F447102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 452 | 288 | 393 | 424 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8020953355|8020953446 |
| Length | 458 |
| Sequence | VLGAGVIGVTTAWHLREAGCDVTVIEREADVAQATSLGNAGVIAPGYVTPWAAPGMPGKILKYLFKPASPLIFRPTLDAAQWRWIARWLRECEFERFRVNKQRMQRIAYYSRACLRAFRDRHPFDYGASRGYLQLLRGAFDVEMVQPALKVLRDAGIAFRELDAAGCTAIEPGLRWARQAPVGGIYLPDDEAGDCARFTRELRSLCEANGVTFRFRTEIRALDVAGGKVRGVRVSATGTDGRSPRDEGTGIDTPDIDLRGAGQPGRPAAGRAASSATKPRDVLLEADAVVVALGVDSAGLLRPHGIDVPLYPVKGYSATLTVVDDEKAPHAALMDESLKTAITRFGPTLRVAGTAELGNRHAALRQQALDTLMKVLDDWFPHAAERASARFWVGRRPMTPDGPPLLGASHIDGLWLNVGHGSTGWAMSMGSGKVLADLVTGREPEIDLSGLTLARYER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 8 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 9 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 10 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 13 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 14 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 15 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 16 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 17 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 18 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 19 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 20 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 21 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 22 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 23 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 24 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 25 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 26 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 27 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 28 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 29 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 30 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 31 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 32 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 33 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 34 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 35 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 36 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 37 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 38 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 39 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 40 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 41 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 42 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 43 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 44 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 45 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 46 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 47 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 48 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 49 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 50 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 51 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 52 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 53 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 54 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 55 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 56 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 57 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 58 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 59 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 63 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 64 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 72 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 101 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 160 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 161 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 162 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 163 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 164 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 165 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 166 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 167 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 168 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 171 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 175 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 276 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 279 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 280 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 281 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 282 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 283 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 284 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 285 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 286 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 287 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 288 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.95 |
| Metatranscriptomes | 0 |
| Isolates | 13.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.82 |
| Nodule | 2.88 |
| Rhizoplane | 3.1 |
| Rhizosphere | 64.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001324 | 3300001979 | Bacteria | 11257 |
| 2 | JGI24737J22298_10020367 | 3300001990 | Bacteria | 2117 |
| 3 | JGI24735J21928_10000155 | 3300002067 | Bacteria | 24058 |
| 4 | JGI24735J21928_10001750 | 3300002067 | Bacteria | 7658 |
| 5 | JGI25156J39149_1000418 | 3300002705 | Bacteria | 26417 |
| 6 | JGI25156J39149_1001488 | 3300002705 | Bacteria | 9800 |
| 7 | JGI25156J39149_1005143 | 3300002705 | Bacteria | 3843 |
| 8 | JGI25151J46595_10001148 | 3300003187 | Bacteria | 19196 |
| 9 | JGI25151J46595_10001220 | 3300003187 | Bacteria | 18383 |
| 10 | JGI25165J46597_1002446 | 3300003214 | Bacteria | 5979 |
| 11 | rootH2_10079005 | 3300003320 | Bacteria | 7297 |
| 12 | rootH2_10129063 | 3300003320 | Bacteria | 2923 |
| 13 | rootL2_10146905 | 3300003322 | Bacteria | 2994 |
| 14 | rootH1_10196331 | 3300003323 | Bacteria | 2752 |
| 15 | JGI25160J50197_1001789 | 3300003354 | Bacteria | 10401 |
| 16 | Ga0055533_1000529 | 3300003756 | Bacteria | 13667 |
| 17 | Ga0055533_1003739 | 3300003756 | Bacteria | 2952 |
| 18 | Ga0055532_1000092 | 3300003758 | Bacteria | 103243 |
| 19 | Ga0055532_1001701 | 3300003758 | Bacteria | 5663 |
| 20 | Ga0055532_1001763 | 3300003758 | Bacteria | 5444 |
| 21 | Ga0055527_1000035 | 3300003760 | Bacteria | 138481 |
| 22 | Ga0055535_1000050 | 3300003761 | Bacteria | 138481 |
| 23 | Ga0055535_1001431 | 3300003761 | Bacteria | 12173 |
| 24 | Ga0055542_1000120 | 3300003762 | Bacteria | 103243 |
| 25 | Ga0055542_1001129 | 3300003762 | Bacteria | 15863 |
| 26 | Ga0055529_1000089 | 3300003763 | Bacteria | 138481 |
| 27 | Ga0055529_1000948 | 3300003763 | Bacteria | 15232 |
| 28 | Ga0055526_1002549 | 3300003771 | Bacteria | 12236 |
| 29 | Ga0055526_1002553 | 3300003771 | Bacteria | 12225 |
| 30 | Ga0055524_1000401 | 3300003775 | Bacteria | 37009 |
| 31 | Ga0055536_1000365 | 3300003781 | Bacteria | 33614 |
| 32 | Ga0055534_1001121 | 3300003784 | Bacteria | 11364 |
| 33 | Ga0055528_1011117 | 3300003790 | Bacteria | 3603 |
| 34 | Ga0055531_10001824 | 3300003794 | Bacteria | 15095 |
| 35 | Ga0058692_1000904 | 3300003856 | Bacteria | 11693 |
| 36 | Ga0065165_1003668 | 3300005262 | Bacteria | 10478 |
| 37 | Ga0070682_100051202 | 3300005337 | Bacteria | 2580 |
| 38 | Ga0070660_100010032 | 3300005339 | Bacteria | 6681 |
| 39 | Ga0070659_100006676 | 3300005366 | Bacteria | 8339 |
| 40 | Ga0070663_100000524 | 3300005455 | Bacteria | 20208 |
| 41 | Ga0070662_100044313 | 3300005457 | Bacteria | 3186 |
| 42 | Ga0068867_100000175 | 3300005459 | Bacteria | 41852 |
| 43 | Ga0070665_100028557 | 3300005548 | Bacteria | 5618 |
| 44 | Ga0068855_100010176 | 3300005563 | Bacteria | 11335 |
| 45 | Ga0068855_100088646 | 3300005563 | Bacteria | 3574 |
| 46 | Ga0068855_100134814 | 3300005563 | Bacteria | 2818 |
| 47 | Ga0068856_100158849 | 3300005614 | Bacteria | 2271 |
| 48 | Ga0068852_100007222 | 3300005616 | Bacteria | 8100 |
| 49 | Ga0075365_10071070 | 3300006038 | Bacteria | 2342 |
| 50 | Ga0075366_10030306 | 3300006195 | Bacteria | 3180 |
| 51 | Ga0075370_10001010 | 3300006353 | Bacteria | 11647 |
| 52 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 53 | Ga0105251_10049577 | 3300009011 | Bacteria | 2009 |
| 54 | Ga0105240_10005791 | 3300009093 | Bacteria | 18327 |
| 55 | Ga0105240_10021398 | 3300009093 | Bacteria | 8602 |
| 56 | Ga0105240_10042020 | 3300009093 | Bacteria | 5828 |
| 57 | Ga0105240_10166384 | 3300009093 | Bacteria | 2615 |
| 58 | Ga0105245_10286709 | 3300009098 | Bacteria | 1611 |
| 59 | Ga0105243_10000770 | 3300009148 | Bacteria | 30670 |
| 60 | Ga0105241_10254407 | 3300009174 | Bacteria | 1490 |
| 61 | Ga0105242_10343589 | 3300009176 | Bacteria | 1376 |
| 62 | Ga0105237_10003275 | 3300009545 | Bacteria | 19332 |
| 63 | Ga0105238_10000102 | 3300009551 | Bacteria | 94910 |
| 64 | Ga0105239_10001547 | 3300010375 | Bacteria | 30388 |
| 65 | Ga0105239_10181241 | 3300010375 | Bacteria | 2357 |
| 66 | Ga0157369_10019485 | 3300013105 | Bacteria | 7592 |
| 67 | Ga0157377_10000014 | 3300014745 | Bacteria | 213961 |
| 68 | Ga0157379_10078911 | 3300014968 | Bacteria | 2949 |
| 69 | Ga0182007_10012347 | 3300015262 | Bacteria | 3289 |
| 70 | Ga0183361_10015 | 3300016635 | Bacteria | 166772 |
| 71 | Ga0209566_100312 | 3300025225 | Bacteria | 43942 |
| 72 | Ga0209674_100153 | 3300025226 | Bacteria | 94333 |
| 73 | Ga0209674_100272 | 3300025226 | Bacteria | 39275 |
| 74 | Ga0209674_102953 | 3300025226 | Bacteria | 3337 |
| 75 | Ga0209672_100054 | 3300025228 | Bacteria | 222217 |
| 76 | Ga0209672_100073 | 3300025228 | Bacteria | 166621 |
| 77 | Ga0209147_100085 | 3300025229 | Bacteria | 185813 |
| 78 | Ga0209147_100093 | 3300025229 | Bacteria | 167196 |
| 79 | Ga0209147_100832 | 3300025229 | Bacteria | 14549 |
| 80 | Ga0209563_101295 | 3300025230 | Bacteria | 6834 |
| 81 | Ga0207427_101047 | 3300025231 | Bacteria | 11492 |
| 82 | Ga0209258_100140 | 3300025242 | Bacteria | 167245 |
| 83 | Ga0209258_100168 | 3300025242 | Bacteria | 145329 |
| 84 | Ga0209148_1000119 | 3300025254 | Bacteria | 188079 |
| 85 | Ga0209148_1000140 | 3300025254 | Bacteria | 166819 |
| 86 | Ga0209759_1000281 | 3300025256 | Bacteria | 71594 |
| 87 | Ga0209759_1000329 | 3300025256 | Bacteria | 62253 |
| 88 | Ga0209759_1000362 | 3300025256 | Bacteria | 58080 |
| 89 | Ga0209759_1013248 | 3300025256 | Bacteria | 2242 |
| 90 | Ga0209233_1000173 | 3300025261 | Bacteria | 145995 |
| 91 | Ga0209565_1000066 | 3300025263 | Bacteria | 173062 |
| 92 | Ga0209455_1000125 | 3300025272 | Bacteria | 166819 |
| 93 | Ga0209455_1000244 | 3300025272 | Bacteria | 67136 |
| 94 | Ga0209673_1000098 | 3300025273 | Bacteria | 193352 |
| 95 | Ga0209673_1034546 | 3300025273 | Bacteria | 1526 |
| 96 | Ga0209675_1000084 | 3300025291 | Bacteria | 152066 |
| 97 | Ga0209675_1001045 | 3300025291 | Bacteria | 17234 |
| 98 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 99 | Ga0209025_1000365 | 3300025294 | Bacteria | 95783 |
| 100 | Ga0209025_1000437 | 3300025294 | Bacteria | 82190 |
| 101 | Ga0209025_1002968 | 3300025294 | Bacteria | 16847 |
| 102 | Ga0209564_1000539 | 3300025295 | Bacteria | 61208 |
| 103 | Ga0209564_1000901 | 3300025295 | Bacteria | 38935 |
| 104 | Ga0209564_1002826 | 3300025295 | Bacteria | 12866 |
| 105 | Ga0209564_1011630 | 3300025295 | Bacteria | 3922 |
| 106 | Ga0209256_1000331 | 3300025299 | Bacteria | 79942 |
| 107 | Ga0207426_1000199 | 3300025302 | Bacteria | 145826 |
| 108 | Ga0209051_1000110 | 3300025303 | Bacteria | 153230 |
| 109 | Ga0209051_1016489 | 3300025303 | Bacteria | 3339 |
| 110 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 111 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 112 | Ga0207647_10055119 | 3300025904 | Bacteria | 2444 |
| 113 | Ga0207647_10077683 | 3300025904 | Bacteria | 1995 |
| 114 | Ga0207695_10003429 | 3300025913 | Bacteria | 22375 |
| 115 | Ga0207695_10005064 | 3300025913 | Bacteria | 17675 |
| 116 | Ga0207695_10169741 | 3300025913 | Bacteria | 2108 |
| 117 | Ga0207671_10001495 | 3300025914 | Bacteria | 26983 |
| 118 | Ga0207693_10027472 | 3300025915 | Bacteria | 4498 |
| 119 | Ga0207657_10017935 | 3300025919 | Bacteria | 6773 |
| 120 | Ga0207694_10000176 | 3300025924 | Bacteria | 66165 |
| 121 | Ga0207690_10002863 | 3300025932 | Bacteria | 10392 |
| 122 | Ga0207706_10014854 | 3300025933 | Bacteria | 7050 |
| 123 | Ga0207709_10013137 | 3300025935 | Bacteria | 4567 |
| 124 | Ga0207689_10092952 | 3300025942 | Bacteria | 2478 |
| 125 | Ga0207667_10017312 | 3300025949 | Bacteria | 8116 |
| 126 | Ga0207678_10001691 | 3300026067 | Bacteria | 20214 |
| 127 | Ga0207648_10000142 | 3300026089 | Bacteria | 71593 |
| 128 | Ga0207698_10024832 | 3300026142 | Bacteria | 4212 |
| 129 | Ga0209371_1000575 | 3300027312 | Bacteria | 33050 |
| 130 | Ga0209371_1001567 | 3300027312 | Bacteria | 15036 |
| 131 | Ga0209282_1000035 | 3300027666 | Bacteria | 137066 |
| 132 | Ga0209974_10000306 | 3300027876 | Bacteria | 15939 |
| 133 | Ga0268266_10012109 | 3300028379 | Bacteria | 7465 |
| 134 | Ga0307515_10000022 | 3300028794 | Bacteria | 404064 |
| 135 | Ga0307515_10000191 | 3300028794 | Bacteria | 149201 |
| 136 | Ga0307515_10025661 | 3300028794 | Bacteria | 10184 |
| 137 | Ga0307515_10058388 | 3300028794 | Bacteria | 5557 |
| 138 | Ga0268256_1000875 | 3300030500 | Bacteria | 20997 |
| 139 | Ga0268256_1001343 | 3300030500 | Bacteria | 15036 |
| 140 | Ga0307513_10026755 | 3300031456 | Bacteria | 6638 |
| 141 | Ga0307509_10057726 | 3300031507 | Bacteria | 4114 |
| 142 | Ga0307408_100003563 | 3300031548 | Bacteria | 10608 |
| 143 | Ga0307508_10000017 | 3300031616 | Bacteria | 203567 |
| 144 | Ga0307516_10036093 | 3300031730 | Bacteria | 4951 |
| 145 | Ga0307405_10036191 | 3300031731 | Bacteria | 2955 |
| 146 | Ga0307412_10000056 | 3300031911 | Bacteria | 145861 |
| 147 | Ga0307409_100200170 | 3300031995 | Bacteria | 1786 |
| 148 | Ga0307416_100009684 | 3300032002 | Bacteria | 6326 |
| 149 | Ga0307414_10035859 | 3300032004 | Bacteria | 3305 |
| 150 | Ga0395899_0001564 | 3300037312 | Bacteria | 19269 |
| 151 | Ga0395899_0003106 | 3300037312 | Bacteria | 13222 |
| 152 | Ga0395899_0012064 | 3300037312 | Bacteria | 6620 |
| 153 | Ga0395899_0012534 | 3300037312 | Bacteria | 6498 |
| 154 | Ga0395900_0008097 | 3300037418 | Bacteria | 10820 |
| 155 | Ga0395900_0011209 | 3300037418 | Bacteria | 9167 |
| 156 | Ga0395900_0013558 | 3300037418 | Bacteria | 8326 |
| 157 | Ga0395900_0052641 | 3300037418 | Bacteria | 4190 |
| 158 | Ga0395900_0064536 | 3300037418 | Bacteria | 3762 |
| 159 | Ga0395900_0154753 | 3300037418 | Bacteria | 2342 |
| 160 | Ga0395900_0276116 | 3300037418 | Bacteria | 1674 |
| 161 | Ga0395898_0031295 | 3300037466 | Bacteria | 5318 |
| 162 | Ga0395905_0002605 | 3300037471 | Bacteria | 19856 |
| 163 | Ga0395905_0009528 | 3300037471 | Bacteria | 9487 |
| 164 | Ga0395905_0023360 | 3300037471 | Bacteria | 5844 |
| 165 | Ga0395905_0033634 | 3300037471 | Bacteria | 4814 |
| 166 | Ga0395905_0081051 | 3300037471 | Bacteria | 3041 |
| 167 | Ga0395905_0087621 | 3300037471 | Bacteria | 2918 |
| 168 | Ga0395901_0002522 | 3300038443 | Bacteria | 18545 |
| 169 | Ga0395901_0003709 | 3300038443 | Bacteria | 15400 |
| 170 | Ga0436361_0037196 | 3300039447 | Bacteria | 2587 |
| 171 | Ga0439436_0015587 | 3300041404 | Bacteria | 2285 |
| 172 | Ga0439436_0026500 | 3300041404 | Bacteria | 1699 |
| 173 | Ga0439449_0002251 | 3300042007 | Bacteria | 7586 |
| 174 | Ga0439462_0003530 | 3300042015 | Bacteria | 3756 |
| 175 | Ga0450911_001137 | 3300042115 | Bacteria | 6577 |
| 176 | Ga0450912_000284 | 3300042116 | Bacteria | 2285 |
| 177 | Ga0450898_000983 | 3300042134 | Bacteria | 3595 |
| 178 | Ga0450898_001580 | 3300042134 | Bacteria | 3039 |
| 179 | Ga0439446_0004830 | 3300042156 | Bacteria | 3436 |
| 180 | Ga0439434_0008896 | 3300042435 | Bacteria | 2951 |
| 181 | Ga0439435_0035206 | 3300042436 | Bacteria | 1380 |
| 182 | Ga0439464_0008229 | 3300042439 | Bacteria | 2733 |
| 183 | Ga0450893_0004321 | 3300042532 | Bacteria | 2264 |
| 184 | Ga0451577_0113064 | 3300042876 | Bacteria | 2430 |
| 185 | Ga0466972_0000285 | 3300044658 | Bacteria | 31510 |
| 186 | Ga0466972_0000508 | 3300044658 | Bacteria | 19348 |
| 187 | Ga0453683_0001993 | 3300044673 | Bacteria | 16524 |
| 188 | Ga0466965_0000473 | 3300044683 | Bacteria | 14207 |
| 189 | Ga0466964_0001829 | 3300044706 | Bacteria | 7406 |
| 190 | Ga0466968_0001709 | 3300044735 | Bacteria | 7910 |
| 191 | Ga0466970_0061413 | 3300044765 | Bacteria | 2013 |
| 192 | Ga0466959_0005993 | 3300045049 | Bacteria | 8388 |
| 193 | Ga0451576_0082807 | 3300045051 | Bacteria | 3337 |
| 194 | Ga0466967_0094770 | 3300045976 | Bacteria | 2719 |
| 195 | Ga0495592_0121385 | 3300046454 | Bacteria | 1838 |
| 196 | Ga0495603_0000734 | 3300046455 | Bacteria | 18663 |
| 197 | Ga0495603_0003264 | 3300046455 | Bacteria | 9656 |
| 198 | Ga0495603_0124045 | 3300046455 | Bacteria | 1505 |
| 199 | Ga0495590_0001899 | 3300046457 | Bacteria | 8843 |
| 200 | Ga0495590_0004680 | 3300046457 | Bacteria | 5488 |
| 201 | Ga0495590_0023900 | 3300046457 | Bacteria | 2155 |
| 202 | Ga0495591_001305 | 3300046458 | Bacteria | 15753 |
| 203 | Ga0495629_0000162 | 3300046459 | Bacteria | 58860 |
| 204 | Ga0495629_0001379 | 3300046459 | Bacteria | 19148 |
| 205 | Ga0495629_0030147 | 3300046459 | Bacteria | 3846 |
| 206 | Ga0495638_0014949 | 3300046460 | Bacteria | 5227 |
| 207 | Ga0495641_0010319 | 3300046461 | Bacteria | 5422 |
| 208 | Ga0495651_0049019 | 3300046462 | Bacteria | 3261 |
| 209 | Ga0495651_0065939 | 3300046462 | Bacteria | 2764 |
| 210 | Ga0495651_0069576 | 3300046462 | Bacteria | 2680 |
| 211 | Ga0495653_0001542 | 3300046463 | Bacteria | 17981 |
| 212 | Ga0495653_0001687 | 3300046463 | Bacteria | 17383 |
| 213 | Ga0495653_0046313 | 3300046463 | Bacteria | 3368 |
| 214 | Ga0495650_0044361 | 3300046471 | Bacteria | 1880 |
| 215 | Ga0495580_0001709 | 3300046472 | Bacteria | 19286 |
| 216 | Ga0495580_0002400 | 3300046472 | Bacteria | 16370 |
| 217 | Ga0495580_0014280 | 3300046472 | Bacteria | 6025 |
| 218 | Ga0495580_0016881 | 3300046472 | Bacteria | 5472 |
| 219 | Ga0495580_0046826 | 3300046472 | Bacteria | 3067 |
| 220 | Ga0495580_0066304 | 3300046472 | Bacteria | 2527 |
| 221 | Ga0495582_0002198 | 3300046473 | Bacteria | 10919 |
| 222 | Ga0495582_0011445 | 3300046473 | Bacteria | 4887 |
| 223 | Ga0495582_0012580 | 3300046473 | Bacteria | 4665 |
| 224 | Ga0495605_0003171 | 3300046474 | Bacteria | 9884 |
| 225 | Ga0495605_0010333 | 3300046474 | Bacteria | 5226 |
| 226 | Ga0495605_0010922 | 3300046474 | Bacteria | 5073 |
| 227 | Ga0495605_0033489 | 3300046474 | Bacteria | 2607 |
| 228 | Ga0495662_0010139 | 3300046476 | Bacteria | 4619 |
| 229 | Ga0495664_0001070 | 3300046477 | Bacteria | 14161 |
| 230 | Ga0495664_0064029 | 3300046477 | Bacteria | 2191 |
| 231 | Ga0495664_0080578 | 3300046477 | Bacteria | 1951 |
| 232 | Ga0495596_0001163 | 3300046500 | Bacteria | 15424 |
| 233 | Ga0495596_0001951 | 3300046500 | Bacteria | 11391 |
| 234 | Ga0495596_0006023 | 3300046500 | Bacteria | 5657 |
| 235 | Ga0495607_0025059 | 3300046501 | Bacteria | 3714 |
| 236 | Ga0495583_0049756 | 3300046506 | Bacteria | 1917 |
| 237 | Ga0495606_0014872 | 3300046507 | Bacteria | 6042 |
| 238 | Ga0495608_0003857 | 3300046511 | Bacteria | 10774 |
| 239 | Ga0495608_0026341 | 3300046511 | Bacteria | 3965 |
| 240 | Ga0495610_0003726 | 3300046512 | Bacteria | 11667 |
| 241 | Ga0495610_0004088 | 3300046512 | Bacteria | 10938 |
| 242 | Ga0495616_0002965 | 3300046513 | Bacteria | 11024 |
| 243 | Ga0495618_0002471 | 3300046514 | Bacteria | 11863 |
| 244 | Ga0495618_0004161 | 3300046514 | Bacteria | 8931 |
| 245 | Ga0495618_0091420 | 3300046514 | Bacteria | 1945 |
| 246 | Ga0495628_0003612 | 3300046516 | Bacteria | 13836 |
| 247 | Ga0495628_0039403 | 3300046516 | Bacteria | 3779 |
| 248 | Ga0495628_0062856 | 3300046516 | Bacteria | 2909 |
| 249 | Ga0495628_0071348 | 3300046516 | Bacteria | 2707 |
| 250 | Ga0495630_0033931 | 3300046517 | Bacteria | 3807 |
| 251 | Ga0495630_0058295 | 3300046517 | Bacteria | 2894 |
| 252 | Ga0495630_0132741 | 3300046517 | Bacteria | 1891 |
| 253 | Ga0495630_0223823 | 3300046517 | Bacteria | 1436 |
| 254 | Ga0495632_0007474 | 3300046519 | Bacteria | 6857 |
| 255 | Ga0495643_0042666 | 3300046522 | Bacteria | 2471 |
| 256 | Ga0495643_0105249 | 3300046522 | Bacteria | 1441 |
| 257 | Ga0495648_0004162 | 3300046524 | Bacteria | 12440 |
| 258 | Ga0495648_0055208 | 3300046524 | Bacteria | 2395 |
| 259 | Ga0495666_0001360 | 3300046526 | Bacteria | 11853 |
| 260 | Ga0495666_0022087 | 3300046526 | Bacteria | 3152 |
| 261 | Ga0495652_0018699 | 3300046529 | Bacteria | 6176 |
| 262 | Ga0495652_0025160 | 3300046529 | Bacteria | 5270 |
| 263 | Ga0495652_0135087 | 3300046529 | Bacteria | 1947 |
| 264 | Ga0495665_0003493 | 3300046531 | Bacteria | 8530 |
| 265 | Ga0495665_0007415 | 3300046531 | Bacteria | 5930 |
| 266 | Ga0495665_0030535 | 3300046531 | Bacteria | 2884 |
| 267 | Ga0495640_0003238 | 3300046533 | Bacteria | 13099 |
| 268 | Ga0495640_0008301 | 3300046533 | Bacteria | 8142 |
| 269 | Ga0495640_0034329 | 3300046533 | Bacteria | 3598 |
| 270 | Ga0495586_0002228 | 3300046535 | Bacteria | 10537 |
| 271 | Ga0495587_0000463 | 3300046536 | Bacteria | 28424 |
| 272 | Ga0495587_0049249 | 3300046536 | Bacteria | 2494 |
| 273 | Ga0495587_0091958 | 3300046536 | Bacteria | 1752 |
| 274 | Ga0495609_0002440 | 3300046538 | Bacteria | 11434 |
| 275 | Ga0495597_0012347 | 3300046542 | Bacteria | 4122 |
| 276 | Ga0495645_0025548 | 3300046543 | Bacteria | 4287 |
| 277 | Ga0495622_0000349 | 3300046557 | Bacteria | 32902 |
| 278 | Ga0495634_0062712 | 3300046642 | Bacteria | 2468 |
| 279 | Ga0495611_0041593 | 3300046648 | Bacteria | 2050 |
| 280 | Ga0495625_0005094 | 3300046660 | Bacteria | 12158 |
| 281 | Ga0495635_0002193 | 3300046663 | Bacteria | 13283 |
| 282 | Ga0495635_0004444 | 3300046663 | Bacteria | 9714 |
| 283 | Ga0495661_0007612 | 3300046665 | Bacteria | 7547 |
| 284 | Ga0495661_0017318 | 3300046665 | Bacteria | 4760 |
| 285 | Ga0495657_0055655 | 3300046675 | Bacteria | 2638 |
| 286 | Ga0495599_0002788 | 3300046678 | Bacteria | 10186 |
| 287 | Ga0495599_0007738 | 3300046678 | Bacteria | 6522 |
| 288 | Ga0495599_0009016 | 3300046678 | Bacteria | 6078 |
| 289 | Ga0495599_0085588 | 3300046678 | Bacteria | 1969 |
| 290 | Ga0495599_0108642 | 3300046678 | Bacteria | 1728 |
| 291 | Ga0495623_0004772 | 3300046679 | Bacteria | 8905 |
| 292 | Ga0495623_0035512 | 3300046679 | Bacteria | 3194 |
| 293 | Ga0495646_0002044 | 3300046680 | Bacteria | 12233 |
| 294 | Ga0495646_0002817 | 3300046680 | Bacteria | 10764 |
| 295 | Ga0495646_0021344 | 3300046680 | Bacteria | 4092 |
| 296 | Ga0495613_0001086 | 3300046689 | Bacteria | 20760 |
| 297 | Ga0495613_0013650 | 3300046689 | Bacteria | 6027 |
| 298 | Ga0495624_0002939 | 3300046690 | Bacteria | 12754 |
| 299 | Ga0495624_0009490 | 3300046690 | Bacteria | 6739 |
| 300 | Ga0495624_0018705 | 3300046690 | Bacteria | 4631 |
| 301 | Ga0495624_0024364 | 3300046690 | Bacteria | 3982 |
| 302 | Ga0495671_0003485 | 3300046692 | Bacteria | 9651 |
| 303 | Ga0495649_0003524 | 3300046694 | Bacteria | 10529 |
| 304 | Ga0495649_0007972 | 3300046694 | Bacteria | 6405 |
| 305 | Ga0495649_0027318 | 3300046694 | Bacteria | 3167 |
| 306 | Ga0495649_0113134 | 3300046694 | Bacteria | 1438 |
| 307 | Ga0495589_0011814 | 3300046794 | Bacteria | 4532 |
| 308 | Ga0495589_0051191 | 3300046794 | Bacteria | 2042 |
| 309 | Ga0495600_0002282 | 3300046809 | Bacteria | 10932 |
| 310 | Ga0495581_0001139 | 3300047315 | Bacteria | 14552 |
| 311 | Ga0495581_0004859 | 3300047315 | Bacteria | 7777 |
| 312 | Ga0495581_0051999 | 3300047315 | Bacteria | 2366 |
| 313 | Ga0495604_0010632 | 3300047317 | Bacteria | 7298 |
| 314 | Ga0495604_0028746 | 3300047317 | Bacteria | 4423 |
| 315 | Ga0495604_0057275 | 3300047317 | Bacteria | 2996 |
| 316 | Ga0495604_0088750 | 3300047317 | Bacteria | 2299 |
| 317 | Ga0495674_0020747 | 3300047319 | Bacteria | 6083 |
| 318 | Ga0495674_0025864 | 3300047319 | Bacteria | 5373 |
| 319 | Ga0495674_0043644 | 3300047319 | Bacteria | 3990 |
| 320 | Ga0495672_0031806 | 3300047320 | Bacteria | 3291 |
| 321 | Ga0495672_0076739 | 3300047320 | Bacteria | 1875 |
| 322 | Ga0495676_0014085 | 3300047321 | Bacteria | 7159 |
| 323 | Ga0495676_0019564 | 3300047321 | Bacteria | 5954 |
| 324 | Ga0495676_0063101 | 3300047321 | Bacteria | 2890 |
| 325 | Ga0495680_0002154 | 3300047322 | Bacteria | 20419 |
| 326 | Ga0495680_0033806 | 3300047322 | Bacteria | 4137 |
| 327 | Ga0495683_0003086 | 3300047323 | Bacteria | 9769 |
| 328 | Ga0495683_0010632 | 3300047323 | Bacteria | 4856 |
| 329 | Ga0495683_0014922 | 3300047323 | Bacteria | 4046 |
| 330 | Ga0495683_0059779 | 3300047323 | Bacteria | 1890 |
| 331 | Ga0495687_013771 | 3300047443 | Bacteria | 4199 |
| 332 | Ga0495687_036743 | 3300047443 | Bacteria | 2188 |
| 333 | Ga0495687_069939 | 3300047443 | Bacteria | 1411 |
| 334 | Ga0495675_0011029 | 3300047444 | Bacteria | 5665 |
| 335 | Ga0495679_000617 | 3300047446 | Bacteria | 24016 |
| 336 | Ga0495679_000750 | 3300047446 | Bacteria | 20735 |
| 337 | Ga0495679_006448 | 3300047446 | Bacteria | 5045 |
| 338 | Ga0495673_0029863 | 3300047469 | Bacteria | 2568 |
| 339 | Ga0495673_0036738 | 3300047469 | Bacteria | 2243 |
| 340 | Ga0495684_0035145 | 3300047471 | Bacteria | 3845 |
| 341 | Ga0495593_0003694 | 3300047673 | Bacteria | 9139 |
| 342 | Ga0495593_0032068 | 3300047673 | Bacteria | 2866 |
| 343 | Ga0495602_0015150 | 3300048088 | Bacteria | 7791 |
| 344 | Ga0495602_0019599 | 3300048088 | Bacteria | 6711 |
| 345 | Ga0495602_0020786 | 3300048088 | Bacteria | 6477 |
| 346 | Ga0495614_0005364 | 3300048089 | Bacteria | 5785 |
| 347 | Ga0495626_0034692 | 3300048091 | Bacteria | 2412 |
| 348 | Ga0495626_0039379 | 3300048091 | Bacteria | 2237 |
| 349 | Ga0496101_0007655 | 3300048904 | Bacteria | 7012 |
| 350 | Ga0496102_0013902 | 3300048905 | Bacteria | 6983 |
| 351 | Ga0496102_0017849 | 3300048905 | Bacteria | 6222 |
| 352 | Ga0496103_0001492 | 3300048906 | Bacteria | 15642 |
| 353 | Ga0496103_0030670 | 3300048906 | Bacteria | 3273 |
| 354 | Ga0496105_0141476 | 3300048908 | Bacteria | 1980 |
| 355 | Ga0496106_0000162 | 3300048909 | Bacteria | 48305 |
| 356 | Ga0496112_0200104 | 3300048915 | Bacteria | 1957 |
| 357 | Ga0496113_0166456 | 3300048916 | Bacteria | 1744 |
| 358 | Ga0496116_0082271 | 3300048919 | Bacteria | 1992 |
| 359 | Ga0496117_0007541 | 3300048920 | Bacteria | 10603 |
| 360 | Ga0496117_0096328 | 3300048920 | Bacteria | 1888 |
| 361 | Ga0496118_0008687 | 3300048921 | Bacteria | 10440 |
| 362 | Ga0496118_0017211 | 3300048921 | Bacteria | 6590 |
| 363 | Ga0496119_0050867 | 3300048922 | Bacteria | 2550 |
| 364 | Ga0496121_0006767 | 3300048924 | Bacteria | 14066 |
| 365 | Ga0496121_0009882 | 3300048924 | Bacteria | 10873 |
| 366 | Ga0496121_0018436 | 3300048924 | Bacteria | 7037 |
| 367 | Ga0496121_0022736 | 3300048924 | Bacteria | 6067 |
| 368 | Ga0496121_0047118 | 3300048924 | Bacteria | 3681 |
| 369 | Ga0496121_0065386 | 3300048924 | Bacteria | 2959 |
| 370 | Ga0496121_0087006 | 3300048924 | Bacteria | 2454 |
| 371 | Ga0496122_0003093 | 3300048925 | Bacteria | 22367 |
| 372 | Ga0496123_0002770 | 3300048926 | Bacteria | 20934 |
| 373 | Ga0496124_0152719 | 3300048927 | Bacteria | 1809 |
| 374 | Ga0496125_0012086 | 3300048928 | Bacteria | 8591 |
| 375 | Ga0496125_0034876 | 3300048928 | Bacteria | 4426 |
| 376 | Ga0496126_0004713 | 3300048929 | Bacteria | 16102 |
| 377 | Ga0496126_0004910 | 3300048929 | Bacteria | 15611 |
| 378 | Ga0495682_0051860 | 3300049460 | Bacteria | 1491 |
| 379 | Ga0501043_0000141 | 3300049579 | Bacteria | 67326 |
| 380 | Ga0501046_0000047 | 3300049580 | Bacteria | 140344 |
| 381 | Ga0501047_0000058 | 3300049581 | Bacteria | 139202 |
| 382 | Ga0501047_0070809 | 3300049581 | Bacteria | 3357 |
| 383 | Ga0501047_0166089 | 3300049581 | Bacteria | 2078 |
| 384 | Ga0501048_0000475 | 3300049582 | Bacteria | 28030 |
| 385 | Ga0501263_001653 | 3300049760 | Bacteria | 2147 |
| 386 | Ga0501035_0110313 | 3300049822 | Bacteria | 2411 |
| 387 | Ga0501044_0017880 | 3300049823 | Bacteria | 7605 |
| 388 | Ga0501044_0078280 | 3300049823 | Bacteria | 3351 |
| 389 | Ga0501045_0074856 | 3300049824 | Bacteria | 2493 |
| 390 | nmdc:mga07m45_5769_c1 | 3300050496 | Bacteria | 6199 |
| 391 | Ga0500578_0018907 | 3300053086 | Bacteria | 4423 |
| 392 | Ga0500658_0040856 | 3300053134 | Bacteria | 1859 |
| 393 | Ga0466962_0107799 | 3300061719 | Bacteria | 1340 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041404 | Ga0439436_0026500 | Ga0439436_0026500_588_1685 | 344 |
| 2 | 3300044765 | Ga0466970_0061413 | Ga0466970_0061413_206_1273 | 354 |
| 3 | 3300045049 | Ga0466959_0005993 | Ga0466959_0005993_4052_5119 | 354 |
| 4 | 3300009176 | Ga0105242_10343589 | Ga0105242_103435892 | 360 |
| 5 | 3300046511 | Ga0495608_0026341 | Ga0495608_0026341_2867_3955 | 362 |
| 6 | 3300046517 | Ga0495630_0132741 | Ga0495630_0132741_34_1122 | 362 |
| 7 | 3300046522 | Ga0495643_0105249 | Ga0495643_0105249_287_1402 | 362 |
| 8 | 3300048927 | Ga0496124_0152719 | Ga0496124_0152719_704_1792 | 362 |
| 9 | 3300041404 | Ga0439436_0015587 | Ga0439436_0015587_387_1640 | 369 |
| 10 | 3300031730 | Ga0307516_10036093 | Ga0307516_100360933 | 383 |
| 11 | 3300048915 | Ga0496112_0200104 | Ga0496112_0200104_690_1895 | 391 |
| 12 | 3300003320 | rootH2_10129063 | rootH2_101290632 | 392 |
| 13 | 3300003758 | Ga0055532_1001763 | Ga0055532_10017633 | 392 |
| 14 | 3300003761 | Ga0055535_1001431 | Ga0055535_10014318 | 392 |
| 15 | 3300003762 | Ga0055542_1001129 | Ga0055542_100112913 | 392 |
| 16 | 3300003763 | Ga0055529_1000948 | Ga0055529_10009485 | 392 |
| 17 | 3300003856 | Ga0058692_1000904 | Ga0058692_10009044 | 392 |
| 18 | 3300025228 | Ga0209672_100054 | Ga0209672_100054185 | 392 |
| 19 | 3300025229 | Ga0209147_100085 | Ga0209147_1000855 | 392 |
| 20 | 3300025242 | Ga0209258_100168 | Ga0209258_1001684 | 392 |
| 21 | 3300025254 | Ga0209148_1000119 | Ga0209148_100011961 | 392 |
| 22 | 3300025272 | Ga0209455_1000244 | Ga0209455_100024461 | 392 |
| 23 | 3300027312 | Ga0209371_1000575 | Ga0209371_10005755 | 392 |
| 24 | 3300030500 | Ga0268256_1000875 | Ga0268256_10008755 | 392 |
| 25 | 3300028794 | Ga0307515_10000022 | Ga0307515_10000022255 | 393 |
| 26 | 3300028794 | Ga0307515_10000191 | Ga0307515_1000019130 | 393 |
| 27 | 3300049581 | Ga0501047_0070809 | Ga0501047_0070809_331_1602 | 393 |
| 28 | 3300003794 | Ga0055531_10001824 | Ga0055531_1000182414 | 394 |
| 29 | 3300005563 | Ga0068855_100088646 | Ga0068855_1000886462 | 394 |
| 30 | 3300005614 | Ga0068856_100158849 | Ga0068856_1001588492 | 394 |
| 31 | 3300006038 | Ga0075365_10071070 | Ga0075365_100710702 | 394 |
| 32 | 3300009174 | Ga0105241_10254407 | Ga0105241_102544071 | 394 |
| 33 | 3300010375 | Ga0105239_10181241 | Ga0105239_101812412 | 394 |
| 34 | 3300025303 | Ga0209051_1000110 | Ga0209051_1000110124 | 394 |
| 35 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012877 | 394 |
| 36 | 3300025304 | Ga0209257_1000045 | Ga0209257_1000045283 | 394 |
| 37 | 3300031731 | Ga0307405_10036191 | Ga0307405_100361912 | 394 |
| 38 | 3300037312 | Ga0395899_0001564 | Ga0395899_0001564_5538_6812 | 394 |
| 39 | 3300037312 | Ga0395899_0012064 | Ga0395899_0012064_2410_3684 | 394 |
| 40 | 3300037418 | Ga0395900_0011209 | Ga0395900_0011209_7362_8639 | 394 |
| 41 | 3300037418 | Ga0395900_0013558 | Ga0395900_0013558_2051_3325 | 394 |
| 42 | 3300037418 | Ga0395900_0064536 | Ga0395900_0064536_1533_2807 | 394 |
| 43 | 3300037418 | Ga0395900_0154753 | Ga0395900_0154753_944_2218 | 394 |
| 44 | 3300037418 | Ga0395900_0276116 | Ga0395900_0276116_264_1538 | 394 |
| 45 | 3300037466 | Ga0395898_0031295 | Ga0395898_0031295_356_1630 | 394 |
| 46 | 3300037471 | Ga0395905_0009528 | Ga0395905_0009528_2413_3687 | 394 |
| 47 | 3300037471 | Ga0395905_0033634 | Ga0395905_0033634_2519_3793 | 394 |
| 48 | 3300037471 | Ga0395905_0081051 | Ga0395905_0081051_671_1948 | 394 |
| 49 | 3300037471 | Ga0395905_0087621 | Ga0395905_0087621_1025_2299 | 394 |
| 50 | 3300042007 | Ga0439449_0002251 | Ga0439449_0002251_4656_5930 | 394 |
| 51 | 3300042015 | Ga0439462_0003530 | Ga0439462_0003530_368_1642 | 394 |
| 52 | 3300042115 | Ga0450911_001137 | Ga0450911_001137_2621_3871 | 394 |
| 53 | 3300042116 | Ga0450912_000284 | Ga0450912_000284_495_1769 | 394 |
| 54 | 3300042134 | Ga0450898_000983 | Ga0450898_000983_2075_3349 | 394 |
| 55 | 3300042134 | Ga0450898_001580 | Ga0450898_001580_1559_2842 | 394 |
| 56 | 3300042156 | Ga0439446_0004830 | Ga0439446_0004830_1862_3136 | 394 |
| 57 | 3300042435 | Ga0439434_0008896 | Ga0439434_0008896_152_1426 | 394 |
| 58 | 3300042436 | Ga0439435_0035206 | Ga0439435_0035206_67_1341 | 394 |
| 59 | 3300042439 | Ga0439464_0008229 | Ga0439464_0008229_1344_2618 | 394 |
| 60 | 3300042532 | Ga0450893_0004321 | Ga0450893_0004321_200_1474 | 394 |
| 61 | 3300042876 | Ga0451577_0113064 | Ga0451577_0113064_348_1622 | 394 |
| 62 | 3300044673 | Ga0453683_0001993 | Ga0453683_0001993_14167_15441 | 394 |
| 63 | 3300045051 | Ga0451576_0082807 | Ga0451576_0082807_1338_2612 | 394 |
| 64 | 3300045976 | Ga0466967_0094770 | Ga0466967_0094770_383_1660 | 394 |
| 65 | 3300048924 | Ga0496121_0009882 | Ga0496121_0009882_9092_10342 | 394 |
| 66 | 3300048928 | Ga0496125_0012086 | Ga0496125_0012086_1382_2632 | 394 |
| 67 | 3300048928 | Ga0496125_0034876 | Ga0496125_0034876_546_1796 | 394 |
| 68 | 3300049760 | Ga0501263_001653 | Ga0501263_001653_855_2129 | 394 |
| 69 | 3300006195 | Ga0075366_10030306 | Ga0075366_100303062 | 395 |
| 70 | 3300028794 | Ga0307515_10025661 | Ga0307515_100256612 | 395 |
| 71 | 3300005457 | Ga0070662_100044313 | Ga0070662_1000443132 | 397 |
| 72 | 3300025933 | Ga0207706_10014854 | Ga0207706_100148544 | 397 |
| 73 | 3300005563 | Ga0068855_100010176 | Ga0068855_1000101766 | 399 |
| 74 | 3300009093 | Ga0105240_10005791 | Ga0105240_1000579111 | 399 |
| 75 | 3300009545 | Ga0105237_10003275 | Ga0105237_100032758 | 399 |
| 76 | 3300009551 | Ga0105238_10000102 | Ga0105238_1000010251 | 399 |
| 77 | 3300010375 | Ga0105239_10001547 | Ga0105239_1000154714 | 399 |
| 78 | 3300025913 | Ga0207695_10003429 | Ga0207695_100034298 | 399 |
| 79 | 3300025914 | Ga0207671_10001495 | Ga0207671_1000149516 | 399 |
| 80 | 3300025924 | Ga0207694_10000176 | Ga0207694_1000017645 | 399 |
| 81 | 3300025949 | Ga0207667_10017312 | Ga0207667_100173126 | 399 |
| 82 | 3300031616 | Ga0307508_10000017 | Ga0307508_10000017174 | 402 |
| 83 | 3300005337 | Ga0070682_100051202 | Ga0070682_1000512022 | 404 |
| 84 | 3300005339 | Ga0070660_100010032 | Ga0070660_1000100322 | 404 |
| 85 | 3300005366 | Ga0070659_100006676 | Ga0070659_1000066765 | 404 |
| 86 | 3300006353 | Ga0075370_10001010 | Ga0075370_1000101012 | 404 |
| 87 | 3300025915 | Ga0207693_10027472 | Ga0207693_100274724 | 404 |
| 88 | 3300025919 | Ga0207657_10017935 | Ga0207657_100179354 | 404 |
| 89 | 3300025932 | Ga0207690_10002863 | Ga0207690_100028632 | 404 |
| 90 | 3300037312 | Ga0395899_0003106 | Ga0395899_0003106_7210_8463 | 404 |
| 91 | 3300037312 | Ga0395899_0012534 | Ga0395899_0012534_4338_5591 | 404 |
| 92 | 3300037418 | Ga0395900_0008097 | Ga0395900_0008097_9269_10522 | 404 |
| 93 | 3300037418 | Ga0395900_0052641 | Ga0395900_0052641_2715_3968 | 404 |
| 94 | 3300037471 | Ga0395905_0002605 | Ga0395905_0002605_11881_13134 | 404 |
| 95 | 3300038443 | Ga0395901_0002522 | Ga0395901_0002522_6940_8172 | 404 |
| 96 | 3300038443 | Ga0395901_0003709 | Ga0395901_0003709_5845_7098 | 404 |
| 97 | 3300044658 | Ga0466972_0000285 | Ga0466972_0000285_19093_20337 | 404 |
| 98 | 3300044683 | Ga0466965_0000473 | Ga0466965_0000473_9135_10379 | 404 |
| 99 | 3300044706 | Ga0466964_0001829 | Ga0466964_0001829_331_1575 | 404 |
| 100 | 3300044735 | Ga0466968_0001709 | Ga0466968_0001709_3632_4876 | 404 |
| 101 | 3300049823 | Ga0501044_0078280 | Ga0501044_0078280_796_2049 | 404 |
| 102 | 3300050496 | nmdc:mga07m45_5769_c1 | nmdc:mga07m45_5769_c1_3388_4650 | 404 |
| 103 | 3300039447 | Ga0436361_0037196 | Ga0436361_0037196_1144_2391 | 405 |
| 104 | 3300044658 | Ga0466972_0000508 | Ga0466972_0000508_610_1947 | 406 |
| 105 | 3300003187 | JGI25151J46595_10001148 | JGI25151J46595_100011489 | 407 |
| 106 | 3300003187 | JGI25151J46595_10001220 | JGI25151J46595_100012206 | 407 |
| 107 | 3300003771 | Ga0055526_1002549 | Ga0055526_10025494 | 407 |
| 108 | 3300003771 | Ga0055526_1002553 | Ga0055526_10025537 | 407 |
| 109 | 3300003775 | Ga0055524_1000401 | Ga0055524_100040113 | 407 |
| 110 | 3300003781 | Ga0055536_1000365 | Ga0055536_100036523 | 407 |
| 111 | 3300003784 | Ga0055534_1001121 | Ga0055534_10011217 | 407 |
| 112 | 3300006948 | Ga0099826_10000004 | Ga0099826_10000004186 | 407 |
| 113 | 3300025263 | Ga0209565_1000066 | Ga0209565_100006694 | 407 |
| 114 | 3300025273 | Ga0209673_1034546 | Ga0209673_10345461 | 407 |
| 115 | 3300025291 | Ga0209675_1000084 | Ga0209675_1000084106 | 407 |
| 116 | 3300025291 | Ga0209675_1001045 | Ga0209675_10010458 | 407 |
| 117 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014401 | 407 |
| 118 | 3300025294 | Ga0209025_1000365 | Ga0209025_100036561 | 407 |
| 119 | 3300025294 | Ga0209025_1000437 | Ga0209025_100043729 | 407 |
| 120 | 3300025294 | Ga0209025_1002968 | Ga0209025_10029684 | 407 |
| 121 | 3300025295 | Ga0209564_1000539 | Ga0209564_100053941 | 407 |
| 122 | 3300025295 | Ga0209564_1000901 | Ga0209564_10009017 | 407 |
| 123 | 3300025295 | Ga0209564_1002826 | Ga0209564_10028264 | 407 |
| 124 | 3300025299 | Ga0209256_1000331 | Ga0209256_100033169 | 407 |
| 125 | 3300025303 | Ga0209051_1016489 | Ga0209051_10164891 | 407 |
| 126 | 3300027666 | Ga0209282_1000035 | Ga0209282_100003585 | 407 |
| 127 | 3300028794 | Ga0307515_10058388 | Ga0307515_100583883 | 407 |
| 128 | 3300031456 | Ga0307513_10026755 | Ga0307513_100267553 | 407 |
| 129 | 3300031507 | Ga0307509_10057726 | Ga0307509_100577262 | 407 |
| 130 | 3300032004 | Ga0307414_10035859 | Ga0307414_100358592 | 407 |
| 131 | 3300046474 | Ga0495605_0003171 | Ga0495605_0003171_7737_9029 | 407 |
| 132 | 3300046500 | Ga0495596_0001951 | Ga0495596_0001951_9437_10729 | 407 |
| 133 | 3300046501 | Ga0495607_0025059 | Ga0495607_0025059_2099_3391 | 407 |
| 134 | 3300046512 | Ga0495610_0003726 | Ga0495610_0003726_713_2005 | 407 |
| 135 | 3300046513 | Ga0495616_0002965 | Ga0495616_0002965_609_1901 | 407 |
| 136 | 3300046519 | Ga0495632_0007474 | Ga0495632_0007474_199_1536 | 407 |
| 137 | 3300046522 | Ga0495643_0042666 | Ga0495643_0042666_309_1601 | 407 |
| 138 | 3300046538 | Ga0495609_0002440 | Ga0495609_0002440_9494_10786 | 407 |
| 139 | 3300046542 | Ga0495597_0012347 | Ga0495597_0012347_262_1554 | 407 |
| 140 | 3300046648 | Ga0495611_0041593 | Ga0495611_0041593_281_1573 | 407 |
| 141 | 3300046660 | Ga0495625_0005094 | Ga0495625_0005094_8960_10297 | 407 |
| 142 | 3300046665 | Ga0495661_0017318 | Ga0495661_0017318_2899_4191 | 407 |
| 143 | 3300046692 | Ga0495671_0003485 | Ga0495671_0003485_7603_8895 | 407 |
| 144 | 3300046694 | Ga0495649_0003524 | Ga0495649_0003524_660_1952 | 407 |
| 145 | 3300047320 | Ga0495672_0031806 | Ga0495672_0031806_307_1599 | 407 |
| 146 | 3300048919 | Ga0496116_0082271 | Ga0496116_0082271_580_1872 | 407 |
| 147 | 3300048924 | Ga0496121_0047118 | Ga0496121_0047118_193_1485 | 407 |
| 148 | 3300048925 | Ga0496122_0003093 | Ga0496122_0003093_11087_12379 | 407 |
| 149 | 3300048926 | Ga0496123_0002770 | Ga0496123_0002770_9331_10623 | 407 |
| 150 | 3300053134 | Ga0500658_0040856 | Ga0500658_0040856_117_1454 | 407 |
| 151 | iso_pu_bacteria | 2513237150 | 2513956863 | 407 |
| 152 | iso_pu_bacteria | 2513237165 | 2514043393 | 407 |
| 153 | iso_pu_bacteria | 2585428062 | 2587755156 | 407 |
| 154 | iso_pu_bacteria | 2834641062 | 2834642025 | 407 |
| 155 | iso_pu_bacteria | 644736347 | 644747751 | 407 |
| 156 | iso_pu_bacteria | 8003400568 | 8003404433 | 407 |
| 157 | 3300003322 | rootL2_10146905 | rootL2_101469052 | 408 |
| 158 | 3300027876 | Ga0209974_10000306 | Ga0209974_100003062 | 408 |
| 159 | iso_pu_bacteria | 2513237151 | 2513962631 | 408 |
| 160 | iso_pu_bacteria | 2904439833 | 2904442367 | 408 |
| 161 | iso_pu_bacteria | 2919046199 | 2919050618 | 408 |
| 162 | 3300005548 | Ga0070665_100028557 | Ga0070665_1000285572 | 409 |
| 163 | 3300009098 | Ga0105245_10286709 | Ga0105245_102867092 | 409 |
| 164 | 3300014968 | Ga0157379_10078911 | Ga0157379_100789112 | 409 |
| 165 | 3300025942 | Ga0207689_10092952 | Ga0207689_100929522 | 409 |
| 166 | 3300028379 | Ga0268266_10012109 | Ga0268266_100121093 | 409 |
| 167 | 3300049581 | Ga0501047_0166089 | Ga0501047_0166089_698_1966 | 409 |
| 168 | 3300049822 | Ga0501035_0110313 | Ga0501035_0110313_667_1935 | 409 |
| 169 | 3300049823 | Ga0501044_0017880 | Ga0501044_0017880_1440_2708 | 409 |
| 170 | 3300003214 | JGI25165J46597_1002446 | JGI25165J46597_10024463 | 410 |
| 171 | 3300003758 | Ga0055532_1000092 | Ga0055532_10000923 | 410 |
| 172 | 3300003760 | Ga0055527_1000035 | Ga0055527_100003541 | 410 |
| 173 | 3300003761 | Ga0055535_1000050 | Ga0055535_100005041 | 410 |
| 174 | 3300003762 | Ga0055542_1000120 | Ga0055542_10001203 | 410 |
| 175 | 3300003763 | Ga0055529_1000089 | Ga0055529_100008941 | 410 |
| 176 | 3300005455 | Ga0070663_100000524 | Ga0070663_1000005246 | 410 |
| 177 | 3300005459 | Ga0068867_100000175 | Ga0068867_10000017533 | 410 |
| 178 | 3300005616 | Ga0068852_100007222 | Ga0068852_1000072226 | 410 |
| 179 | 3300009148 | Ga0105243_10000770 | Ga0105243_1000077015 | 410 |
| 180 | 3300014745 | Ga0157377_10000014 | Ga0157377_10000014187 | 410 |
| 181 | 3300025228 | Ga0209672_100073 | Ga0209672_100073106 | 410 |
| 182 | 3300025229 | Ga0209147_100093 | Ga0209147_100093106 | 410 |
| 183 | 3300025231 | Ga0207427_101047 | Ga0207427_1010477 | 410 |
| 184 | 3300025242 | Ga0209258_100140 | Ga0209258_100140106 | 410 |
| 185 | 3300025254 | Ga0209148_1000140 | Ga0209148_1000140107 | 410 |
| 186 | 3300025261 | Ga0209233_1000173 | Ga0209233_1000173106 | 410 |
| 187 | 3300025272 | Ga0209455_1000125 | Ga0209455_1000125107 | 410 |
| 188 | 3300025935 | Ga0207709_10013137 | Ga0207709_100131374 | 410 |
| 189 | 3300026067 | Ga0207678_10001691 | Ga0207678_1000169114 | 410 |
| 190 | 3300026089 | Ga0207648_10000142 | Ga0207648_1000014236 | 410 |
| 191 | 3300026142 | Ga0207698_10024832 | Ga0207698_100248322 | 410 |
| 192 | 3300037471 | Ga0395905_0023360 | Ga0395905_0023360_3237_4583 | 410 |
| 193 | 3300049579 | Ga0501043_0000141 | Ga0501043_0000141_18707_20053 | 410 |
| 194 | 3300049580 | Ga0501046_0000047 | Ga0501046_0000047_40719_42065 | 410 |
| 195 | 3300049581 | Ga0501047_0000058 | Ga0501047_0000058_98682_100028 | 410 |
| 196 | 3300049582 | Ga0501048_0000475 | Ga0501048_0000475_12533_13879 | 410 |
| 197 | 3300049824 | Ga0501045_0074856 | Ga0501045_0074856_916_2262 | 410 |
| 198 | 3300053086 | Ga0500578_0018907 | Ga0500578_0018907_1799_3145 | 410 |
| 199 | 3300016635 | Ga0183361_10015 | Ga0183361_1001575 | 411 |
| 200 | 3300001979 | JGI24740J21852_10001324 | JGI24740J21852_100013246 | 412 |
| 201 | 3300001990 | JGI24737J22298_10020367 | JGI24737J22298_100203672 | 412 |
| 202 | 3300002067 | JGI24735J21928_10000155 | JGI24735J21928_100001554 | 412 |
| 203 | 3300002067 | JGI24735J21928_10001750 | JGI24735J21928_100017506 | 412 |
| 204 | 3300002705 | JGI25156J39149_1000418 | JGI25156J39149_100041819 | 412 |
| 205 | 3300002705 | JGI25156J39149_1001488 | JGI25156J39149_10014883 | 412 |
| 206 | 3300002705 | JGI25156J39149_1005143 | JGI25156J39149_10051432 | 412 |
| 207 | 3300003320 | rootH2_10079005 | rootH2_100790053 | 412 |
| 208 | 3300003323 | rootH1_10196331 | rootH1_101963313 | 412 |
| 209 | 3300003354 | JGI25160J50197_1001789 | JGI25160J50197_100178910 | 412 |
| 210 | 3300003756 | Ga0055533_1000529 | Ga0055533_10005295 | 412 |
| 211 | 3300003756 | Ga0055533_1003739 | Ga0055533_10037392 | 412 |
| 212 | 3300003758 | Ga0055532_1001701 | Ga0055532_10017014 | 412 |
| 213 | 3300003790 | Ga0055528_1011117 | Ga0055528_10111173 | 412 |
| 214 | 3300005262 | Ga0065165_1003668 | Ga0065165_10036682 | 412 |
| 215 | 3300005563 | Ga0068855_100134814 | Ga0068855_1001348142 | 412 |
| 216 | 3300009011 | Ga0105251_10049577 | Ga0105251_100495772 | 412 |
| 217 | 3300009093 | Ga0105240_10021398 | Ga0105240_100213985 | 412 |
| 218 | 3300009093 | Ga0105240_10042020 | Ga0105240_100420202 | 412 |
| 219 | 3300009093 | Ga0105240_10166384 | Ga0105240_101663842 | 412 |
| 220 | 3300013105 | Ga0157369_10019485 | Ga0157369_100194855 | 412 |
| 221 | 3300015262 | Ga0182007_10012347 | Ga0182007_100123473 | 412 |
| 222 | 3300025225 | Ga0209566_100312 | Ga0209566_10031217 | 412 |
| 223 | 3300025226 | Ga0209674_100153 | Ga0209674_10015365 | 412 |
| 224 | 3300025226 | Ga0209674_100272 | Ga0209674_1002726 | 412 |
| 225 | 3300025226 | Ga0209674_102953 | Ga0209674_1029533 | 412 |
| 226 | 3300025229 | Ga0209147_100832 | Ga0209147_10083210 | 412 |
| 227 | 3300025230 | Ga0209563_101295 | Ga0209563_1012953 | 412 |
| 228 | 3300025256 | Ga0209759_1000281 | Ga0209759_100028147 | 412 |
| 229 | 3300025256 | Ga0209759_1000329 | Ga0209759_10003294 | 412 |
| 230 | 3300025256 | Ga0209759_1000362 | Ga0209759_100036219 | 412 |
| 231 | 3300025256 | Ga0209759_1013248 | Ga0209759_10132482 | 412 |
| 232 | 3300025273 | Ga0209673_1000098 | Ga0209673_1000098141 | 412 |
| 233 | 3300025295 | Ga0209564_1011630 | Ga0209564_10116302 | 412 |
| 234 | 3300025302 | Ga0207426_1000199 | Ga0207426_100019949 | 412 |
| 235 | 3300025904 | Ga0207647_10055119 | Ga0207647_100551192 | 412 |
| 236 | 3300025904 | Ga0207647_10077683 | Ga0207647_100776831 | 412 |
| 237 | 3300025913 | Ga0207695_10005064 | Ga0207695_1000506416 | 412 |
| 238 | 3300025913 | Ga0207695_10169741 | Ga0207695_101697412 | 412 |
| 239 | 3300027312 | Ga0209371_1001567 | Ga0209371_10015673 | 412 |
| 240 | 3300030500 | Ga0268256_1001343 | Ga0268256_10013433 | 412 |
| 241 | 3300031548 | Ga0307408_100003563 | Ga0307408_1000035633 | 412 |
| 242 | 3300031911 | Ga0307412_10000056 | Ga0307412_1000005656 | 412 |
| 243 | 3300031995 | Ga0307409_100200170 | Ga0307409_1002001702 | 412 |
| 244 | 3300032002 | Ga0307416_100009684 | Ga0307416_1000096842 | 412 |
| 245 | 3300046454 | Ga0495592_0121385 | Ga0495592_0121385_304_1569 | 412 |
| 246 | 3300046455 | Ga0495603_0000734 | Ga0495603_0000734_17018_18283 | 412 |
| 247 | 3300046455 | Ga0495603_0003264 | Ga0495603_0003264_50_1318 | 412 |
| 248 | 3300046455 | Ga0495603_0124045 | Ga0495603_0124045_25_1290 | 412 |
| 249 | 3300046457 | Ga0495590_0001899 | Ga0495590_0001899_1722_3014 | 412 |
| 250 | 3300046457 | Ga0495590_0004680 | Ga0495590_0004680_958_2232 | 412 |
| 251 | 3300046457 | Ga0495590_0023900 | Ga0495590_0023900_540_1808 | 412 |
| 252 | 3300046458 | Ga0495591_001305 | Ga0495591_001305_11381_12646 | 412 |
| 253 | 3300046459 | Ga0495629_0000162 | Ga0495629_0000162_55360_56634 | 412 |
| 254 | 3300046459 | Ga0495629_0001379 | Ga0495629_0001379_15891_17183 | 412 |
| 255 | 3300046459 | Ga0495629_0030147 | Ga0495629_0030147_867_2132 | 412 |
| 256 | 3300046460 | Ga0495638_0014949 | Ga0495638_0014949_3877_5151 | 412 |
| 257 | 3300046461 | Ga0495641_0010319 | Ga0495641_0010319_2924_4189 | 412 |
| 258 | 3300046462 | Ga0495651_0049019 | Ga0495651_0049019_406_1680 | 412 |
| 259 | 3300046462 | Ga0495651_0065939 | Ga0495651_0065939_55_1320 | 412 |
| 260 | 3300046462 | Ga0495651_0069576 | Ga0495651_0069576_648_1922 | 412 |
| 261 | 3300046463 | Ga0495653_0001542 | Ga0495653_0001542_16397_17662 | 412 |
| 262 | 3300046463 | Ga0495653_0001687 | Ga0495653_0001687_4835_6109 | 412 |
| 263 | 3300046463 | Ga0495653_0046313 | Ga0495653_0046313_1090_2355 | 412 |
| 264 | 3300046471 | Ga0495650_0044361 | Ga0495650_0044361_545_1810 | 412 |
| 265 | 3300046472 | Ga0495580_0001709 | Ga0495580_0001709_2717_3982 | 412 |
| 266 | 3300046472 | Ga0495580_0002400 | Ga0495580_0002400_1479_2753 | 412 |
| 267 | 3300046472 | Ga0495580_0014280 | Ga0495580_0014280_3980_5251 | 412 |
| 268 | 3300046472 | Ga0495580_0016881 | Ga0495580_0016881_659_1933 | 412 |
| 269 | 3300046472 | Ga0495580_0046826 | Ga0495580_0046826_753_2018 | 412 |
| 270 | 3300046472 | Ga0495580_0066304 | Ga0495580_0066304_277_1545 | 412 |
| 271 | 3300046473 | Ga0495582_0002198 | Ga0495582_0002198_751_2016 | 412 |
| 272 | 3300046473 | Ga0495582_0011445 | Ga0495582_0011445_1070_2341 | 412 |
| 273 | 3300046473 | Ga0495582_0012580 | Ga0495582_0012580_194_1486 | 412 |
| 274 | 3300046474 | Ga0495605_0010333 | Ga0495605_0010333_908_2173 | 412 |
| 275 | 3300046474 | Ga0495605_0010922 | Ga0495605_0010922_2188_3462 | 412 |
| 276 | 3300046474 | Ga0495605_0033489 | Ga0495605_0033489_558_1826 | 412 |
| 277 | 3300046476 | Ga0495662_0010139 | Ga0495662_0010139_529_1794 | 412 |
| 278 | 3300046477 | Ga0495664_0001070 | Ga0495664_0001070_11113_12378 | 412 |
| 279 | 3300046477 | Ga0495664_0064029 | Ga0495664_0064029_145_1437 | 412 |
| 280 | 3300046477 | Ga0495664_0080578 | Ga0495664_0080578_15_1280 | 412 |
| 281 | 3300046500 | Ga0495596_0001163 | Ga0495596_0001163_11454_12719 | 412 |
| 282 | 3300046500 | Ga0495596_0006023 | Ga0495596_0006023_3213_4478 | 412 |
| 283 | 3300046506 | Ga0495583_0049756 | Ga0495583_0049756_505_1773 | 412 |
| 284 | 3300046507 | Ga0495606_0014872 | Ga0495606_0014872_3478_4770 | 412 |
| 285 | 3300046511 | Ga0495608_0003857 | Ga0495608_0003857_6451_7743 | 412 |
| 286 | 3300046512 | Ga0495610_0004088 | Ga0495610_0004088_6686_7951 | 412 |
| 287 | 3300046514 | Ga0495618_0002471 | Ga0495618_0002471_5878_7143 | 412 |
| 288 | 3300046514 | Ga0495618_0004161 | Ga0495618_0004161_3546_4838 | 412 |
| 289 | 3300046514 | Ga0495618_0091420 | Ga0495618_0091420_94_1359 | 412 |
| 290 | 3300046516 | Ga0495628_0003612 | Ga0495628_0003612_3125_4390 | 412 |
| 291 | 3300046516 | Ga0495628_0039403 | Ga0495628_0039403_1709_3001 | 412 |
| 292 | 3300046516 | Ga0495628_0062856 | Ga0495628_0062856_748_2022 | 412 |
| 293 | 3300046516 | Ga0495628_0071348 | Ga0495628_0071348_1278_2552 | 412 |
| 294 | 3300046517 | Ga0495630_0033931 | Ga0495630_0033931_457_1728 | 412 |
| 295 | 3300046517 | Ga0495630_0058295 | Ga0495630_0058295_1175_2440 | 412 |
| 296 | 3300046517 | Ga0495630_0223823 | Ga0495630_0223823_94_1386 | 412 |
| 297 | 3300046524 | Ga0495648_0004162 | Ga0495648_0004162_11041_12306 | 412 |
| 298 | 3300046524 | Ga0495648_0055208 | Ga0495648_0055208_251_1525 | 412 |
| 299 | 3300046526 | Ga0495666_0001360 | Ga0495666_0001360_1376_2641 | 412 |
| 300 | 3300046526 | Ga0495666_0022087 | Ga0495666_0022087_1067_2341 | 412 |
| 301 | 3300046529 | Ga0495652_0018699 | Ga0495652_0018699_3176_4468 | 412 |
| 302 | 3300046529 | Ga0495652_0025160 | Ga0495652_0025160_1717_2982 | 412 |
| 303 | 3300046529 | Ga0495652_0135087 | Ga0495652_0135087_253_1527 | 412 |
| 304 | 3300046531 | Ga0495665_0003493 | Ga0495665_0003493_4516_5808 | 412 |
| 305 | 3300046531 | Ga0495665_0007415 | Ga0495665_0007415_173_1438 | 412 |
| 306 | 3300046531 | Ga0495665_0030535 | Ga0495665_0030535_1557_2822 | 412 |
| 307 | 3300046533 | Ga0495640_0003238 | Ga0495640_0003238_278_1543 | 412 |
| 308 | 3300046533 | Ga0495640_0008301 | Ga0495640_0008301_3420_4712 | 412 |
| 309 | 3300046533 | Ga0495640_0034329 | Ga0495640_0034329_1715_2980 | 412 |
| 310 | 3300046535 | Ga0495586_0002228 | Ga0495586_0002228_9262_10527 | 412 |
| 311 | 3300046536 | Ga0495587_0000463 | Ga0495587_0000463_23989_25254 | 412 |
| 312 | 3300046536 | Ga0495587_0049249 | Ga0495587_0049249_562_1827 | 412 |
| 313 | 3300046536 | Ga0495587_0091958 | Ga0495587_0091958_403_1677 | 412 |
| 314 | 3300046543 | Ga0495645_0025548 | Ga0495645_0025548_2670_3935 | 412 |
| 315 | 3300046557 | Ga0495622_0000349 | Ga0495622_0000349_4827_6092 | 412 |
| 316 | 3300046642 | Ga0495634_0062712 | Ga0495634_0062712_427_1692 | 412 |
| 317 | 3300046663 | Ga0495635_0002193 | Ga0495635_0002193_6539_7831 | 412 |
| 318 | 3300046663 | Ga0495635_0004444 | Ga0495635_0004444_179_1444 | 412 |
| 319 | 3300046665 | Ga0495661_0007612 | Ga0495661_0007612_4826_6091 | 412 |
| 320 | 3300046675 | Ga0495657_0055655 | Ga0495657_0055655_128_1420 | 412 |
| 321 | 3300046678 | Ga0495599_0002788 | Ga0495599_0002788_1155_2420 | 412 |
| 322 | 3300046678 | Ga0495599_0007738 | Ga0495599_0007738_1822_3096 | 412 |
| 323 | 3300046678 | Ga0495599_0009016 | Ga0495599_0009016_553_1827 | 412 |
| 324 | 3300046678 | Ga0495599_0085588 | Ga0495599_0085588_464_1756 | 412 |
| 325 | 3300046678 | Ga0495599_0108642 | Ga0495599_0108642_303_1568 | 412 |
| 326 | 3300046679 | Ga0495623_0004772 | Ga0495623_0004772_1709_3001 | 412 |
| 327 | 3300046679 | Ga0495623_0035512 | Ga0495623_0035512_1381_2655 | 412 |
| 328 | 3300046680 | Ga0495646_0002044 | Ga0495646_0002044_6175_7467 | 412 |
| 329 | 3300046680 | Ga0495646_0002817 | Ga0495646_0002817_8927_10192 | 412 |
| 330 | 3300046680 | Ga0495646_0021344 | Ga0495646_0021344_616_1890 | 412 |
| 331 | 3300046689 | Ga0495613_0001086 | Ga0495613_0001086_137_1402 | 412 |
| 332 | 3300046689 | Ga0495613_0013650 | Ga0495613_0013650_408_1673 | 412 |
| 333 | 3300046690 | Ga0495624_0002939 | Ga0495624_0002939_9220_10485 | 412 |
| 334 | 3300046690 | Ga0495624_0009490 | Ga0495624_0009490_1870_3144 | 412 |
| 335 | 3300046690 | Ga0495624_0018705 | Ga0495624_0018705_1034_2305 | 412 |
| 336 | 3300046690 | Ga0495624_0024364 | Ga0495624_0024364_999_2273 | 412 |
| 337 | 3300046694 | Ga0495649_0007972 | Ga0495649_0007972_2165_3457 | 412 |
| 338 | 3300046694 | Ga0495649_0027318 | Ga0495649_0027318_923_2251 | 412 |
| 339 | 3300046694 | Ga0495649_0113134 | Ga0495649_0113134_37_1311 | 412 |
| 340 | 3300046794 | Ga0495589_0011814 | Ga0495589_0011814_2822_4087 | 412 |
| 341 | 3300046794 | Ga0495589_0051191 | Ga0495589_0051191_518_1783 | 412 |
| 342 | 3300046809 | Ga0495600_0002282 | Ga0495600_0002282_3012_4304 | 412 |
| 343 | 3300047315 | Ga0495581_0001139 | Ga0495581_0001139_4777_6042 | 412 |
| 344 | 3300047315 | Ga0495581_0004859 | Ga0495581_0004859_3066_4358 | 412 |
| 345 | 3300047315 | Ga0495581_0051999 | Ga0495581_0051999_632_1897 | 412 |
| 346 | 3300047317 | Ga0495604_0010632 | Ga0495604_0010632_1242_2507 | 412 |
| 347 | 3300047317 | Ga0495604_0028746 | Ga0495604_0028746_2572_3846 | 412 |
| 348 | 3300047317 | Ga0495604_0057275 | Ga0495604_0057275_1334_2608 | 412 |
| 349 | 3300047317 | Ga0495604_0088750 | Ga0495604_0088750_305_1597 | 412 |
| 350 | 3300047319 | Ga0495674_0020747 | Ga0495674_0020747_3460_4725 | 412 |
| 351 | 3300047319 | Ga0495674_0025864 | Ga0495674_0025864_935_2206 | 412 |
| 352 | 3300047319 | Ga0495674_0043644 | Ga0495674_0043644_1829_3094 | 412 |
| 353 | 3300047320 | Ga0495672_0076739 | Ga0495672_0076739_535_1803 | 412 |
| 354 | 3300047321 | Ga0495676_0014085 | Ga0495676_0014085_1167_2432 | 412 |
| 355 | 3300047321 | Ga0495676_0019564 | Ga0495676_0019564_4326_5591 | 412 |
| 356 | 3300047321 | Ga0495676_0063101 | Ga0495676_0063101_862_2136 | 412 |
| 357 | 3300047322 | Ga0495680_0002154 | Ga0495680_0002154_14281_15546 | 412 |
| 358 | 3300047322 | Ga0495680_0033806 | Ga0495680_0033806_2536_3810 | 412 |
| 359 | 3300047323 | Ga0495683_0003086 | Ga0495683_0003086_4923_6215 | 412 |
| 360 | 3300047323 | Ga0495683_0010632 | Ga0495683_0010632_1765_3039 | 412 |
| 361 | 3300047323 | Ga0495683_0014922 | Ga0495683_0014922_129_1394 | 412 |
| 362 | 3300047323 | Ga0495683_0059779 | Ga0495683_0059779_603_1868 | 412 |
| 363 | 3300047443 | Ga0495687_013771 | Ga0495687_013771_2790_4055 | 412 |
| 364 | 3300047443 | Ga0495687_036743 | Ga0495687_036743_763_2031 | 412 |
| 365 | 3300047443 | Ga0495687_069939 | Ga0495687_069939_98_1390 | 412 |
| 366 | 3300047444 | Ga0495675_0011029 | Ga0495675_0011029_541_1899 | 412 |
| 367 | 3300047446 | Ga0495679_000617 | Ga0495679_000617_574_1839 | 412 |
| 368 | 3300047446 | Ga0495679_000750 | Ga0495679_000750_16506_17780 | 412 |
| 369 | 3300047446 | Ga0495679_006448 | Ga0495679_006448_793_2058 | 412 |
| 370 | 3300047469 | Ga0495673_0029863 | Ga0495673_0029863_157_1422 | 412 |
| 371 | 3300047469 | Ga0495673_0036738 | Ga0495673_0036738_80_1354 | 412 |
| 372 | 3300047471 | Ga0495684_0035145 | Ga0495684_0035145_1141_2406 | 412 |
| 373 | 3300047673 | Ga0495593_0003694 | Ga0495593_0003694_671_1945 | 412 |
| 374 | 3300047673 | Ga0495593_0032068 | Ga0495593_0032068_559_1824 | 412 |
| 375 | 3300048088 | Ga0495602_0015150 | Ga0495602_0015150_754_2019 | 412 |
| 376 | 3300048088 | Ga0495602_0019599 | Ga0495602_0019599_1136_2410 | 412 |
| 377 | 3300048088 | Ga0495602_0020786 | Ga0495602_0020786_381_1646 | 412 |
| 378 | 3300048089 | Ga0495614_0005364 | Ga0495614_0005364_3142_4407 | 412 |
| 379 | 3300048091 | Ga0495626_0034692 | Ga0495626_0034692_1005_2270 | 412 |
| 380 | 3300048091 | Ga0495626_0039379 | Ga0495626_0039379_368_1660 | 412 |
| 381 | 3300048904 | Ga0496101_0007655 | Ga0496101_0007655_4405_5673 | 412 |
| 382 | 3300048905 | Ga0496102_0013902 | Ga0496102_0013902_4404_5672 | 412 |
| 383 | 3300048905 | Ga0496102_0017849 | Ga0496102_0017849_154_1419 | 412 |
| 384 | 3300048906 | Ga0496103_0001492 | Ga0496103_0001492_13425_14693 | 412 |
| 385 | 3300048906 | Ga0496103_0030670 | Ga0496103_0030670_528_1793 | 412 |
| 386 | 3300048908 | Ga0496105_0141476 | Ga0496105_0141476_533_1801 | 412 |
| 387 | 3300048909 | Ga0496106_0000162 | Ga0496106_0000162_42426_43691 | 412 |
| 388 | 3300048916 | Ga0496113_0166456 | Ga0496113_0166456_419_1687 | 412 |
| 389 | 3300048920 | Ga0496117_0007541 | Ga0496117_0007541_8023_9288 | 412 |
| 390 | 3300048920 | Ga0496117_0096328 | Ga0496117_0096328_210_1475 | 412 |
| 391 | 3300048921 | Ga0496118_0008687 | Ga0496118_0008687_8327_9595 | 412 |
| 392 | 3300048921 | Ga0496118_0017211 | Ga0496118_0017211_1612_2877 | 412 |
| 393 | 3300048922 | Ga0496119_0050867 | Ga0496119_0050867_173_1441 | 412 |
| 394 | 3300048924 | Ga0496121_0006767 | Ga0496121_0006767_7801_9066 | 412 |
| 395 | 3300048924 | Ga0496121_0018436 | Ga0496121_0018436_3343_4608 | 412 |
| 396 | 3300048924 | Ga0496121_0022736 | Ga0496121_0022736_4414_5682 | 412 |
| 397 | 3300048924 | Ga0496121_0065386 | Ga0496121_0065386_744_2012 | 412 |
| 398 | 3300048924 | Ga0496121_0087006 | Ga0496121_0087006_497_1771 | 412 |
| 399 | 3300048929 | Ga0496126_0004713 | Ga0496126_0004713_9213_10478 | 412 |
| 400 | 3300048929 | Ga0496126_0004910 | Ga0496126_0004910_3098_4372 | 412 |
| 401 | 3300049460 | Ga0495682_0051860 | Ga0495682_0051860_155_1429 | 412 |
| 402 | 3300061719 | Ga0466962_0107799 | Ga0466962_0107799_20_1312 | 412 |
| 403 | iso_pu_bacteria | 2501025502 | 2501084082 | 412 |
| 404 | iso_pu_bacteria | 2501025504 | 2501414392 | 412 |
| 405 | iso_pu_bacteria | 2508501125 | 2509130812 | 412 |
| 406 | iso_pu_bacteria | 2510917013 | 2511093365 | 412 |
| 407 | iso_pu_bacteria | 2510917014 | 2511099815 | 412 |
| 408 | iso_pu_bacteria | 2510917015 | 2511102414 | 412 |
| 409 | iso_pu_bacteria | 2512047030 | 2512348407 | 412 |
| 410 | iso_pu_bacteria | 2515154189 | 2516022267 | 412 |
| 411 | iso_pu_bacteria | 2526164713 | 2527080622 | 412 |
| 412 | iso_pu_bacteria | 2562617112 | 2563061559 | 412 |
| 413 | iso_pu_bacteria | 2599185239 | 2599741082 | 412 |
| 414 | iso_pu_bacteria | 2599185240 | 2599748389 | 412 |
| 415 | iso_pu_bacteria | 2599185355 | 2600210301 | 412 |
| 416 | iso_pu_bacteria | 2675903129 | 2676745774 | 412 |
| 417 | iso_pu_bacteria | 2711768613 | 2713478576 | 412 |
| 418 | iso_pu_bacteria | 2738541296 | 2738823994 | 412 |
| 419 | iso_pu_bacteria | 2738541298 | 2738836385 | 412 |
| 420 | iso_pu_bacteria | 2738541306 | 2738877915 | 412 |
| 421 | iso_pu_bacteria | 2738543002 | 2739189621 | 412 |
| 422 | iso_pu_bacteria | 2738543008 | 2739224508 | 412 |
| 423 | iso_pu_bacteria | 2744054900 | 2746087259 | 412 |
| 424 | iso_pu_bacteria | 2744054901 | 2746093234 | 412 |
| 425 | iso_pu_bacteria | 2818991452 | 2819636838 | 412 |
| 426 | iso_pu_bacteria | 2842324504 | 2842332154 | 412 |
| 427 | iso_pu_bacteria | 2842348783 | 2842356394 | 412 |
| 428 | iso_pu_bacteria | 2842454564 | 2842461252 | 412 |
| 429 | iso_pu_bacteria | 2856287931 | 2856289370 | 412 |
| 430 | iso_pu_bacteria | 2857357740 | 2857362243 | 412 |
| 431 | iso_pu_bacteria | 2863421361 | 2863426457 | 412 |
| 432 | iso_pu_bacteria | 2870068957 | 2870069363 | 412 |
| 433 | iso_pu_bacteria | 2883087390 | 2883091401 | 412 |
| 434 | iso_pu_bacteria | 2885270888 | 2885272393 | 412 |
| 435 | iso_pu_bacteria | 2900634093 | 2900637102 | 412 |
| 436 | iso_pu_bacteria | 2904483920 | 2904490149 | 412 |
| 437 | iso_pu_bacteria | 2904564687 | 2904569378 | 412 |
| 438 | iso_pu_bacteria | 2904571731 | 2904576785 | 412 |
| 439 | iso_pu_bacteria | 2919527303 | 2919533318 | 412 |
| 440 | iso_pu_bacteria | 2928170801 | 2928176295 | 412 |
| 441 | iso_pu_bacteria | 2928536128 | 2928542055 | 412 |
| 442 | iso_pu_bacteria | 2945934425 | 2945934533 | 412 |
| 443 | iso_pu_bacteria | 2990703756 | 2990704908 | 412 |
| 444 | iso_pu_bacteria | 641736151 | 642426572 | 412 |
| 445 | iso_pu_bacteria | 642555113 | 642623169 | 412 |
| 446 | iso_pu_bacteria | 8018845410 | 8018847968 | 412 |
| 447 | iso_pu_bacteria | 8020938398 | 8020939007 | 412 |
| 448 | iso_pu_bacteria | 8020945358 | 8020947723 | 412 |
| 449 | iso_pu_bacteria | 8020953355 | 8020953446 | 412 |
| 450 | iso_pu_bacteria | 8021120328 | 8021127552 | 412 |
| 451 | iso_pu_bacteria | 8039098773 | 8039099702 | 412 |
| 452 | iso_pu_bacteria | 8055301274 | 8055307381 | 412 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oc4-assembly1.cif.gz_A | crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 | 0.8815 | 198 | 246 |
| 3oc4-assembly1.cif.gz_B | crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 | 0.875 | 198 | 246 |
| 3itj-assembly2.cif.gz_C | crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) | 0.8746 | 203 | 239 |
| 7cyx-assembly1.cif.gz_A | crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 | 0.8518 | 2 | 395 |
| 4ysh-assembly1.cif.gz_A | crystal structure of glycine oxidase from geobacillus kaustophilus | 0.8485 | 2 | 406 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ykgA03 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8803 | 192 | 236 | 3.50.50.60 |
| 3ctyB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8711 | 193 | 245 | 3.50.50.60 |
| af_P96261_93_276_3.30.9.10 | Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 | 0.869 | 126 | 332 | 3.30.9.10 |
| 3gsiA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8641 | 184 | 406 | 3.50.50.60 |
| 3e1tA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8639 | 188 | 246 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839A0Z1-F1-model_v4 | deleted | 0.9677 | 2 | 398 |
|
| AF-A0A6N9SSC0-F1-model_v4 | FAD-dependent oxidoreductase | 0.9669 | 2 | 398 |
GO:0005737
GO:0005886 GO:0008718 GO:0055130 |
| AF-A4SNB0-F1-model_v4 | D-amino acid dehydrogenase (EC 1.4.99.-) | 0.9661 | 2 | 407 |
GO:0005737
GO:0005886 GO:0008718 GO:0055130 |
| AF-A0A8B3G9I7-F1-model_v4 | deleted | 0.9658 | 237 | 409 |
|
| AF-A0A847DWZ4-F1-model_v4 | D-amino acid dehydrogenase | 0.9654 | 2 | 408 |
GO:0005737
GO:0005886 GO:0008718 GO:0055130 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar