790 Bacteria 3603
34 Ga0055531_10001824 3300003794 Bacteria 15095
35 Ga0058692_1000904 3300003856 Bacteria 11693
36 Ga0065165_1003668 3300005262 Bacteria 10478
37 Ga0070682_100051202 3300005337 Bacteria 2580
38 Ga0070660_100010032 3300005339 Bacteria 6681
39 Ga0070659_100006676 3300005366 Bacteria 8339
40 Ga0070663_100000524 3300005455 Bacteria 20208
41 Ga0070662_100044313 3300005457 Bacteria 3186
42 Ga0068867_100000175 3300005459 Bacteria 41852
43 Ga0070665_100028557 3300005548 Bacteria 5618
44 Ga0068855_100010176 3300005563 Bacteria 11335
45 Ga0068855_100088646 3300005563 Bacteria 3574
46 Ga0068855_100134814 3300005563 Bacteria 2818
47 Ga0068856_100158849 3300005614 Bacteria 2271
48 Ga0068852_100007222 3300005616 Bacteria 8100
49 Ga0075365_10071070 3300006038 Bacteria 2342
50 Ga0075366_10030306 3300006195 Bacteria 3180
51 Ga0075370_10001010 3300006353 Bacteria 11647
52 Ga0099826_10000004 3300006948 Bacteria 802669
53 Ga0105251_10049577 3300009011 Bacteria 2009
54 Ga0105240_10005791 3300009093 Bacteria 18327
55 Ga0105240_10021398 3300009093 Bacteria 8602
56 Ga0105240_10042020 3300009093 Bacteria 5828
57 Ga0105240_10166384 3300009093 Bacteria 2615
58 Ga0105245_10286709 3300009098 Bacteria 1611
59 Ga0105243_10000770 3300009148 Bacteria 30670
60 Ga0105241_10254407 3300009174 Bacteria 1490
61 Ga0105242_10343589 3300009176 Bacteria 1376
62 Ga0105237_10003275 3300009545 Bacteria 19332
63 Ga0105238_10000102 3300009551 Bacteria 94910
64 Ga0105239_10001547 3300010375 Bacteria 30388
65 Ga0105239_10181241 3300010375 Bacteria 2357
66 Ga0157369_10019485 3300013105 Bacteria 7592
67 Ga0157377_10000014 3300014745 Bacteria 213961
68 Ga0157379_10078911 3300014968 Bacteria 2949
69 Ga0182007_10012347 3300015262 Bacteria 3289
70 Ga0183361_10015 3300016635 Bacteria 166772
71 Ga0209566_100312 3300025225 Bacteria 43942
72 Ga0209674_100153 3300025226 Bacteria 94333
73 Ga0209674_100272 3300025226 Bacteria 39275
74 Ga0209674_102953 3300025226 Bacteria 3337
75 Ga0209672_100054 3300025228 Bacteria 222217
76 Ga0209672_100073 3300025228 Bacteria 166621
77 Ga0209147_100085 3300025229 Bacteria 185813
78 Ga0209147_100093 3300025229 Bacteria 167196
79 Ga0209147_100832 3300025229 Bacteria 14549
80 Ga0209563_101295 3300025230 Bacteria 6834
81 Ga0207427_101047 3300025231 Bacteria 11492
82 Ga0209258_100140 3300025242 Bacteria 167245
83 Ga0209258_100168 3300025242 Bacteria 145329
84 Ga0209148_1000119 3300025254 Bacteria 188079
85 Ga0209148_1000140 3300025254 Bacteria 166819
86 Ga0209759_1000281 3300025256 Bacteria 71594
87 Ga0209759_1000329 3300025256 Bacteria 62253
88 Ga0209759_1000362 3300025256 Bacteria 58080
89 Ga0209759_1013248 3300025256 Bacteria 2242
90 Ga0209233_1000173 3300025261 Bacteria 145995
91 Ga0209565_1000066 3300025263 Bacteria 173062
92 Ga0209455_1000125 3300025272 Bacteria 166819
93 Ga0209455_1000244 3300025272 Bacteria 67136
94 Ga0209673_1000098 3300025273 Bacteria 193352
95 Ga0209673_1034546 3300025273 Bacteria 1526
96 Ga0209675_1000084 3300025291 Bacteria 152066
97 Ga0209675_1001045 3300025291 Bacteria 17234
98 Ga0209676_1000014 3300025292 Bacteria 793514
99 Ga0209025_1000365 3300025294 Bacteria 95783
100 Ga0209025_1000437 3300025294 Bacteria 82190
101 Ga0209025_1002968 3300025294 Bacteria 16847
102 Ga0209564_1000539 3300025295 Bacteria 61208
103 Ga0209564_1000901 3300025295 Bacteria 38935
104 Ga0209564_1002826 3300025295 Bacteria 12866
105 Ga0209564_1011630 3300025295 Bacteria 3922
106 Ga0209256_1000331 3300025299 Bacteria 79942
107 Ga0207426_1000199 3300025302 Bacteria 145826
108 Ga0209051_1000110 3300025303 Bacteria 153230
109 Ga0209051_1016489 3300025303 Bacteria 3339
110 Ga0209257_1000012 3300025304 Bacteria 1111138
111 Ga0209257_1000045 3300025304 Bacteria 484429
112 Ga0207647_10055119 3300025904 Bacteria 2444
113 Ga0207647_10077683 3300025904 Bacteria 1995
114 Ga0207695_10003429 3300025913 Bacteria 22375
115 Ga0207695_10005064 3300025913 Bacteria 17675
116 Ga0207695_10169741 3300025913 Bacteria 2108
117 Ga0207671_10001495 3300025914 Bacteria 26983
118 Ga0207693_10027472 3300025915 Bacteria 4498
119 Ga0207657_10017935 3300025919 Bacteria 6773
120 Ga0207694_10000176 3300025924 Bacteria 66165
121 Ga0207690_10002863 3300025932 Bacteria 10392
122 Ga0207706_10014854 3300025933 Bacteria 7050
123 Ga0207709_10013137 3300025935 Bacteria 4567
124 Ga0207689_10092952 3300025942 Bacteria 2478
125 Ga0207667_10017312 3300025949 Bacteria 8116
126 Ga0207678_10001691 3300026067 Bacteria 20214
127 Ga0207648_10000142 3300026089 Bacteria 71593
128 Ga0207698_10024832 3300026142 Bacteria 4212
129 Ga0209371_1000575 3300027312 Bacteria 33050
130 Ga0209371_1001567 3300027312 Bacteria 15036
131 Ga0209282_1000035 3300027666 Bacteria 137066
132 Ga0209974_10000306 3300027876 Bacteria 15939
133 Ga0268266_10012109 3300028379 Bacteria 7465
134 Ga0307515_10000022 3300028794 Bacteria 404064
135 Ga0307515_10000191 3300028794 Bacteria 149201
136 Ga0307515_10025661 3300028794 Bacteria 10184
137 Ga0307515_10058388 3300028794 Bacteria 5557
138 Ga0268256_1000875 3300030500 Bacteria 20997
139 Ga0268256_1001343 3300030500 Bacteria 15036
140 Ga0307513_10026755 3300031456 Bacteria 6638
141 Ga0307509_10057726 3300031507 Bacteria 4114
142 Ga0307408_100003563 3300031548 Bacteria 10608
143 Ga0307508_10000017 3300031616 Bacteria 203567
144 Ga0307516_10036093 3300031730 Bacteria 4951
145 Ga0307405_10036191 3300031731 Bacteria 2955
146 Ga0307412_10000056 3300031911 Bacteria 145861
147 Ga0307409_100200170 3300031995 Bacteria 1786
148 Ga0307416_100009684 3300032002 Bacteria 6326
149 Ga0307414_10035859 3300032004 Bacteria 3305
150 Ga0395899_0001564 3300037312 Bacteria 19269
151 Ga0395899_0003106 3300037312 Bacteria 13222
152 Ga0395899_0012064 3300037312 Bacteria 6620
153 Ga0395899_0012534 3300037312 Bacteria 6498
154 Ga0395900_0008097 3300037418 Bacteria 10820
155 Ga0395900_0011209 3300037418 Bacteria 9167
156 Ga0395900_0013558 3300037418 Bacteria 8326
157 Ga0395900_0052641 3300037418 Bacteria 4190
158 Ga0395900_0064536 3300037418 Bacteria 3762
159 Ga0395900_0154753 3300037418 Bacteria 2342
160 Ga0395900_0276116 3300037418 Bacteria 1674
161 Ga0395898_0031295 3300037466 Bacteria 5318
162 Ga0395905_0002605 3300037471 Bacteria 19856
163 Ga0395905_0009528 3300037471 Bacteria 9487
164 Ga0395905_0023360 3300037471 Bacteria 5844
165 Ga0395905_0033634 3300037471 Bacteria 4814
166 Ga0395905_0081051 3300037471 Bacteria 3041
167 Ga0395905_0087621 3300037471 Bacteria 2918
168 Ga0395901_0002522 3300038443 Bacteria 18545
169 Ga0395901_0003709 3300038443 Bacteria 15400
170 Ga0436361_0037196 3300039447 Bacteria 2587
171 Ga0439436_0015587 3300041404 Bacteria 2285
172 Ga0439436_0026500 3300041404 Bacteria 1699
173 Ga0439449_0002251 3300042007 Bacteria 7586
174 Ga0439462_0003530 3300042015 Bacteria 3756
175 Ga0450911_001137 3300042115 Bacteria 6577
176 Ga0450912_000284 3300042116 Bacteria 2285
177 Ga0450898_000983 3300042134 Bacteria 3595
178 Ga0450898_001580 3300042134 Bacteria 3039
179 Ga0439446_0004830 3300042156 Bacteria 3436
180 Ga0439434_0008896 3300042435 Bacteria 2951
181 Ga0439435_0035206 3300042436 Bacteria 1380
182 Ga0439464_0008229 3300042439 Bacteria 2733
183 Ga0450893_0004321 3300042532 Bacteria 2264
184 Ga0451577_0113064 3300042876 Bacteria 2430
185 Ga0466972_0000285 3300044658 Bacteria 31510
186 Ga0466972_0000508 3300044658 Bacteria 19348
187 Ga0453683_0001993 3300044673 Bacteria 16524
188 Ga0466965_0000473 3300044683 Bacteria 14207
189 Ga0466964_0001829 3300044706 Bacteria 7406
190 Ga0466968_0001709 3300044735 Bacteria 7910
191 Ga0466970_0061413 3300044765 Bacteria 2013
192 Ga0466959_0005993 3300045049 Bacteria 8388
193 Ga0451576_0082807 3300045051 Bacteria 3337
194 Ga0466967_0094770 3300045976 Bacteria 2719
195 Ga0495592_0121385 3300046454 Bacteria 1838
196 Ga0495603_0000734 3300046455 Bacteria 18663
197 Ga0495603_0003264 3300046455 Bacteria 9656
198 Ga0495603_0124045 3300046455 Bacteria 1505
199 Ga0495590_0001899 3300046457 Bacteria 8843
200 Ga0495590_0004680 3300046457 Bacteria 5488
201 Ga0495590_0023900 3300046457 Bacteria 2155
202 Ga0495591_001305 3300046458 Bacteria 15753
203 Ga0495629_0000162 3300046459 Bacteria 58860
204 Ga0495629_0001379 3300046459 Bacteria 19148
205 Ga0495629_0030147 3300046459 Bacteria 3846
206 Ga0495638_0014949 3300046460 Bacteria 5227
207 Ga0495641_0010319 3300046461 Bacteria 5422
208 Ga0495651_0049019 3300046462 Bacteria 3261
209 Ga0495651_0065939 3300046462 Bacteria 2764
210 Ga0495651_0069576 3300046462 Bacteria 2680
211 Ga0495653_0001542 3300046463 Bacteria 17981
212 Ga0495653_0001687 3300046463 Bacteria 17383
213 Ga0495653_0046313 3300046463 Bacteria 3368
214 Ga0495650_0044361 3300046471 Bacteria 1880
215 Ga0495580_0001709 3300046472 Bacteria 19286
216 Ga0495580_0002400 3300046472 Bacteria 16370
217 Ga0495580_0014280 3300046472 Bacteria 6025
218 Ga0495580_0016881 3300046472 Bacteria 5472
219 Ga0495580_0046826 3300046472 Bacteria 3067
220 Ga0495580_0066304 3300046472 Bacteria 2527
221 Ga0495582_0002198 3300046473 Bacteria 10919
222 Ga0495582_0011445 3300046473 Bacteria 4887
223 Ga0495582_0012580 3300046473 Bacteria 4665
224 Ga0495605_0003171 3300046474 Bacteria 9884
225 Ga0495605_0010333 3300046474 Bacteria 5226
226 Ga0495605_0010922 3300046474 Bacteria 5073
227 Ga0495605_0033489 3300046474 Bacteria 2607
228 Ga0495662_0010139 3300046476 Bacteria 4619
229 Ga0495664_0001070 3300046477 Bacteria 14161
230 Ga0495664_0064029 3300046477 Bacteria 2191
231 Ga0495664_0080578 3300046477 Bacteria 1951
232 Ga0495596_0001163 3300046500 Bacteria 15424
233 Ga0495596_0001951 3300046500 Bacteria 11391
234 Ga0495596_0006023 3300046500 Bacteria 5657
235 Ga0495607_0025059 3300046501 Bacteria 3714
236 Ga0495583_0049756 3300046506 Bacteria 1917
237 Ga0495606_0014872 3300046507 Bacteria 6042
238 Ga0495608_0003857 3300046511 Bacteria 10774
239 Ga0495608_0026341 3300046511 Bacteria 3965
240 Ga0495610_0003726 3300046512 Bacteria 11667
241 Ga0495610_0004088 3300046512 Bacteria 10938
242 Ga0495616_0002965 3300046513 Bacteria 11024
243 Ga0495618_0002471 3300046514 Bacteria 11863
244 Ga0495618_0004161 3300046514 Bacteria 8931
245 Ga0495618_0091420 3300046514 Bacteria 1945
246 Ga0495628_0003612 3300046516 Bacteria 13836
247 Ga0495628_0039403 3300046516 Bacteria 3779
248 Ga0495628_0062856 3300046516 Bacteria 2909
249 Ga0495628_0071348 3300046516 Bacteria 2707
250 Ga0495630_0033931 3300046517 Bacteria 3807
251 Ga0495630_0058295 3300046517 Bacteria 2894
252 Ga0495630_0132741 3300046517 Bacteria 1891
253 Ga0495630_0223823 3300046517 Bacteria 1436
254 Ga0495632_0007474 3300046519 Bacteria 6857
255 Ga0495643_0042666 3300046522 Bacteria 2471
256 Ga0495643_0105249 3300046522 Bacteria 1441
257 Ga0495648_0004162 3300046524 Bacteria 12440
258 Ga0495648_0055208 3300046524 Bacteria 2395
259 Ga0495666_0001360 3300046526 Bacteria 11853
260 Ga0495666_0022087 3300046526 Bacteria 3152
261 Ga0495652_0018699 3300046529 Bacteria 6176
262 Ga0495652_0025160 3300046529 Bacteria 5270
263 Ga0495652_0135087 3300046529 Bacteria 1947
264 Ga0495665_0003493 3300046531 Bacteria 8530
265 Ga0495665_0007415 3300046531 Bacteria 5930
266 Ga0495665_0030535 3300046531 Bacteria 2884
267 Ga0495640_0003238 3300046533 Bacteria 13099
268 Ga0495640_0008301 3300046533 Bacteria 8142
269 Ga0495640_0034329 3300046533 Bacteria 3598
270 Ga0495586_0002228 3300046535 Bacteria 10537
271 Ga0495587_0000463 3300046536 Bacteria 28424
272 Ga0495587_0049249 3300046536 Bacteria 2494
273 Ga0495587_0091958 3300046536 Bacteria 1752
274 Ga0495609_0002440 3300046538 Bacteria 11434
275 Ga0495597_0012347 3300046542 Bacteria 4122
276 Ga0495645_0025548 3300046543 Bacteria 4287
277 Ga0495622_0000349 3300046557 Bacteria 32902
278 Ga0495634_0062712 3300046642 Bacteria 2468
279 Ga0495611_0041593 3300046648 Bacteria 2050
280 Ga0495625_0005094 3300046660 Bacteria 12158
281 Ga0495635_0002193 3300046663 Bacteria 13283
282 Ga0495635_0004444 3300046663 Bacteria 9714
283 Ga0495661_0007612 3300046665 Bacteria 7547
284 Ga0495661_0017318 3300046665 Bacteria 4760
285 Ga0495657_0055655 3300046675 Bacteria 2638
286 Ga0495599_0002788 3300046678 Bacteria 10186
287 Ga0495599_0007738 3300046678 Bacteria 6522
288 Ga0495599_0009016 3300046678 Bacteria 6078
289 Ga0495599_0085588 3300046678 Bacteria 1969
290 Ga0495599_0108642 3300046678 Bacteria 1728
291 Ga0495623_0004772 3300046679 Bacteria 8905
292 Ga0495623_0035512 3300046679 Bacteria 3194
293 Ga0495646_0002044 3300046680 Bacteria 12233
294 Ga0495646_0002817 3300046680 Bacteria 10764
295 Ga0495646_0021344 3300046680 Bacteria 4092
296 Ga0495613_0001086 3300046689 Bacteria 20760
297 Ga0495613_0013650 3300046689 Bacteria 6027
298 Ga0495624_0002939 3300046690 Bacteria 12754
299 Ga0495624_0009490 3300046690 Bacteria 6739
300 Ga0495624_0018705 3300046690 Bacteria 4631
301 Ga0495624_0024364 3300046690 Bacteria 3982
302 Ga0495671_0003485 3300046692 Bacteria 9651
303 Ga0495649_0003524 3300046694 Bacteria 10529
304 Ga0495649_0007972 3300046694 Bacteria 6405
305 Ga0495649_0027318 3300046694 Bacteria 3167
306 Ga0495649_0113134 3300046694 Bacteria 1438
307 Ga0495589_0011814 3300046794 Bacteria 4532
308 Ga0495589_0051191 3300046794 Bacteria 2042
309 Ga0495600_0002282 3300046809 Bacteria 10932
310 Ga0495581_0001139 3300047315 Bacteria 14552
311 Ga0495581_0004859 3300047315 Bacteria 7777
312 Ga0495581_0051999 3300047315 Bacteria 2366
313 Ga0495604_0010632 3300047317 Bacteria 7298
314 Ga0495604_0028746 3300047317 Bacteria 4423
315 Ga0495604_0057275 3300047317 Bacteria 2996
316 Ga0495604_0088750 3300047317 Bacteria 2299
317 Ga0495674_0020747 3300047319 Bacteria 6083
318 Ga0495674_0025864 3300047319 Bacteria 5373
319 Ga0495674_0043644 3300047319 Bacteria 3990
320 Ga0495672_0031806 3300047320 Bacteria 3291
321 Ga0495672_0076739 3300047320 Bacteria 1875
322 Ga0495676_0014085 3300047321 Bacteria 7159
323 Ga0495676_0019564 3300047321 Bacteria 5954
324 Ga0495676_0063101 3300047321 Bacteria 2890
325 Ga0495680_0002154 3300047322 Bacteria 20419
326 Ga0495680_0033806 3300047322 Bacteria 4137
327 Ga0495683_0003086 3300047323 Bacteria 9769
328 Ga0495683_0010632 3300047323 Bacteria 4856
329 Ga0495683_0014922 3300047323 Bacteria 4046
330 Ga0495683_0059779 3300047323 Bacteria 1890
331 Ga0495687_013771 3300047443 Bacteria 4199
332 Ga0495687_036743 3300047443 Bacteria 2188
333 Ga0495687_069939 3300047443 Bacteria 1411
334 Ga0495675_0011029 3300047444 Bacteria 5665
335 Ga0495679_000617 3300047446 Bacteria 24016
336 Ga0495679_000750 3300047446 Bacteria 20735
337 Ga0495679_006448 3300047446 Bacteria 5045
338 Ga0495673_0029863 3300047469 Bacteria 2568
339 Ga0495673_0036738 3300047469 Bacteria 2243
340 Ga0495684_0035145 3300047471 Bacteria 3845
341 Ga0495593_0003694 3300047673 Bacteria 9139
342 Ga0495593_0032068 3300047673 Bacteria 2866
343 Ga0495602_0015150 3300048088 Bacteria 7791
344 Ga0495602_0019599 3300048088 Bacteria 6711
345 Ga0495602_0020786 3300048088 Bacteria 6477
346 Ga0495614_0005364 3300048089 Bacteria 5785
347 Ga0495626_0034692 3300048091 Bacteria 2412
348 Ga0495626_0039379 3300048091 Bacteria 2237
349 Ga0496101_0007655 3300048904 Bacteria 7012
350 Ga0496102_0013902 3300048905 Bacteria 6983
351 Ga0496102_0017849 3300048905 Bacteria 6222
352 Ga0496103_0001492 3300048906 Bacteria 15642
353 Ga0496103_0030670 3300048906 Bacteria 3273
354 Ga0496105_0141476 3300048908 Bacteria 1980
355 Ga0496106_0000162 3300048909 Bacteria 48305
356 Ga0496112_0200104 3300048915 Bacteria 1957
357 Ga0496113_0166456 3300048916 Bacteria 1744
358 Ga0496116_0082271 3300048919 Bacteria 1992
359 Ga0496117_0007541 3300048920 Bacteria 10603
360 Ga0496117_0096328 3300048920 Bacteria 1888
361 Ga0496118_0008687 3300048921 Bacteria 10440
362 Ga0496118_0017211 3300048921 Bacteria 6590
363 Ga0496119_0050867 3300048922 Bacteria 2550
364 Ga0496121_0006767 3300048924 Bacteria 14066
365 Ga0496121_0009882 3300048924 Bacteria 10873
366 Ga0496121_0018436 3300048924 Bacteria 7037
367 Ga0496121_0022736 3300048924 Bacteria 6067
368 Ga0496121_0047118 3300048924 Bacteria 3681
369 Ga0496121_0065386 3300048924 Bacteria 2959
370 Ga0496121_0087006 3300048924 Bacteria 2454
371 Ga0496122_0003093 3300048925 Bacteria 22367
372 Ga0496123_0002770 3300048926 Bacteria 20934
373 Ga0496124_0152719 3300048927 Bacteria 1809
374 Ga0496125_0012086 3300048928 Bacteria 8591
375 Ga0496125_0034876 3300048928 Bacteria 4426
376 Ga0496126_0004713 3300048929 Bacteria 16102
377 Ga0496126_0004910 3300048929 Bacteria 15611
378 Ga0495682_0051860 3300049460 Bacteria 1491
379 Ga0501043_0000141 3300049579 Bacteria 67326
380 Ga0501046_0000047 3300049580 Bacteria 140344
381 Ga0501047_0000058 3300049581 Bacteria 139202
382 Ga0501047_0070809 3300049581 Bacteria 3357
383 Ga0501047_0166089 3300049581 Bacteria 2078
384 Ga0501048_0000475 3300049582 Bacteria 28030
385 Ga0501263_001653 3300049760 Bacteria 2147
386 Ga0501035_0110313 3300049822 Bacteria 2411
387 Ga0501044_0017880 3300049823 Bacteria 7605
388 Ga0501044_0078280 3300049823 Bacteria 3351
389 Ga0501045_0074856 3300049824 Bacteria 2493
390 nmdc:mga07m45_5769_c1 3300050496 Bacteria 6199
391 Ga0500578_0018907 3300053086 Bacteria 4423
392 Ga0500658_0040856 3300053134 Bacteria 1859
393 Ga0466962_0107799 3300061719 Bacteria 1340

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0026500 Ga0439436_0026500_588_1685 344
2 3300044765 Ga0466970_0061413 Ga0466970_0061413_206_1273 354
3 3300045049 Ga0466959_0005993 Ga0466959_0005993_4052_5119 354
4 3300009176 Ga0105242_10343589 Ga0105242_103435892 360
5 3300046511 Ga0495608_0026341 Ga0495608_0026341_2867_3955 362
6 3300046517 Ga0495630_0132741 Ga0495630_0132741_34_1122 362
7 3300046522 Ga0495643_0105249 Ga0495643_0105249_287_1402 362
8 3300048927 Ga0496124_0152719 Ga0496124_0152719_704_1792 362
9 3300041404 Ga0439436_0015587 Ga0439436_0015587_387_1640 369
10 3300031730 Ga0307516_10036093 Ga0307516_100360933 383
11 3300048915 Ga0496112_0200104 Ga0496112_0200104_690_1895 391
12 3300003320 rootH2_10129063 rootH2_101290632 392
13 3300003758 Ga0055532_1001763 Ga0055532_10017633 392
14 3300003761 Ga0055535_1001431 Ga0055535_10014318 392
15 3300003762 Ga0055542_1001129 Ga0055542_100112913 392
16 3300003763 Ga0055529_1000948 Ga0055529_10009485 392
17 3300003856 Ga0058692_1000904 Ga0058692_10009044 392
18 3300025228 Ga0209672_100054 Ga0209672_100054185 392
19 3300025229 Ga0209147_100085 Ga0209147_1000855 392
20 3300025242 Ga0209258_100168 Ga0209258_1001684 392
21 3300025254 Ga0209148_1000119 Ga0209148_100011961 392
22 3300025272 Ga0209455_1000244 Ga0209455_100024461 392
23 3300027312 Ga0209371_1000575 Ga0209371_10005755 392
24 3300030500 Ga0268256_1000875 Ga0268256_10008755 392
25 3300028794 Ga0307515_10000022 Ga0307515_10000022255 393
26 3300028794 Ga0307515_10000191 Ga0307515_1000019130 393
27 3300049581 Ga0501047_0070809 Ga0501047_0070809_331_1602 393
28 3300003794 Ga0055531_10001824 Ga0055531_1000182414 394
29 3300005563 Ga0068855_100088646 Ga0068855_1000886462 394
30 3300005614 Ga0068856_100158849 Ga0068856_1001588492 394
31 3300006038 Ga0075365_10071070 Ga0075365_100710702 394
32 3300009174 Ga0105241_10254407 Ga0105241_102544071 394
33 3300010375 Ga0105239_10181241 Ga0105239_101812412 394
34 3300025303 Ga0209051_1000110 Ga0209051_1000110124 394
35 3300025304 Ga0209257_1000012 Ga0209257_1000012877 394
36 3300025304 Ga0209257_1000045 Ga0209257_1000045283 394
37 3300031731 Ga0307405_10036191 Ga0307405_100361912 394
38 3300037312 Ga0395899_0001564 Ga0395899_0001564_5538_6812 394
39 3300037312 Ga0395899_0012064 Ga0395899_0012064_2410_3684 394
40 3300037418 Ga0395900_0011209 Ga0395900_0011209_7362_8639 394
41 3300037418 Ga0395900_0013558 Ga0395900_0013558_2051_3325 394
42 3300037418 Ga0395900_0064536 Ga0395900_0064536_1533_2807 394
43 3300037418 Ga0395900_0154753 Ga0395900_0154753_944_2218 394
44 3300037418 Ga0395900_0276116 Ga0395900_0276116_264_1538 394
45 3300037466 Ga0395898_0031295 Ga0395898_0031295_356_1630 394
46 3300037471 Ga0395905_0009528 Ga0395905_0009528_2413_3687 394
47 3300037471 Ga0395905_0033634 Ga0395905_0033634_2519_3793 394
48 3300037471 Ga0395905_0081051 Ga0395905_0081051_671_1948 394
49 3300037471 Ga0395905_0087621 Ga0395905_0087621_1025_2299 394
50 3300042007 Ga0439449_0002251 Ga0439449_0002251_4656_5930 394
51 3300042015 Ga0439462_0003530 Ga0439462_0003530_368_1642 394
52 3300042115 Ga0450911_001137 Ga0450911_001137_2621_3871 394
53 3300042116 Ga0450912_000284 Ga0450912_000284_495_1769 394
54 3300042134 Ga0450898_000983 Ga0450898_000983_2075_3349 394
55 3300042134 Ga0450898_001580 Ga0450898_001580_1559_2842 394
56 3300042156 Ga0439446_0004830 Ga0439446_0004830_1862_3136 394
57 3300042435 Ga0439434_0008896 Ga0439434_0008896_152_1426 394
58 3300042436 Ga0439435_0035206 Ga0439435_0035206_67_1341 394
59 3300042439 Ga0439464_0008229 Ga0439464_0008229_1344_2618 394
60 3300042532 Ga0450893_0004321 Ga0450893_0004321_200_1474 394
61 3300042876 Ga0451577_0113064 Ga0451577_0113064_348_1622 394
62 3300044673 Ga0453683_0001993 Ga0453683_0001993_14167_15441 394
63 3300045051 Ga0451576_0082807 Ga0451576_0082807_1338_2612 394
64 3300045976 Ga0466967_0094770 Ga0466967_0094770_383_1660 394
65 3300048924 Ga0496121_0009882 Ga0496121_0009882_9092_10342 394
66 3300048928 Ga0496125_0012086 Ga0496125_0012086_1382_2632 394
67 3300048928 Ga0496125_0034876 Ga0496125_0034876_546_1796 394
68 3300049760 Ga0501263_001653 Ga0501263_001653_855_2129 394
69 3300006195 Ga0075366_10030306 Ga0075366_100303062 395
70 3300028794 Ga0307515_10025661 Ga0307515_100256612 395
71 3300005457 Ga0070662_100044313 Ga0070662_1000443132 397
72 3300025933 Ga0207706_10014854 Ga0207706_100148544 397
73 3300005563 Ga0068855_100010176 Ga0068855_1000101766 399
74 3300009093 Ga0105240_10005791 Ga0105240_1000579111 399
75 3300009545 Ga0105237_10003275 Ga0105237_100032758 399
76 3300009551 Ga0105238_10000102 Ga0105238_1000010251 399
77 3300010375 Ga0105239_10001547 Ga0105239_1000154714 399
78 3300025913 Ga0207695_10003429 Ga0207695_100034298 399
79 3300025914 Ga0207671_10001495 Ga0207671_1000149516 399
80 3300025924 Ga0207694_10000176 Ga0207694_1000017645 399
81 3300025949 Ga0207667_10017312 Ga0207667_100173126 399
82 3300031616 Ga0307508_10000017 Ga0307508_10000017174 402
83 3300005337 Ga0070682_100051202 Ga0070682_1000512022 404
84 3300005339 Ga0070660_100010032 Ga0070660_1000100322 404
85 3300005366 Ga0070659_100006676 Ga0070659_1000066765 404
86 3300006353 Ga0075370_10001010 Ga0075370_1000101012 404
87 3300025915 Ga0207693_10027472 Ga0207693_100274724 404
88 3300025919 Ga0207657_10017935 Ga0207657_100179354 404
89 3300025932 Ga0207690_10002863 Ga0207690_100028632 404
90 3300037312 Ga0395899_0003106 Ga0395899_0003106_7210_8463 404
91 3300037312 Ga0395899_0012534 Ga0395899_0012534_4338_5591 404
92 3300037418 Ga0395900_0008097 Ga0395900_0008097_9269_10522 404
93 3300037418 Ga0395900_0052641 Ga0395900_0052641_2715_3968 404
94 3300037471 Ga0395905_0002605 Ga0395905_0002605_11881_13134 404
95 3300038443 Ga0395901_0002522 Ga0395901_0002522_6940_8172 404
96 3300038443 Ga0395901_0003709 Ga0395901_0003709_5845_7098 404
97 3300044658 Ga0466972_0000285 Ga0466972_0000285_19093_20337 404
98 3300044683 Ga0466965_0000473 Ga0466965_0000473_9135_10379 404
99 3300044706 Ga0466964_0001829 Ga0466964_0001829_331_1575 404
100 3300044735 Ga0466968_0001709 Ga0466968_0001709_3632_4876 404
101 3300049823 Ga0501044_0078280 Ga0501044_0078280_796_2049 404
102 3300050496 nmdc:mga07m45_5769_c1 nmdc:mga07m45_5769_c1_3388_4650 404
103 3300039447 Ga0436361_0037196 Ga0436361_0037196_1144_2391 405
104 3300044658 Ga0466972_0000508 Ga0466972_0000508_610_1947 406
105 3300003187 JGI25151J46595_10001148 JGI25151J46595_100011489 407
106 3300003187 JGI25151J46595_10001220 JGI25151J46595_100012206 407
107 3300003771 Ga0055526_1002549 Ga0055526_10025494 407
108 3300003771 Ga0055526_1002553 Ga0055526_10025537 407
109 3300003775 Ga0055524_1000401 Ga0055524_100040113 407
110 3300003781 Ga0055536_1000365 Ga0055536_100036523 407
111 3300003784 Ga0055534_1001121 Ga0055534_10011217 407
112 3300006948 Ga0099826_10000004 Ga0099826_10000004186 407
113 3300025263 Ga0209565_1000066 Ga0209565_100006694 407
114 3300025273 Ga0209673_1034546 Ga0209673_10345461 407
115 3300025291 Ga0209675_1000084 Ga0209675_1000084106 407
116 3300025291 Ga0209675_1001045 Ga0209675_10010458 407
117 3300025292 Ga0209676_1000014 Ga0209676_1000014401 407
118 3300025294 Ga0209025_1000365 Ga0209025_100036561 407
119 3300025294 Ga0209025_1000437 Ga0209025_100043729 407
120 3300025294 Ga0209025_1002968 Ga0209025_10029684 407
121 3300025295 Ga0209564_1000539 Ga0209564_100053941 407
122 3300025295 Ga0209564_1000901 Ga0209564_10009017 407
123 3300025295 Ga0209564_1002826 Ga0209564_10028264 407
124 3300025299 Ga0209256_1000331 Ga0209256_100033169 407
125 3300025303 Ga0209051_1016489 Ga0209051_10164891 407
126 3300027666 Ga0209282_1000035 Ga0209282_100003585 407
127 3300028794 Ga0307515_10058388 Ga0307515_100583883 407
128 3300031456 Ga0307513_10026755 Ga0307513_100267553 407
129 3300031507 Ga0307509_10057726 Ga0307509_100577262 407
130 3300032004 Ga0307414_10035859 Ga0307414_100358592 407
131 3300046474 Ga0495605_0003171 Ga0495605_0003171_7737_9029 407
132 3300046500 Ga0495596_0001951 Ga0495596_0001951_9437_10729 407
133 3300046501 Ga0495607_0025059 Ga0495607_0025059_2099_3391 407
134 3300046512 Ga0495610_0003726 Ga0495610_0003726_713_2005 407
135 3300046513 Ga0495616_0002965 Ga0495616_0002965_609_1901 407
136 3300046519 Ga0495632_0007474 Ga0495632_0007474_199_1536 407
137 3300046522 Ga0495643_0042666 Ga0495643_0042666_309_1601 407
138 3300046538 Ga0495609_0002440 Ga0495609_0002440_9494_10786 407
139 3300046542 Ga0495597_0012347 Ga0495597_0012347_262_1554 407
140 3300046648 Ga0495611_0041593 Ga0495611_0041593_281_1573 407
141 3300046660 Ga0495625_0005094 Ga0495625_0005094_8960_10297 407
142 3300046665 Ga0495661_0017318 Ga0495661_0017318_2899_4191 407
143 3300046692 Ga0495671_0003485 Ga0495671_0003485_7603_8895 407
144 3300046694 Ga0495649_0003524 Ga0495649_0003524_660_1952 407
145 3300047320 Ga0495672_0031806 Ga0495672_0031806_307_1599 407
146 3300048919 Ga0496116_0082271 Ga0496116_0082271_580_1872 407
147 3300048924 Ga0496121_0047118 Ga0496121_0047118_193_1485 407
148 3300048925 Ga0496122_0003093 Ga0496122_0003093_11087_12379 407
149 3300048926 Ga0496123_0002770 Ga0496123_0002770_9331_10623 407
150 3300053134 Ga0500658_0040856 Ga0500658_0040856_117_1454 407
151 iso_pu_bacteria 2513237150 2513956863 407
152 iso_pu_bacteria 2513237165 2514043393 407
153 iso_pu_bacteria 2585428062 2587755156 407
154 iso_pu_bacteria 2834641062 2834642025 407
155 iso_pu_bacteria 644736347 644747751 407
156 iso_pu_bacteria 8003400568 8003404433 407
157 3300003322 rootL2_10146905 rootL2_101469052 408
158 3300027876 Ga0209974_10000306 Ga0209974_100003062 408
159 iso_pu_bacteria 2513237151 2513962631 408
160 iso_pu_bacteria 2904439833 2904442367 408
161 iso_pu_bacteria 2919046199 2919050618 408
162 3300005548 Ga0070665_100028557 Ga0070665_1000285572 409
163 3300009098 Ga0105245_10286709 Ga0105245_102867092 409
164 3300014968 Ga0157379_10078911 Ga0157379_100789112 409
165 3300025942 Ga0207689_10092952 Ga0207689_100929522 409
166 3300028379 Ga0268266_10012109 Ga0268266_100121093 409
167 3300049581 Ga0501047_0166089 Ga0501047_0166089_698_1966 409
168 3300049822 Ga0501035_0110313 Ga0501035_0110313_667_1935 409
169 3300049823 Ga0501044_0017880 Ga0501044_0017880_1440_2708 409
170 3300003214 JGI25165J46597_1002446 JGI25165J46597_10024463 410
171 3300003758 Ga0055532_1000092 Ga0055532_10000923 410
172 3300003760 Ga0055527_1000035 Ga0055527_100003541 410
173 3300003761 Ga0055535_1000050 Ga0055535_100005041 410
174 3300003762 Ga0055542_1000120 Ga0055542_10001203 410
175 3300003763 Ga0055529_1000089 Ga0055529_100008941 410
176 3300005455 Ga0070663_100000524 Ga0070663_1000005246 410
177 3300005459 Ga0068867_100000175 Ga0068867_10000017533 410
178 3300005616 Ga0068852_100007222 Ga0068852_1000072226 410
179 3300009148 Ga0105243_10000770 Ga0105243_1000077015 410
180 3300014745 Ga0157377_10000014 Ga0157377_10000014187 410
181 3300025228 Ga0209672_100073 Ga0209672_100073106 410
182 3300025229 Ga0209147_100093 Ga0209147_100093106 410
183 3300025231 Ga0207427_101047 Ga0207427_1010477 410
184 3300025242 Ga0209258_100140 Ga0209258_100140106 410
185 3300025254 Ga0209148_1000140 Ga0209148_1000140107 410
186 3300025261 Ga0209233_1000173 Ga0209233_1000173106 410
187 3300025272 Ga0209455_1000125 Ga0209455_1000125107 410
188 3300025935 Ga0207709_10013137 Ga0207709_100131374 410
189 3300026067 Ga0207678_10001691 Ga0207678_1000169114 410
190 3300026089 Ga0207648_10000142 Ga0207648_1000014236 410
191 3300026142 Ga0207698_10024832 Ga0207698_100248322 410
192 3300037471 Ga0395905_0023360 Ga0395905_0023360_3237_4583 410
193 3300049579 Ga0501043_0000141 Ga0501043_0000141_18707_20053 410
194 3300049580 Ga0501046_0000047 Ga0501046_0000047_40719_42065 410
195 3300049581 Ga0501047_0000058 Ga0501047_0000058_98682_100028 410
196 3300049582 Ga0501048_0000475 Ga0501048_0000475_12533_13879 410
197 3300049824 Ga0501045_0074856 Ga0501045_0074856_916_2262 410
198 3300053086 Ga0500578_0018907 Ga0500578_0018907_1799_3145 410
199 3300016635 Ga0183361_10015 Ga0183361_1001575 411
200 3300001979 JGI24740J21852_10001324 JGI24740J21852_100013246 412
201 3300001990 JGI24737J22298_10020367 JGI24737J22298_100203672 412
202 3300002067 JGI24735J21928_10000155 JGI24735J21928_100001554 412
203 3300002067 JGI24735J21928_10001750 JGI24735J21928_100017506 412
204 3300002705 JGI25156J39149_1000418 JGI25156J39149_100041819 412
205 3300002705 JGI25156J39149_1001488 JGI25156J39149_10014883 412
206 3300002705 JGI25156J39149_1005143 JGI25156J39149_10051432 412
207 3300003320 rootH2_10079005 rootH2_100790053 412
208 3300003323 rootH1_10196331 rootH1_101963313 412
209 3300003354 JGI25160J50197_1001789 JGI25160J50197_100178910 412
210 3300003756 Ga0055533_1000529 Ga0055533_10005295 412
211 3300003756 Ga0055533_1003739 Ga0055533_10037392 412
212 3300003758 Ga0055532_1001701 Ga0055532_10017014 412
213 3300003790 Ga0055528_1011117 Ga0055528_10111173 412
214 3300005262 Ga0065165_1003668 Ga0065165_10036682 412
215 3300005563 Ga0068855_100134814 Ga0068855_1001348142 412
216 3300009011 Ga0105251_10049577 Ga0105251_100495772 412
217 3300009093 Ga0105240_10021398 Ga0105240_100213985 412
218 3300009093 Ga0105240_10042020 Ga0105240_100420202 412
219 3300009093 Ga0105240_10166384 Ga0105240_101663842 412
220 3300013105 Ga0157369_10019485 Ga0157369_100194855 412
221 3300015262 Ga0182007_10012347 Ga0182007_100123473 412
222 3300025225 Ga0209566_100312 Ga0209566_10031217 412
223 3300025226 Ga0209674_100153 Ga0209674_10015365 412
224 3300025226 Ga0209674_100272 Ga0209674_1002726 412
225 3300025226 Ga0209674_102953 Ga0209674_1029533 412
226 3300025229 Ga0209147_100832 Ga0209147_10083210 412
227 3300025230 Ga0209563_101295 Ga0209563_1012953 412
228 3300025256 Ga0209759_1000281 Ga0209759_100028147 412
229 3300025256 Ga0209759_1000329 Ga0209759_10003294 412
230 3300025256 Ga0209759_1000362 Ga0209759_100036219 412
231 3300025256 Ga0209759_1013248 Ga0209759_10132482 412
232 3300025273 Ga0209673_1000098 Ga0209673_1000098141 412
233 3300025295 Ga0209564_1011630 Ga0209564_10116302 412
234 3300025302 Ga0207426_1000199 Ga0207426_100019949 412
235 3300025904 Ga0207647_10055119 Ga0207647_100551192 412
236 3300025904 Ga0207647_10077683 Ga0207647_100776831 412
237 3300025913 Ga0207695_10005064 Ga0207695_1000506416 412
238 3300025913 Ga0207695_10169741 Ga0207695_101697412 412
239 3300027312 Ga0209371_1001567 Ga0209371_10015673 412
240 3300030500 Ga0268256_1001343 Ga0268256_10013433 412
241 3300031548 Ga0307408_100003563 Ga0307408_1000035633 412
242 3300031911 Ga0307412_10000056 Ga0307412_1000005656 412
243 3300031995 Ga0307409_100200170 Ga0307409_1002001702 412
244 3300032002 Ga0307416_100009684 Ga0307416_1000096842 412
245 3300046454 Ga0495592_0121385 Ga0495592_0121385_304_1569 412
246 3300046455 Ga0495603_0000734 Ga0495603_0000734_17018_18283 412
247 3300046455 Ga0495603_0003264 Ga0495603_0003264_50_1318 412
248 3300046455 Ga0495603_0124045 Ga0495603_0124045_25_1290 412
249 3300046457 Ga0495590_0001899 Ga0495590_0001899_1722_3014 412
250 3300046457 Ga0495590_0004680 Ga0495590_0004680_958_2232 412
251 3300046457 Ga0495590_0023900 Ga0495590_0023900_540_1808 412
252 3300046458 Ga0495591_001305 Ga0495591_001305_11381_12646 412
253 3300046459 Ga0495629_0000162 Ga0495629_0000162_55360_56634 412
254 3300046459 Ga0495629_0001379 Ga0495629_0001379_15891_17183 412
255 3300046459 Ga0495629_0030147 Ga0495629_0030147_867_2132 412
256 3300046460 Ga0495638_0014949 Ga0495638_0014949_3877_5151 412
257 3300046461 Ga0495641_0010319 Ga0495641_0010319_2924_4189 412
258 3300046462 Ga0495651_0049019 Ga0495651_0049019_406_1680 412
259 3300046462 Ga0495651_0065939 Ga0495651_0065939_55_1320 412
260 3300046462 Ga0495651_0069576 Ga0495651_0069576_648_1922 412
261 3300046463 Ga0495653_0001542 Ga0495653_0001542_16397_17662 412
262 3300046463 Ga0495653_0001687 Ga0495653_0001687_4835_6109 412
263 3300046463 Ga0495653_0046313 Ga0495653_0046313_1090_2355 412
264 3300046471 Ga0495650_0044361 Ga0495650_0044361_545_1810 412
265 3300046472 Ga0495580_0001709 Ga0495580_0001709_2717_3982 412
266 3300046472 Ga0495580_0002400 Ga0495580_0002400_1479_2753 412
267 3300046472 Ga0495580_0014280 Ga0495580_0014280_3980_5251 412
268 3300046472 Ga0495580_0016881 Ga0495580_0016881_659_1933 412
269 3300046472 Ga0495580_0046826 Ga0495580_0046826_753_2018 412
270 3300046472 Ga0495580_0066304 Ga0495580_0066304_277_1545 412
271 3300046473 Ga0495582_0002198 Ga0495582_0002198_751_2016 412
272 3300046473 Ga0495582_0011445 Ga0495582_0011445_1070_2341 412
273 3300046473 Ga0495582_0012580 Ga0495582_0012580_194_1486 412
274 3300046474 Ga0495605_0010333 Ga0495605_0010333_908_2173 412
275 3300046474 Ga0495605_0010922 Ga0495605_0010922_2188_3462 412
276 3300046474 Ga0495605_0033489 Ga0495605_0033489_558_1826 412
277 3300046476 Ga0495662_0010139 Ga0495662_0010139_529_1794 412
278 3300046477 Ga0495664_0001070 Ga0495664_0001070_11113_12378 412
279 3300046477 Ga0495664_0064029 Ga0495664_0064029_145_1437 412
280 3300046477 Ga0495664_0080578 Ga0495664_0080578_15_1280 412
281 3300046500 Ga0495596_0001163 Ga0495596_0001163_11454_12719 412
282 3300046500 Ga0495596_0006023 Ga0495596_0006023_3213_4478 412
283 3300046506 Ga0495583_0049756 Ga0495583_0049756_505_1773 412
284 3300046507 Ga0495606_0014872 Ga0495606_0014872_3478_4770 412
285 3300046511 Ga0495608_0003857 Ga0495608_0003857_6451_7743 412
286 3300046512 Ga0495610_0004088 Ga0495610_0004088_6686_7951 412
287 3300046514 Ga0495618_0002471 Ga0495618_0002471_5878_7143 412
288 3300046514 Ga0495618_0004161 Ga0495618_0004161_3546_4838 412
289 3300046514 Ga0495618_0091420 Ga0495618_0091420_94_1359 412
290 3300046516 Ga0495628_0003612 Ga0495628_0003612_3125_4390 412
291 3300046516 Ga0495628_0039403 Ga0495628_0039403_1709_3001 412
292 3300046516 Ga0495628_0062856 Ga0495628_0062856_748_2022 412
293 3300046516 Ga0495628_0071348 Ga0495628_0071348_1278_2552 412
294 3300046517 Ga0495630_0033931 Ga0495630_0033931_457_1728 412
295 3300046517 Ga0495630_0058295 Ga0495630_0058295_1175_2440 412
296 3300046517 Ga0495630_0223823 Ga0495630_0223823_94_1386 412
297 3300046524 Ga0495648_0004162 Ga0495648_0004162_11041_12306 412
298 3300046524 Ga0495648_0055208 Ga0495648_0055208_251_1525 412
299 3300046526 Ga0495666_0001360 Ga0495666_0001360_1376_2641 412
300 3300046526 Ga0495666_0022087 Ga0495666_0022087_1067_2341 412
301 3300046529 Ga0495652_0018699 Ga0495652_0018699_3176_4468 412
302 3300046529 Ga0495652_0025160 Ga0495652_0025160_1717_2982 412
303 3300046529 Ga0495652_0135087 Ga0495652_0135087_253_1527 412
304 3300046531 Ga0495665_0003493 Ga0495665_0003493_4516_5808 412
305 3300046531 Ga0495665_0007415 Ga0495665_0007415_173_1438 412
306 3300046531 Ga0495665_0030535 Ga0495665_0030535_1557_2822 412
307 3300046533 Ga0495640_0003238 Ga0495640_0003238_278_1543 412
308 3300046533 Ga0495640_0008301 Ga0495640_0008301_3420_4712 412
309 3300046533 Ga0495640_0034329 Ga0495640_0034329_1715_2980 412
310 3300046535 Ga0495586_0002228 Ga0495586_0002228_9262_10527 412
311 3300046536 Ga0495587_0000463 Ga0495587_0000463_23989_25254 412
312 3300046536 Ga0495587_0049249 Ga0495587_0049249_562_1827 412
313 3300046536 Ga0495587_0091958 Ga0495587_0091958_403_1677 412
314 3300046543 Ga0495645_0025548 Ga0495645_0025548_2670_3935 412
315 3300046557 Ga0495622_0000349 Ga0495622_0000349_4827_6092 412
316 3300046642 Ga0495634_0062712 Ga0495634_0062712_427_1692 412
317 3300046663 Ga0495635_0002193 Ga0495635_0002193_6539_7831 412
318 3300046663 Ga0495635_0004444 Ga0495635_0004444_179_1444 412
319 3300046665 Ga0495661_0007612 Ga0495661_0007612_4826_6091 412
320 3300046675 Ga0495657_0055655 Ga0495657_0055655_128_1420 412
321 3300046678 Ga0495599_0002788 Ga0495599_0002788_1155_2420 412
322 3300046678 Ga0495599_0007738 Ga0495599_0007738_1822_3096 412
323 3300046678 Ga0495599_0009016 Ga0495599_0009016_553_1827 412
324 3300046678 Ga0495599_0085588 Ga0495599_0085588_464_1756 412
325 3300046678 Ga0495599_0108642 Ga0495599_0108642_303_1568 412
326 3300046679 Ga0495623_0004772 Ga0495623_0004772_1709_3001 412
327 3300046679 Ga0495623_0035512 Ga0495623_0035512_1381_2655 412
328 3300046680 Ga0495646_0002044 Ga0495646_0002044_6175_7467 412
329 3300046680 Ga0495646_0002817 Ga0495646_0002817_8927_10192 412
330 3300046680 Ga0495646_0021344 Ga0495646_0021344_616_1890 412
331 3300046689 Ga0495613_0001086 Ga0495613_0001086_137_1402 412
332 3300046689 Ga0495613_0013650 Ga0495613_0013650_408_1673 412
333 3300046690 Ga0495624_0002939 Ga0495624_0002939_9220_10485 412
334 3300046690 Ga0495624_0009490 Ga0495624_0009490_1870_3144 412
335 3300046690 Ga0495624_0018705 Ga0495624_0018705_1034_2305 412
336 3300046690 Ga0495624_0024364 Ga0495624_0024364_999_2273 412
337 3300046694 Ga0495649_0007972 Ga0495649_0007972_2165_3457 412
338 3300046694 Ga0495649_0027318 Ga0495649_0027318_923_2251 412
339 3300046694 Ga0495649_0113134 Ga0495649_0113134_37_1311 412
340 3300046794 Ga0495589_0011814 Ga0495589_0011814_2822_4087 412
341 3300046794 Ga0495589_0051191 Ga0495589_0051191_518_1783 412
342 3300046809 Ga0495600_0002282 Ga0495600_0002282_3012_4304 412
343 3300047315 Ga0495581_0001139 Ga0495581_0001139_4777_6042 412
344 3300047315 Ga0495581_0004859 Ga0495581_0004859_3066_4358 412
345 3300047315 Ga0495581_0051999 Ga0495581_0051999_632_1897 412
346 3300047317 Ga0495604_0010632 Ga0495604_0010632_1242_2507 412
347 3300047317 Ga0495604_0028746 Ga0495604_0028746_2572_3846 412
348 3300047317 Ga0495604_0057275 Ga0495604_0057275_1334_2608 412
349 3300047317 Ga0495604_0088750 Ga0495604_0088750_305_1597 412
350 3300047319 Ga0495674_0020747 Ga0495674_0020747_3460_4725 412
351 3300047319 Ga0495674_0025864 Ga0495674_0025864_935_2206 412
352 3300047319 Ga0495674_0043644 Ga0495674_0043644_1829_3094 412
353 3300047320 Ga0495672_0076739 Ga0495672_0076739_535_1803 412
354 3300047321 Ga0495676_0014085 Ga0495676_0014085_1167_2432 412
355 3300047321 Ga0495676_0019564 Ga0495676_0019564_4326_5591 412
356 3300047321 Ga0495676_0063101 Ga0495676_0063101_862_2136 412
357 3300047322 Ga0495680_0002154 Ga0495680_0002154_14281_15546 412
358 3300047322 Ga0495680_0033806 Ga0495680_0033806_2536_3810 412
359 3300047323 Ga0495683_0003086 Ga0495683_0003086_4923_6215 412
360 3300047323 Ga0495683_0010632 Ga0495683_0010632_1765_3039 412
361 3300047323 Ga0495683_0014922 Ga0495683_0014922_129_1394 412
362 3300047323 Ga0495683_0059779 Ga0495683_0059779_603_1868 412
363 3300047443 Ga0495687_013771 Ga0495687_013771_2790_4055 412
364 3300047443 Ga0495687_036743 Ga0495687_036743_763_2031 412
365 3300047443 Ga0495687_069939 Ga0495687_069939_98_1390 412
366 3300047444 Ga0495675_0011029 Ga0495675_0011029_541_1899 412
367 3300047446 Ga0495679_000617 Ga0495679_000617_574_1839 412
368 3300047446 Ga0495679_000750 Ga0495679_000750_16506_17780 412
369 3300047446 Ga0495679_006448 Ga0495679_006448_793_2058 412
370 3300047469 Ga0495673_0029863 Ga0495673_0029863_157_1422 412
371 3300047469 Ga0495673_0036738 Ga0495673_0036738_80_1354 412
372 3300047471 Ga0495684_0035145 Ga0495684_0035145_1141_2406 412
373 3300047673 Ga0495593_0003694 Ga0495593_0003694_671_1945 412
374 3300047673 Ga0495593_0032068 Ga0495593_0032068_559_1824 412
375 3300048088 Ga0495602_0015150 Ga0495602_0015150_754_2019 412
376 3300048088 Ga0495602_0019599 Ga0495602_0019599_1136_2410 412
377 3300048088 Ga0495602_0020786 Ga0495602_0020786_381_1646 412
378 3300048089 Ga0495614_0005364 Ga0495614_0005364_3142_4407 412
379 3300048091 Ga0495626_0034692 Ga0495626_0034692_1005_2270 412
380 3300048091 Ga0495626_0039379 Ga0495626_0039379_368_1660 412
381 3300048904 Ga0496101_0007655 Ga0496101_0007655_4405_5673 412
382 3300048905 Ga0496102_0013902 Ga0496102_0013902_4404_5672 412
383 3300048905 Ga0496102_0017849 Ga0496102_0017849_154_1419 412
384 3300048906 Ga0496103_0001492 Ga0496103_0001492_13425_14693 412
385 3300048906 Ga0496103_0030670 Ga0496103_0030670_528_1793 412
386 3300048908 Ga0496105_0141476 Ga0496105_0141476_533_1801 412
387 3300048909 Ga0496106_0000162 Ga0496106_0000162_42426_43691 412
388 3300048916 Ga0496113_0166456 Ga0496113_0166456_419_1687 412
389 3300048920 Ga0496117_0007541 Ga0496117_0007541_8023_9288 412
390 3300048920 Ga0496117_0096328 Ga0496117_0096328_210_1475 412
391 3300048921 Ga0496118_0008687 Ga0496118_0008687_8327_9595 412
392 3300048921 Ga0496118_0017211 Ga0496118_0017211_1612_2877 412
393 3300048922 Ga0496119_0050867 Ga0496119_0050867_173_1441 412
394 3300048924 Ga0496121_0006767 Ga0496121_0006767_7801_9066 412
395 3300048924 Ga0496121_0018436 Ga0496121_0018436_3343_4608 412
396 3300048924 Ga0496121_0022736 Ga0496121_0022736_4414_5682 412
397 3300048924 Ga0496121_0065386 Ga0496121_0065386_744_2012 412
398 3300048924 Ga0496121_0087006 Ga0496121_0087006_497_1771 412
399 3300048929 Ga0496126_0004713 Ga0496126_0004713_9213_10478 412
400 3300048929 Ga0496126_0004910 Ga0496126_0004910_3098_4372 412
401 3300049460 Ga0495682_0051860 Ga0495682_0051860_155_1429 412
402 3300061719 Ga0466962_0107799 Ga0466962_0107799_20_1312 412
403 iso_pu_bacteria 2501025502 2501084082 412
404 iso_pu_bacteria 2501025504 2501414392 412
405 iso_pu_bacteria 2508501125 2509130812 412
406 iso_pu_bacteria 2510917013 2511093365 412
407 iso_pu_bacteria 2510917014 2511099815 412
408 iso_pu_bacteria 2510917015 2511102414 412
409 iso_pu_bacteria 2512047030 2512348407 412
410 iso_pu_bacteria 2515154189 2516022267 412
411 iso_pu_bacteria 2526164713 2527080622 412
412 iso_pu_bacteria 2562617112 2563061559 412
413 iso_pu_bacteria 2599185239 2599741082 412
414 iso_pu_bacteria 2599185240 2599748389 412
415 iso_pu_bacteria 2599185355 2600210301 412
416 iso_pu_bacteria 2675903129 2676745774 412
417 iso_pu_bacteria 2711768613 2713478576 412
418 iso_pu_bacteria 2738541296 2738823994 412
419 iso_pu_bacteria 2738541298 2738836385 412
420 iso_pu_bacteria 2738541306 2738877915 412
421 iso_pu_bacteria 2738543002 2739189621 412
422 iso_pu_bacteria 2738543008 2739224508 412
423 iso_pu_bacteria 2744054900 2746087259 412
424 iso_pu_bacteria 2744054901 2746093234 412
425 iso_pu_bacteria 2818991452 2819636838 412
426 iso_pu_bacteria 2842324504 2842332154 412
427 iso_pu_bacteria 2842348783 2842356394 412
428 iso_pu_bacteria 2842454564 2842461252 412
429 iso_pu_bacteria 2856287931 2856289370 412
430 iso_pu_bacteria 2857357740 2857362243 412
431 iso_pu_bacteria 2863421361 2863426457 412
432 iso_pu_bacteria 2870068957 2870069363 412
433 iso_pu_bacteria 2883087390 2883091401 412
434 iso_pu_bacteria 2885270888 2885272393 412
435 iso_pu_bacteria 2900634093 2900637102 412
436 iso_pu_bacteria 2904483920 2904490149 412
437 iso_pu_bacteria 2904564687 2904569378 412
438 iso_pu_bacteria 2904571731 2904576785 412
439 iso_pu_bacteria 2919527303 2919533318 412
440 iso_pu_bacteria 2928170801 2928176295 412
441 iso_pu_bacteria 2928536128 2928542055 412
442 iso_pu_bacteria 2945934425 2945934533 412
443 iso_pu_bacteria 2990703756 2990704908 412
444 iso_pu_bacteria 641736151 642426572 412
445 iso_pu_bacteria 642555113 642623169 412
446 iso_pu_bacteria 8018845410 8018847968 412
447 iso_pu_bacteria 8020938398 8020939007 412
448 iso_pu_bacteria 8020945358 8020947723 412
449 iso_pu_bacteria 8020953355 8020953446 412
450 iso_pu_bacteria 8021120328 8021127552 412
451 iso_pu_bacteria 8039098773 8039099702 412
452 iso_pu_bacteria 8055301274 8055307381 412

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

1

438

0.9

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

1

58

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oc4-assembly1.cif.gz_A crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.8815 198 246
3oc4-assembly1.cif.gz_B crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.875 198 246
3itj-assembly2.cif.gz_C crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) 0.8746 203 239
7cyx-assembly1.cif.gz_A crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 0.8518 2 395
4ysh-assembly1.cif.gz_A crystal structure of glycine oxidase from geobacillus kaustophilus 0.8485 2 406
ID Description Score Start End Superfamily
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8803 192 236 3.50.50.60
3ctyB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8711 193 245 3.50.50.60
af_P96261_93_276_3.30.9.10 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.869 126 332 3.30.9.10
3gsiA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8641 184 406 3.50.50.60
3e1tA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8639 188 246 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A839A0Z1-F1-model_v4 deleted 0.9677 2 398
AF-A0A6N9SSC0-F1-model_v4 FAD-dependent oxidoreductase 0.9669 2 398 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A4SNB0-F1-model_v4 D-amino acid dehydrogenase (EC 1.4.99.-) 0.9661 2 407 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A8B3G9I7-F1-model_v4 deleted 0.9658 237 409
AF-A0A847DWZ4-F1-model_v4 D-amino acid dehydrogenase 0.9654 2 408 GO:0005737
GO:0005886
GO:0008718
GO:0055130

Feature Viewer

pLDDT pTM Quality
93.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map