F447050

General Info

Members Datasets Scaffolds Average Seq Length
452 274 452 149

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0050495|Ga0495628_0050495_202_750
Length 182
Sequence MEYSEAERQRGAIRRLAGSGLAHSVWDILATPGAKAMRAVVQRVSRASVEIDGESVGSIGAGLVVLLGVTHDDTADKAKWLAEKIVGLRIFNDADVKMNRDLTEVGGAMLIVSQFTLYGDCRKGKRPSFIDAAPPPIAIPLYEAFINGVKALGIPVATGRFGADMKVELINDGPVTLIVESK

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
185 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
186 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
187 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
241 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
242 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
243 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
244 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
245 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
251 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
252 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
253 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
254 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 1.55
Rhizosphere 94.25
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10311999 3300005289 Bacteria 867
2 Ga0065707_10006581 3300005295 Bacteria 4315
3 Ga0070676_10008758 3300005328 Bacteria 5461
4 Ga0070670_100025936 3300005331 Bacteria 5043
5 Ga0070670_100046891 3300005331 Bacteria 3717
6 Ga0070670_100187157 3300005331 Bacteria 1798
7 Ga0070670_100450081 3300005331 Bacteria 1141
8 Ga0068869_100017195 3300005334 Bacteria 4896
9 Ga0070666_10045707 3300005335 Bacteria 2935
10 Ga0068868_100701615 3300005338 Bacteria 905
11 Ga0070660_100043284 3300005339 Bacteria 3441
12 Ga0070689_100079681 3300005340 Bacteria 2569
13 Ga0070687_100010350 3300005343 Bacteria 4031
14 Ga0070687_100021899 3300005343 Bacteria 3013
15 Ga0070661_100000724 3300005344 Bacteria 24118
16 Ga0070661_100343890 3300005344 Bacteria 1169
17 Ga0070661_100600434 3300005344 Bacteria 890
18 Ga0070692_10001371 3300005345 Bacteria 8794
19 Ga0070668_100000182 3300005347 Bacteria 40680
20 Ga0070668_100214254 3300005347 Bacteria 1586
21 Ga0070668_100313867 3300005347 Bacteria 1318
22 Ga0070669_100026730 3300005353 Bacteria 4152
23 Ga0070669_100324249 3300005353 Bacteria 1244
24 Ga0070671_100781160 3300005355 Bacteria 831
25 Ga0070673_100133537 3300005364 Bacteria 2086
26 Ga0070688_100040021 3300005365 Bacteria 2871
27 Ga0070688_100066368 3300005365 Bacteria 2296
28 Ga0070667_100025028 3300005367 Bacteria 4960
29 Ga0070709_10037792 3300005434 Bacteria 2951
30 Ga0070709_10187972 3300005434 Bacteria 1455
31 Ga0070714_100018598 3300005435 Bacteria 5648
32 Ga0070714_101792930 3300005435 Unclassified 599
33 Ga0070713_100004065 3300005436 Bacteria 9738
34 Ga0070710_10039803 3300005437 Bacteria 2588
35 Ga0070701_10038473 3300005438 Bacteria 2421
36 Ga0070701_10856628 3300005438 Bacteria 624
37 Ga0070711_100002710 3300005439 Bacteria 10161
38 Ga0070711_100363650 3300005439 Bacteria 1166
39 Ga0070711_100479566 3300005439 Bacteria 1022
40 Ga0070705_100365669 3300005440 Bacteria 1057
41 Ga0070700_100017031 3300005441 Bacteria 4150
42 Ga0070700_100297188 3300005441 Bacteria 1177
43 Ga0070700_101558411 3300005441 Bacteria 563
44 Ga0070694_100011220 3300005444 Bacteria 5548
45 Ga0070694_100229779 3300005444 Bacteria 1395
46 Ga0070708_100077595 3300005445 Bacteria 3002
47 Ga0070708_100415978 3300005445 Unclassified 1268
48 Ga0070708_100669903 3300005445 Bacteria 977
49 Ga0070663_100006609 3300005455 Bacteria 6990
50 Ga0070663_100196524 3300005455 Bacteria 1572
51 Ga0070678_100036356 3300005456 Bacteria 3447
52 Ga0070678_100705683 3300005456 Bacteria 909
53 Ga0070662_100004769 3300005457 Bacteria 8590
54 Ga0070662_100378868 3300005457 Bacteria 1164
55 Ga0070706_100047365 3300005467 Bacteria 3967
56 Ga0070706_100048850 3300005467 Bacteria 3904
57 Ga0070706_100778547 3300005467 Bacteria 886
58 Ga0070707_100000704 3300005468 Bacteria 33310
59 Ga0070707_100463783 3300005468 Bacteria 1228
60 Ga0070698_100001198 3300005471 Bacteria 28769
61 Ga0070698_100097114 3300005471 Bacteria 2922
62 Ga0070698_100378030 3300005471 Bacteria 1349
63 Ga0070698_100717785 3300005471 Bacteria 942
64 Ga0070698_100857804 3300005471 Unclassified 853
65 Ga0070699_100000699 3300005518 Bacteria 31141
66 Ga0070699_100167156 3300005518 Bacteria 1948
67 Ga0070699_100331012 3300005518 Bacteria 1370
68 Ga0070699_100653433 3300005518 Bacteria 960
69 Ga0070679_100064781 3300005530 Bacteria 3642
70 Ga0070684_100006603 3300005535 Bacteria 8986
71 Ga0070684_100460518 3300005535 Bacteria 1176
72 Ga0070684_101707560 3300005535 Bacteria 594
73 Ga0070697_100000114 3300005536 Bacteria 63225
74 Ga0070697_100012893 3300005536 Bacteria 6549
75 Ga0070697_100343066 3300005536 Unclassified 1289
76 Ga0070697_100879007 3300005536 Bacteria 795
77 Ga0070697_101052028 3300005536 Unclassified 724
78 Ga0068853_100007829 3300005539 Bacteria 8569
79 Ga0070672_100151044 3300005543 Bacteria 1921
80 Ga0070672_101646838 3300005543 Unclassified 576
81 Ga0070695_100959153 3300005545 Unclassified 694
82 Ga0070696_100005390 3300005546 Bacteria 8531
83 Ga0070665_101085070 3300005548 Unclassified 812
84 Ga0070704_100089729 3300005549 Bacteria 2287
85 Ga0070704_100468722 3300005549 Unclassified 1088
86 Ga0070704_100876213 3300005549 Bacteria 806
87 Ga0068855_100378307 3300005563 Bacteria 1555
88 Ga0070664_100018704 3300005564 Bacteria 5698
89 Ga0070664_100096585 3300005564 Bacteria 2564
90 Ga0068857_100008564 3300005577 Bacteria 8846
91 Ga0068857_100616366 3300005577 Bacteria 1026
92 Ga0068854_100094259 3300005578 Bacteria 2233
93 Ga0068854_100215637 3300005578 Bacteria 1516
94 Ga0068852_100003909 3300005616 Bacteria 10468
95 Ga0068852_102442440 3300005616 Bacteria 543
96 Ga0068859_100157009 3300005617 Bacteria 2353
97 Ga0068859_101816209 3300005617 Bacteria 673
98 Ga0068859_102251957 3300005617 Bacteria 601
99 Ga0068864_101017904 3300005618 Bacteria 822
100 Ga0068864_102185531 3300005618 Bacteria 560
101 Ga0068861_100001153 3300005719 Bacteria 16459
102 Ga0068861_100692609 3300005719 Bacteria 946
103 Ga0068851_10258320 3300005834 Bacteria 990
104 Ga0068863_100004308 3300005841 Bacteria 14018
105 Ga0068860_100167630 3300005843 Bacteria 2120
106 Ga0068862_100006895 3300005844 Bacteria 9420
107 Ga0068862_100332499 3300005844 Bacteria 1405
108 Ga0068862_100897249 3300005844 Bacteria 871
109 Ga0068862_101060861 3300005844 Bacteria 804
110 Ga0081539_10012295 3300005985 Bacteria 6622
111 Ga0081539_10141963 3300005985 Bacteria 1166
112 Ga0081539_10232377 3300005985 Bacteria 831
113 Ga0070717_10001379 3300006028 Bacteria 16726
114 Ga0070717_10150395 3300006028 Bacteria 2014
115 Ga0070717_10250482 3300006028 Bacteria 1565
116 Ga0070717_11325275 3300006028 Bacteria 654
117 Ga0075365_10145244 3300006038 Bacteria 1648
118 Ga0075363_100031344 3300006048 Bacteria 2756
119 Ga0075364_10010210 3300006051 Bacteria 5663
120 Ga0070715_10141694 3300006163 Unclassified 1168
121 Ga0070715_10274260 3300006163 Unclassified 891
122 Ga0070715_10565147 3300006163 Unclassified 661
123 Ga0070716_100000749 3300006173 Bacteria 13903
124 Ga0070716_100057566 3300006173 Unclassified 2234
125 Ga0070712_100000055 3300006175 Bacteria 57367
126 Ga0070712_100238336 3300006175 Bacteria 1448
127 Ga0075362_10000017 3300006177 Bacteria 77754
128 Ga0075428_100209385 3300006844 Bacteria 2107
129 Ga0075428_100753488 3300006844 Bacteria 1036
130 Ga0075434_100057144 3300006871 Bacteria 3878
131 Ga0075434_100691221 3300006871 Unclassified 1038
132 Ga0075429_100271270 3300006880 Bacteria 1486
133 Ga0068865_100000702 3300006881 Bacteria 18828
134 Ga0075436_100058491 3300006914 Bacteria 2662
135 Ga0075436_100507646 3300006914 Bacteria 882
136 Ga0075436_100574284 3300006914 Bacteria 829
137 Ga0097620_100157012 3300006931 Bacteria 2353
138 Ga0097620_101816855 3300006931 Bacteria 673
139 Ga0097620_102251579 3300006931 Bacteria 601
140 Ga0111539_10166833 3300009094 Bacteria 2574
141 Ga0105245_10058536 3300009098 Bacteria 3468
142 Ga0114129_10149064 3300009147 Bacteria 3202
143 Ga0114129_10514732 3300009147 Bacteria 1561
144 Ga0114129_10913867 3300009147 Bacteria 1111
145 Ga0105243_11098941 3300009148 Unclassified 803
146 Ga0105241_10678557 3300009174 Unclassified 938
147 Ga0105241_11931289 3300009174 Unclassified 579
148 Ga0105248_10090358 3300009177 Bacteria 3448
149 Ga0105248_11436448 3300009177 Bacteria 781
150 Ga0105238_10454604 3300009551 Bacteria 1278
151 Ga0105238_12357702 3300009551 Unclassified 567
152 Ga0105249_10005699 3300009553 Bacteria 10767
153 Ga0105249_10274862 3300009553 Bacteria 1680
154 Ga0105249_12009261 3300009553 Bacteria 651
155 Ga0105239_10221683 3300010375 Bacteria 2121
156 Ga0157371_10029672 3300013102 Bacteria 3952
157 Ga0157371_10249366 3300013102 Bacteria 1278
158 Ga0157370_10264783 3300013104 Bacteria 1588
159 Ga0163162_10009031 3300013306 Bacteria 9687
160 Ga0163162_10641653 3300013306 Bacteria 1186
161 Ga0157372_10141429 3300013307 Bacteria 2772
162 Ga0157372_10166063 3300013307 Bacteria 2553
163 Ga0157372_10801799 3300013307 Bacteria 1094
164 Ga0157375_10184589 3300013308 Bacteria 2238
165 Ga0157375_11553587 3300013308 Unclassified 782
166 Ga0163163_10002771 3300014325 Bacteria 14797
167 Ga0163163_10061891 3300014325 Bacteria 3709
168 Ga0157380_10021085 3300014326 Bacteria 4882
169 Ga0157380_11195741 3300014326 Bacteria 804
170 Ga0157379_10001669 3300014968 Bacteria 18349
171 Ga0157376_10969225 3300014969 Bacteria 872
172 Ga0213876_10010704 3300021384 Bacteria 4914
173 Ga0213876_10087550 3300021384 Unclassified 1649
174 Ga0207697_10000742 3300025315 Bacteria 18463
175 Ga0207656_10027736 3300025321 Bacteria 2318
176 Ga0207692_10405866 3300025898 Unclassified 850
177 Ga0207688_10051245 3300025901 Bacteria 2312
178 Ga0207680_10548957 3300025903 Bacteria 825
179 Ga0207647_10024268 3300025904 Bacteria 4000
180 Ga0207685_10141480 3300025905 Unclassified 1079
181 Ga0207685_10162586 3300025905 Unclassified 1020
182 Ga0207699_10126142 3300025906 Bacteria 1662
183 Ga0207699_10382363 3300025906 Unclassified 999
184 Ga0207645_10036966 3300025907 Bacteria 3135
185 Ga0207684_10000274 3300025910 Bacteria 76497
186 Ga0207684_10133284 3300025910 Unclassified 2133
187 Ga0207684_10205201 3300025910 Unclassified 1700
188 Ga0207684_10990611 3300025910 Bacteria 703
189 Ga0207707_10403564 3300025912 Bacteria 1173
190 Ga0207693_10000143 3300025915 Bacteria 65412
191 Ga0207663_10004972 3300025916 Bacteria 6661
192 Ga0207663_10135011 3300025916 Bacteria 1711
193 Ga0207663_10364190 3300025916 Bacteria 1097
194 Ga0207662_10065289 3300025918 Bacteria 2192
195 Ga0207662_10112904 3300025918 Bacteria 1696
196 Ga0207657_10029607 3300025919 Bacteria 4982
197 Ga0207657_10101701 3300025919 Bacteria 2385
198 Ga0207649_10003779 3300025920 Bacteria 8260
199 Ga0207649_10191463 3300025920 Bacteria 1439
200 Ga0207649_10948177 3300025920 Bacteria 676
201 Ga0207652_10612107 3300025921 Bacteria 976
202 Ga0207646_10000240 3300025922 Bacteria 75609
203 Ga0207646_10085446 3300025922 Bacteria 2823
204 Ga0207646_10287250 3300025922 Unclassified 1486
205 Ga0207681_10012578 3300025923 Bacteria 5225
206 Ga0207681_10321614 3300025923 Bacteria 1230
207 Ga0207681_11612361 3300025923 Bacteria 543
208 Ga0207650_10010095 3300025925 Bacteria 6469
209 Ga0207650_10115903 3300025925 Bacteria 2080
210 Ga0207650_10122958 3300025925 Bacteria 2023
211 Ga0207650_10329126 3300025925 Bacteria 1253
212 Ga0207659_10051584 3300025926 Bacteria 2926
213 Ga0207687_10040661 3300025927 Bacteria 3189
214 Ga0207700_10007254 3300025928 Bacteria 6762
215 Ga0207700_10071634 3300025928 Bacteria 2669
216 Ga0207664_10005288 3300025929 Bacteria 8815
217 Ga0207690_10084214 3300025932 Bacteria 2228
218 Ga0207706_10000364 3300025933 Bacteria 48974
219 Ga0207706_10136474 3300025933 Bacteria 2158
220 Ga0207706_10378080 3300025933 Unclassified 1229
221 Ga0207670_10222804 3300025936 Bacteria 1445
222 Ga0207704_10013881 3300025938 Bacteria 4050
223 Ga0207665_10004344 3300025939 Bacteria 9414
224 Ga0207665_10078429 3300025939 Bacteria 2269
225 Ga0207691_10000745 3300025940 Bacteria 32134
226 Ga0207711_10030446 3300025941 Bacteria 4552
227 Ga0207689_10003089 3300025942 Bacteria 15318
228 Ga0207661_10045533 3300025944 Bacteria 3473
229 Ga0207661_10102834 3300025944 Bacteria 2403
230 Ga0207661_10180769 3300025944 Bacteria 1842
231 Ga0207679_10005109 3300025945 Bacteria 8207
232 Ga0207667_10095274 3300025949 Bacteria 3073
233 Ga0207667_10301947 3300025949 Bacteria 1636
234 Ga0207651_10274551 3300025960 Bacteria 1390
235 Ga0207651_11197054 3300025960 Bacteria 682
236 Ga0207712_10007974 3300025961 Bacteria 6693
237 Ga0207668_10002709 3300025972 Bacteria 10367
238 Ga0207668_10163160 3300025972 Bacteria 1739
239 Ga0207668_10240223 3300025972 Bacteria 1465
240 Ga0207668_10303211 3300025972 Bacteria 1319
241 Ga0207640_10164215 3300025981 Bacteria 1647
242 Ga0207658_10068953 3300025986 Bacteria 2670
243 Ga0207677_10013812 3300026023 Bacteria 4691
244 Ga0207677_11327860 3300026023 Bacteria 661
245 Ga0207678_10376209 3300026067 Bacteria 1227
246 Ga0207708_10061417 3300026075 Bacteria 2870
247 Ga0207641_10100325 3300026088 Bacteria 2549
248 Ga0207648_10767682 3300026089 Bacteria 896
249 Ga0207674_10000658 3300026116 Bacteria 44902
250 Ga0207674_10164638 3300026116 Bacteria 2172
251 Ga0207675_100000030 3300026118 Bacteria 109178
252 Ga0207683_10082572 3300026121 Bacteria 2855
253 Ga0207683_10247695 3300026121 Bacteria 1626
254 Ga0207698_10035105 3300026142 Bacteria 3665
255 Ga0207698_10807453 3300026142 Bacteria 941
256 Ga0209588_1135723 3300027671 Bacteria 784
257 Ga0268266_10184569 3300028379 Bacteria 1901
258 Ga0268266_10247083 3300028379 Bacteria 1649
259 Ga0268266_10263242 3300028379 Bacteria 1599
260 Ga0268265_10015959 3300028380 Bacteria 5153
261 Ga0268265_10144596 3300028380 Unclassified 1996
262 Ga0265338_10390274 3300028800 Unclassified 994
263 Ga0265339_10022588 3300031249 Bacteria 3644
264 Ga0307408_100149856 3300031548 Bacteria 1840
265 Ga0307408_100639077 3300031548 Bacteria 950
266 Ga0307408_102467710 3300031548 Bacteria 505
267 Ga0316576_10033551 3300031727 Bacteria 3655
268 Ga0307405_10034005 3300031731 Unclassified 3029
269 Ga0316577_10006078 3300031733 Bacteria 6364
270 Ga0307413_10007618 3300031824 Bacteria 5046
271 Ga0307413_10074174 3300031824 Bacteria 2154
272 Ga0307410_10021376 3300031852 Bacteria 3979
273 Ga0307410_10025524 3300031852 Bacteria 3709
274 Ga0307406_10003212 3300031901 Bacteria 8896
275 Ga0307407_10028244 3300031903 Bacteria 2997
276 Ga0307407_10034321 3300031903 Bacteria 2776
277 Ga0307407_10056492 3300031903 Unclassified 2273
278 Ga0307412_10110696 3300031911 Unclassified 1960
279 Ga0307412_10574255 3300031911 Bacteria 951
280 Ga0307409_100059508 3300031995 Bacteria 2973
281 Ga0307409_100152134 3300031995 Bacteria 2010
282 Ga0307409_100180855 3300031995 Unclassified 1866
283 Ga0307416_100052096 3300032002 Bacteria 3274
284 Ga0307416_100630727 3300032002 Bacteria 1155
285 Ga0307414_10012633 3300032004 Bacteria 5003
286 Ga0307411_10021705 3300032005 Bacteria 3763
287 Ga0307411_11153274 3300032005 Bacteria 701
288 Ga0373926_0373424 3300035083 Unclassified 561
289 Ga0373934_0146473 3300035086 Bacteria 966
290 Ga0373940_0110408 3300035088 Bacteria 844
291 Ga0373944_0061946 3300035089 Unclassified 1202
292 Ga0373923_0009530 3300035111 Bacteria 3508
293 Ga0373936_0003338 3300035113 Bacteria 6018
294 Ga0373939_0281701 3300035114 Bacteria 657
295 Ga0373953_0069078 3300035117 Bacteria 1455
296 Ga0373954_0017999 3300035118 Bacteria 3177
297 Ga0373956_0011117 3300035119 Bacteria 3706
298 Ga0373943_0067783 3300035170 Unclassified 1800
299 Ga0373943_0617821 3300035170 Unclassified 639
300 Ga0373946_0097046 3300035171 Bacteria 1315
301 Ga0373955_0005390 3300035172 Bacteria 5747
302 Ga0373962_0022101 3300035242 Bacteria 1684
303 Ga0373924_0042781 3300035410 Bacteria 1859
304 Ga0373931_0088630 3300035691 Bacteria 1720
305 Ga0373935_0171553 3300035692 Bacteria 1484
306 Ga0373935_0369768 3300035692 Unclassified 1025
307 Ga0373927_0061342 3300035695 Bacteria 2433
308 Ga0373927_0090697 3300035695 Bacteria 1985
309 Ga0373933_0176506 3300035724 Bacteria 1361
310 Ga0373933_0208104 3300035724 Unclassified 1253
311 Ga0373933_0702519 3300035724 Unclassified 665
312 Ga0373947_0027915 3300035725 Bacteria 3306
313 Ga0373937_0021479 3300036401 Bacteria 5793
314 Ga0373937_0091454 3300036401 Bacteria 2820
315 Ga0373937_0430218 3300036401 Bacteria 1253
316 Ga0316584_0010650 3300036712 Bacteria 6437
317 Ga0373925_0095858 3300037068 Unclassified 2273
318 Ga0373925_0247942 3300037068 Bacteria 1428
319 Ga0373925_0713950 3300037068 Unclassified 826
320 Ga0395905_0044260 3300037471 Bacteria 4178
321 Ga0395905_0184749 3300037471 Bacteria 1957
322 Ga0436364_0107785 3300037853 Unclassified 2189
323 Ga0436364_0864451 3300037853 Bacteria 627
324 Ga0395901_0104363 3300038443 Bacteria 2975
325 Ga0400485_20631 3300038735 Bacteria 5934
326 Ga0400486_07431 3300038742 Bacteria 24844
327 Ga0400483_050187 3300039062 Bacteria 12634
328 Ga0400483_205332 3300039062 Bacteria 2720
329 Ga0400489_90984 3300039093 Bacteria 13397
330 Ga0436365_0329605 3300039437 Bacteria 1167
331 Ga0436365_1152567 3300039437 Bacteria 4660
332 Ga0436365_1453400 3300039437 Bacteria 5494
333 Ga0436363_1042578 3300039450 Bacteria 684
334 Ga0436362_0525528 3300039453 Bacteria 816
335 Ga0451795_0313244 3300041456 Bacteria 3354
336 Ga0439458_0123929 3300042157 Bacteria 682
337 Ga0439458_0126524 3300042157 Unclassified 675
338 Ga0451577_0000005 3300042876 Bacteria 712599
339 Ga0451577_0160829 3300042876 Bacteria 2022
340 Ga0453683_0005031 3300044673 Bacteria 9287
341 Ga0453683_0206009 3300044673 Bacteria 1249
342 Ga0466963_0778378 3300044694 Bacteria 675
343 Ga0453684_0009782 3300044712 Bacteria 16639
344 Ga0453684_0287752 3300044712 Bacteria 1872
345 Ga0453684_1502406 3300044712 Bacteria 695
346 Ga0451576_0804773 3300045051 Unclassified 987
347 Ga0495629_0008416 3300046459 Bacteria 7591
348 Ga0495629_0200744 3300046459 Bacteria 1379
349 Ga0495580_0000561 3300046472 Bacteria 31371
350 Ga0495639_0294179 3300046475 Bacteria 809
351 Ga0495664_0093401 3300046477 Bacteria 1810
352 Ga0495628_0050495 3300046516 Bacteria 3290
353 Ga0495628_0280617 3300046516 Bacteria 1237
354 Ga0495630_0009697 3300046517 Bacteria 6925
355 Ga0495632_0018499 3300046519 Bacteria 3824
356 Ga0495665_0165597 3300046531 Bacteria 1152
357 Ga0495640_0575746 3300046533 Unclassified 681
358 Ga0495645_0395077 3300046543 Unclassified 882
359 Ga0495599_0031278 3300046678 Bacteria 3341
360 Ga0495599_0054564 3300046678 Bacteria 2504
361 Ga0495646_0205914 3300046680 Bacteria 1070
362 Ga0495658_0014703 3300046683 Bacteria 4002
363 Ga0495658_0065433 3300046683 Unclassified 2097
364 Ga0495658_0611372 3300046683 Unclassified 698
365 Ga0495613_0400058 3300046689 Unclassified 937
366 Ga0495674_0009019 3300047319 Bacteria 9477
367 Ga0495672_0001915 3300047320 Bacteria 19735
368 Ga0496104_0247123 3300048907 Bacteria 1697
369 Ga0496105_0335441 3300048908 Bacteria 1210
370 Ga0496109_0438452 3300048912 Bacteria 1234
371 Ga0496109_0714961 3300048912 Bacteria 939
372 Ga0496112_0455512 3300048915 Bacteria 1217
373 Ga0496115_0006349 3300048918 Bacteria 8658
374 Ga0501298_036947 3300049521 Bacteria 979
375 Ga0501033_0014379 3300049570 Bacteria 6012
376 Ga0501034_0003338 3300049571 Bacteria 18320
377 Ga0501034_0450814 3300049571 Unclassified 1204
378 Ga0501034_0543814 3300049571 Bacteria 1071
379 Ga0501034_0594696 3300049571 Bacteria 1012
380 Ga0501037_0238012 3300049573 Bacteria 1276
381 Ga0501038_0380071 3300049574 Bacteria 1096
382 Ga0501039_1373805 3300049575 Bacteria 544
383 Ga0501040_0016522 3300049576 Bacteria 4887
384 Ga0501041_0205404 3300049577 Bacteria 1235
385 Ga0501042_0012747 3300049578 Bacteria 5704
386 Ga0501043_0136833 3300049579 Bacteria 1919
387 Ga0501046_0295187 3300049580 Bacteria 1185
388 Ga0501047_0302078 3300049581 Unclassified 1443
389 Ga0501047_0971826 3300049581 Bacteria 662
390 Ga0501067_0005478 3300049583 Bacteria 7039
391 Ga0501067_0006189 3300049583 Bacteria 6636
392 Ga0501068_0000339 3300049584 Bacteria 23563
393 Ga0501068_0000537 3300049584 Bacteria 19150
394 Ga0501069_0000336 3300049585 Bacteria 21210
395 Ga0501069_0101611 3300049585 Bacteria 1632
396 Ga0501070_0010846 3300049586 Bacteria 7697
397 Ga0501070_0039481 3300049586 Bacteria 3937
398 Ga0501071_0006402 3300049587 Bacteria 7642
399 Ga0501071_0006897 3300049587 Bacteria 7407
400 Ga0501071_0208871 3300049587 Unclassified 1468
401 Ga0501072_0002957 3300049588 Bacteria 12799
402 Ga0501072_0014524 3300049588 Bacteria 6034
403 Ga0501072_0354762 3300049588 Bacteria 1164
404 Ga0501072_1174879 3300049588 Bacteria 596
405 Ga0501073_0011604 3300049589 Bacteria 6439
406 Ga0501074_0000291 3300049590 Bacteria 29100
407 Ga0501074_0009434 3300049590 Bacteria 7087
408 Ga0501076_0160203 3300049592 Bacteria 1833
409 Ga0501198_037481 3300049649 Bacteria 830
410 Ga0501230_004055 3300049667 Bacteria 1987
411 Ga0501239_000163 3300049672 Bacteria 4658
412 Ga0501248_040130 3300049678 Bacteria 570
413 Ga0501257_047651 3300049686 Unclassified 1063
414 Ga0501234_007414 3300049707 Unclassified 1716
415 Ga0501079_0377557 3300049741 Bacteria 1111
416 Ga0501079_1125100 3300049741 Bacteria 619
417 Ga0501080_0014656 3300049742 Bacteria 7220
418 Ga0501080_0099834 3300049742 Bacteria 2693
419 Ga0501080_1423131 3300049742 Bacteria 591
420 Ga0501081_0006873 3300049743 Bacteria 7400
421 Ga0501083_0001706 3300049744 Bacteria 14979
422 Ga0501262_005084 3300049759 Unclassified 1543
423 Ga0501268_181934 3300049765 Bacteria 501
424 Ga0501273_000881 3300049770 Unclassified 2644
425 Ga0501275_001516 3300049772 Bacteria 2269
426 Ga0501280_011180 3300049776 Unclassified 1254
427 Ga0501283_000944 3300049779 Bacteria 3862
428 Ga0501044_0093774 3300049823 Unclassified 3027
429 Ga0501045_0446618 3300049824 Bacteria 961
430 nmdc:mga00v17_1648_c1 3300050491 Bacteria 11661
431 nmdc:mga0yw44_146612_c1 3300050492 Bacteria 1537
432 nmdc:mga05p37_563959_c1 3300050507 Bacteria 1293
433 nmdc:mga09592_833497_c1 3300050508 Bacteria 778
434 nmdc:mga08y16_21058_c1 3300050511 Bacteria 6884
435 nmdc:mga0n895_10726_c1 3300050512 Bacteria 8120
436 nmdc:mga0n895_58732_c1 3300050512 Bacteria 3793
437 nmdc:mga0rr50_554298_c1 3300050513 Bacteria 979
438 nmdc:mga08x19_3311_c1 3300050514 Bacteria 9630
439 nmdc:mga08x19_439364_c1 3300050514 Bacteria 918
440 nmdc:mga0a205_268417_c1 3300050515 Bacteria 1583
441 nmdc:mga0a205_527450_c1 3300050515 Bacteria 1037
442 Ga0495619_0433999 3300053085 Bacteria 906
443 Ga0501084_0000549 3300054114 Bacteria 28603
444 Ga0590071_000752 3300059421 Bacteria 9067
445 Ga0590074_005829 3300059423 Bacteria 2044
446 Ga0590075_000724 3300059424 Bacteria 8763
447 Ga0590075_038090 3300059424 Unclassified 1227
448 Ga0590077_000579 3300059426 Bacteria 10124
449 Ga0501082_0023190 3300060353 Bacteria 5353
450 Ga0501082_0294607 3300060353 Bacteria 1413
451 Ga0530510_0141810 3300061734 Bacteria 1771
452 Ga0530510_1064753 3300061734 Bacteria 619

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0206009 Ga0453683_0206009_414_821 131
2 3300044712 Ga0453684_0287752 Ga0453684_0287752_1234_1641 131
3 3300005331 Ga0070670_100450081 Ga0070670_1004500812 132
4 3300005338 Ga0068868_100701615 Ga0068868_1007016152 132
5 3300005455 Ga0070663_100196524 Ga0070663_1001965242 132
6 3300005543 Ga0070672_101646838 Ga0070672_1016468381 132
7 3300005549 Ga0070704_100468722 Ga0070704_1004687222 132
8 3300009177 Ga0105248_11436448 Ga0105248_114364482 132
9 3300009551 Ga0105238_12357702 Ga0105238_123577021 132
10 3300013306 Ga0163162_10641653 Ga0163162_106416532 132
11 3300013308 Ga0157375_11553587 Ga0157375_115535871 132
12 3300014325 Ga0163163_10061891 Ga0163163_100618914 132
13 3300014969 Ga0157376_10969225 Ga0157376_109692252 132
14 3300025903 Ga0207680_10548957 Ga0207680_105489572 132
15 3300025925 Ga0207650_10329126 Ga0207650_103291262 132
16 3300025941 Ga0207711_10030446 Ga0207711_100304461 132
17 3300026023 Ga0207677_11327860 Ga0207677_113278601 132
18 3300026067 Ga0207678_10376209 Ga0207678_103762092 132
19 3300028379 Ga0268266_10247083 Ga0268266_102470832 132
20 3300048907 Ga0496104_0247123 Ga0496104_0247123_956_1408 132
21 3300005445 Ga0070708_100415978 Ga0070708_1004159782 133
22 3300005518 Ga0070699_100167156 Ga0070699_1001671564 133
23 3300031824 Ga0307413_10074174 Ga0307413_100741743 133
24 3300031852 Ga0307410_10025524 Ga0307410_100255245 133
25 3300031903 Ga0307407_10034321 Ga0307407_100343214 133
26 3300031995 Ga0307409_100059508 Ga0307409_1000595084 133
27 3300032005 Ga0307411_10021705 Ga0307411_100217053 133
28 3300021384 Ga0213876_10087550 Ga0213876_100875504 136
29 3300039437 Ga0436365_1152567 Ga0436365_1152567_1175_1642 136
30 3300005439 Ga0070711_100479566 Ga0070711_1004795662 141
31 3300005536 Ga0070697_100879007 Ga0070697_1008790071 141
32 3300006175 Ga0070712_100238336 Ga0070712_1002383362 141
33 3300025916 Ga0207663_10135011 Ga0207663_101350112 141
34 3300027671 Ga0209588_1135723 Ga0209588_11357231 141
35 3300005444 Ga0070694_100011220 Ga0070694_1000112205 142
36 3300005518 Ga0070699_100331012 Ga0070699_1003310122 142
37 3300035086 Ga0373934_0146473 Ga0373934_0146473_331_777 142
38 3300035111 Ga0373923_0009530 Ga0373923_0009530_1142_1588 142
39 3300035117 Ga0373953_0069078 Ga0373953_0069078_509_955 142
40 3300035118 Ga0373954_0017999 Ga0373954_0017999_588_1034 142
41 3300035119 Ga0373956_0011117 Ga0373956_0011117_3076_3522 142
42 3300035172 Ga0373955_0005390 Ga0373955_0005390_1340_1786 142
43 3300035695 Ga0373927_0090697 Ga0373927_0090697_1447_1893 142
44 3300035724 Ga0373933_0176506 Ga0373933_0176506_233_679 142
45 3300036401 Ga0373937_0021479 Ga0373937_0021479_2890_3336 142
46 3300036401 Ga0373937_0430218 Ga0373937_0430218_605_1045 142
47 3300046683 Ga0495658_0014703 Ga0495658_0014703_2778_3224 142
48 3300005441 Ga0070700_101558411 Ga0070700_1015584111 144
49 3300009147 Ga0114129_10514732 Ga0114129_105147321 144
50 3300009553 Ga0105249_10274862 Ga0105249_102748622 144
51 3300031548 Ga0307408_102467710 Ga0307408_1024677101 144
52 3300035724 Ga0373933_0208104 Ga0373933_0208104_567_1025 144
53 3300037068 Ga0373925_0247942 Ga0373925_0247942_56_508 144
54 3300046475 Ga0495639_0294179 Ga0495639_0294179_22_456 144
55 3300049575 Ga0501039_1373805 Ga0501039_1373805_16_465 144
56 3300049742 Ga0501080_1423131 Ga0501080_1423131_94_543 144
57 3300005331 Ga0070670_100187157 Ga0070670_1001871574 145
58 3300005343 Ga0070687_100021899 Ga0070687_1000218992 145
59 3300005344 Ga0070661_100343890 Ga0070661_1003438901 145
60 3300005347 Ga0070668_100214254 Ga0070668_1002142542 145
61 3300005347 Ga0070668_100313867 Ga0070668_1003138671 145
62 3300005353 Ga0070669_100324249 Ga0070669_1003242492 145
63 3300005365 Ga0070688_100066368 Ga0070688_1000663682 145
64 3300005434 Ga0070709_10037792 Ga0070709_100377923 145
65 3300005434 Ga0070709_10187972 Ga0070709_101879722 145
66 3300005435 Ga0070714_100018598 Ga0070714_1000185982 145
67 3300005435 Ga0070714_101792930 Ga0070714_1017929301 145
68 3300005436 Ga0070713_100004065 Ga0070713_1000040658 145
69 3300005437 Ga0070710_10039803 Ga0070710_100398034 145
70 3300005438 Ga0070701_10856628 Ga0070701_108566281 145
71 3300005439 Ga0070711_100002710 Ga0070711_10000271010 145
72 3300005439 Ga0070711_100363650 Ga0070711_1003636502 145
73 3300005440 Ga0070705_100365669 Ga0070705_1003656691 145
74 3300005441 Ga0070700_100297188 Ga0070700_1002971881 145
75 3300005444 Ga0070694_100229779 Ga0070694_1002297791 145
76 3300005445 Ga0070708_100077595 Ga0070708_1000775952 145
77 3300005445 Ga0070708_100669903 Ga0070708_1006699031 145
78 3300005456 Ga0070678_100036356 Ga0070678_1000363562 145
79 3300005456 Ga0070678_100705683 Ga0070678_1007056832 145
80 3300005457 Ga0070662_100378868 Ga0070662_1003788682 145
81 3300005467 Ga0070706_100047365 Ga0070706_1000473654 145
82 3300005467 Ga0070706_100048850 Ga0070706_1000488501 145
83 3300005468 Ga0070707_100000704 Ga0070707_10000070426 145
84 3300005468 Ga0070707_100463783 Ga0070707_1004637832 145
85 3300005471 Ga0070698_100001198 Ga0070698_10000119813 145
86 3300005471 Ga0070698_100097114 Ga0070698_1000971145 145
87 3300005471 Ga0070698_100378030 Ga0070698_1003780302 145
88 3300005471 Ga0070698_100717785 Ga0070698_1007177852 145
89 3300005471 Ga0070698_100857804 Ga0070698_1008578041 145
90 3300005518 Ga0070699_100000699 Ga0070699_1000006992 145
91 3300005518 Ga0070699_100653433 Ga0070699_1006534332 145
92 3300005530 Ga0070679_100064781 Ga0070679_1000647812 145
93 3300005535 Ga0070684_101707560 Ga0070684_1017075601 145
94 3300005536 Ga0070697_100000114 Ga0070697_10000011436 145
95 3300005536 Ga0070697_100012893 Ga0070697_1000128935 145
96 3300005536 Ga0070697_100343066 Ga0070697_1003430662 145
97 3300005536 Ga0070697_101052028 Ga0070697_1010520281 145
98 3300005545 Ga0070695_100959153 Ga0070695_1009591532 145
99 3300005546 Ga0070696_100005390 Ga0070696_1000053902 145
100 3300005548 Ga0070665_101085070 Ga0070665_1010850701 145
101 3300005549 Ga0070704_100089729 Ga0070704_1000897293 145
102 3300005549 Ga0070704_100876213 Ga0070704_1008762132 145
103 3300005563 Ga0068855_100378307 Ga0068855_1003783072 145
104 3300005577 Ga0068857_100616366 Ga0068857_1006163662 145
105 3300005578 Ga0068854_100215637 Ga0068854_1002156372 145
106 3300005617 Ga0068859_100157009 Ga0068859_1001570092 145
107 3300005617 Ga0068859_102251957 Ga0068859_1022519572 145
108 3300005618 Ga0068864_102185531 Ga0068864_1021855311 145
109 3300005719 Ga0068861_100692609 Ga0068861_1006926092 145
110 3300005843 Ga0068860_100167630 Ga0068860_1001676303 145
111 3300005844 Ga0068862_100332499 Ga0068862_1003324993 145
112 3300005844 Ga0068862_100897249 Ga0068862_1008972492 145
113 3300005844 Ga0068862_101060861 Ga0068862_1010608612 145
114 3300005985 Ga0081539_10141963 Ga0081539_101419632 145
115 3300006028 Ga0070717_10001379 Ga0070717_1000137910 145
116 3300006028 Ga0070717_10150395 Ga0070717_101503953 145
117 3300006028 Ga0070717_10250482 Ga0070717_102504823 145
118 3300006028 Ga0070717_11325275 Ga0070717_113252751 145
119 3300006038 Ga0075365_10145244 Ga0075365_101452442 145
120 3300006048 Ga0075363_100031344 Ga0075363_1000313443 145
121 3300006051 Ga0075364_10010210 Ga0075364_100102104 145
122 3300006163 Ga0070715_10141694 Ga0070715_101416943 145
123 3300006163 Ga0070715_10274260 Ga0070715_102742602 145
124 3300006163 Ga0070715_10565147 Ga0070715_105651472 145
125 3300006173 Ga0070716_100000749 Ga0070716_10000074910 145
126 3300006173 Ga0070716_100057566 Ga0070716_1000575662 145
127 3300006175 Ga0070712_100000055 Ga0070712_10000005526 145
128 3300006177 Ga0075362_10000017 Ga0075362_100000174 145
129 3300006844 Ga0075428_100209385 Ga0075428_1002093852 145
130 3300006871 Ga0075434_100691221 Ga0075434_1006912212 145
131 3300006914 Ga0075436_100058491 Ga0075436_1000584914 145
132 3300006914 Ga0075436_100507646 Ga0075436_1005076462 145
133 3300006914 Ga0075436_100574284 Ga0075436_1005742841 145
134 3300006931 Ga0097620_100157012 Ga0097620_1001570122 145
135 3300006931 Ga0097620_102251579 Ga0097620_1022515792 145
136 3300009147 Ga0114129_10913867 Ga0114129_109138672 145
137 3300009148 Ga0105243_11098941 Ga0105243_110989412 145
138 3300009174 Ga0105241_10678557 Ga0105241_106785572 145
139 3300009174 Ga0105241_11931289 Ga0105241_119312891 145
140 3300009551 Ga0105238_10454604 Ga0105238_104546042 145
141 3300009553 Ga0105249_12009261 Ga0105249_120092611 145
142 3300013102 Ga0157371_10029672 Ga0157371_100296723 145
143 3300013102 Ga0157371_10249366 Ga0157371_102493663 145
144 3300013104 Ga0157370_10264783 Ga0157370_102647832 145
145 3300013307 Ga0157372_10141429 Ga0157372_101414294 145
146 3300013307 Ga0157372_10166063 Ga0157372_101660632 145
147 3300013307 Ga0157372_10801799 Ga0157372_108017992 145
148 3300014326 Ga0157380_11195741 Ga0157380_111957412 145
149 3300021384 Ga0213876_10010704 Ga0213876_100107045 145
150 3300025898 Ga0207692_10405866 Ga0207692_104058662 145
151 3300025905 Ga0207685_10141480 Ga0207685_101414802 145
152 3300025905 Ga0207685_10162586 Ga0207685_101625863 145
153 3300025906 Ga0207699_10126142 Ga0207699_101261422 145
154 3300025906 Ga0207699_10382363 Ga0207699_103823632 145
155 3300025910 Ga0207684_10000274 Ga0207684_1000027463 145
156 3300025910 Ga0207684_10133284 Ga0207684_101332842 145
157 3300025910 Ga0207684_10205201 Ga0207684_102052012 145
158 3300025910 Ga0207684_10990611 Ga0207684_109906111 145
159 3300025912 Ga0207707_10403564 Ga0207707_104035642 145
160 3300025915 Ga0207693_10000143 Ga0207693_1000014334 145
161 3300025916 Ga0207663_10004972 Ga0207663_100049728 145
162 3300025916 Ga0207663_10364190 Ga0207663_103641902 145
163 3300025918 Ga0207662_10065289 Ga0207662_100652893 145
164 3300025919 Ga0207657_10101701 Ga0207657_101017013 145
165 3300025920 Ga0207649_10191463 Ga0207649_101914632 145
166 3300025921 Ga0207652_10612107 Ga0207652_106121072 145
167 3300025922 Ga0207646_10000240 Ga0207646_1000024062 145
168 3300025922 Ga0207646_10085446 Ga0207646_100854462 145
169 3300025922 Ga0207646_10287250 Ga0207646_102872502 145
170 3300025923 Ga0207681_10321614 Ga0207681_103216142 145
171 3300025923 Ga0207681_11612361 Ga0207681_116123611 145
172 3300025925 Ga0207650_10115903 Ga0207650_101159034 145
173 3300025928 Ga0207700_10007254 Ga0207700_100072542 145
174 3300025928 Ga0207700_10071634 Ga0207700_100716342 145
175 3300025929 Ga0207664_10005288 Ga0207664_100052886 145
176 3300025933 Ga0207706_10136474 Ga0207706_101364742 145
177 3300025933 Ga0207706_10378080 Ga0207706_103780803 145
178 3300025936 Ga0207670_10222804 Ga0207670_102228042 145
179 3300025939 Ga0207665_10004344 Ga0207665_1000434410 145
180 3300025939 Ga0207665_10078429 Ga0207665_100784292 145
181 3300025944 Ga0207661_10180769 Ga0207661_101807692 145
182 3300025949 Ga0207667_10301947 Ga0207667_103019472 145
183 3300025960 Ga0207651_11197054 Ga0207651_111970542 145
184 3300025972 Ga0207668_10163160 Ga0207668_101631602 145
185 3300025972 Ga0207668_10240223 Ga0207668_102402232 145
186 3300025972 Ga0207668_10303211 Ga0207668_103032111 145
187 3300026116 Ga0207674_10164638 Ga0207674_101646382 145
188 3300026121 Ga0207683_10082572 Ga0207683_100825723 145
189 3300026121 Ga0207683_10247695 Ga0207683_102476953 145
190 3300028379 Ga0268266_10263242 Ga0268266_102632423 145
191 3300028380 Ga0268265_10144596 Ga0268265_101445963 145
192 3300028800 Ga0265338_10390274 Ga0265338_103902742 145
193 3300031249 Ga0265339_10022588 Ga0265339_100225883 145
194 3300031548 Ga0307408_100149856 Ga0307408_1001498562 145
195 3300031727 Ga0316576_10033551 Ga0316576_100335512 145
196 3300031731 Ga0307405_10034005 Ga0307405_100340055 145
197 3300031733 Ga0316577_10006078 Ga0316577_100060782 145
198 3300031824 Ga0307413_10007618 Ga0307413_100076183 145
199 3300031852 Ga0307410_10021376 Ga0307410_100213763 145
200 3300031901 Ga0307406_10003212 Ga0307406_100032125 145
201 3300031903 Ga0307407_10028244 Ga0307407_100282442 145
202 3300031903 Ga0307407_10056492 Ga0307407_100564922 145
203 3300031911 Ga0307412_10110696 Ga0307412_101106962 145
204 3300031911 Ga0307412_10574255 Ga0307412_105742552 145
205 3300031995 Ga0307409_100152134 Ga0307409_1001521342 145
206 3300031995 Ga0307409_100180855 Ga0307409_1001808553 145
207 3300032002 Ga0307416_100052096 Ga0307416_1000520962 145
208 3300032004 Ga0307414_10012633 Ga0307414_100126335 145
209 3300032005 Ga0307411_11153274 Ga0307411_111532741 145
210 3300035083 Ga0373926_0373424 Ga0373926_0373424_66_515 145
211 3300035088 Ga0373940_0110408 Ga0373940_0110408_245_694 145
212 3300035089 Ga0373944_0061946 Ga0373944_0061946_724_1173 145
213 3300035113 Ga0373936_0003338 Ga0373936_0003338_5476_5925 145
214 3300035170 Ga0373943_0067783 Ga0373943_0067783_1269_1718 145
215 3300035170 Ga0373943_0617821 Ga0373943_0617821_18_467 145
216 3300035171 Ga0373946_0097046 Ga0373946_0097046_636_1085 145
217 3300035410 Ga0373924_0042781 Ga0373924_0042781_450_899 145
218 3300035691 Ga0373931_0088630 Ga0373931_0088630_1010_1465 145
219 3300035692 Ga0373935_0171553 Ga0373935_0171553_402_851 145
220 3300035692 Ga0373935_0369768 Ga0373935_0369768_175_624 145
221 3300035695 Ga0373927_0061342 Ga0373927_0061342_769_1218 145
222 3300035724 Ga0373933_0702519 Ga0373933_0702519_143_592 145
223 3300035725 Ga0373947_0027915 Ga0373947_0027915_2215_2664 145
224 3300036401 Ga0373937_0091454 Ga0373937_0091454_183_632 145
225 3300036712 Ga0316584_0010650 Ga0316584_0010650_2590_3027 145
226 3300037068 Ga0373925_0095858 Ga0373925_0095858_564_1013 145
227 3300037068 Ga0373925_0713950 Ga0373925_0713950_64_513 145
228 3300037471 Ga0395905_0044260 Ga0395905_0044260_3108_3557 145
229 3300037853 Ga0436364_0107785 Ga0436364_0107785_965_1405 145
230 3300037853 Ga0436364_0864451 Ga0436364_0864451_49_489 145
231 3300038443 Ga0395901_0104363 Ga0395901_0104363_500_1006 145
232 3300038735 Ga0400485_20631 Ga0400485_20631_2039_2479 145
233 3300038742 Ga0400486_07431 Ga0400486_07431_12928_13368 145
234 3300039062 Ga0400483_050187 Ga0400483_050187_10475_10927 145
235 3300039062 Ga0400483_205332 Ga0400483_205332_1927_2370 145
236 3300039093 Ga0400489_90984 Ga0400489_90984_4527_4967 145
237 3300039437 Ga0436365_0329605 Ga0436365_0329605_701_1150 145
238 3300039437 Ga0436365_1453400 Ga0436365_1453400_3417_3866 145
239 3300039450 Ga0436363_1042578 Ga0436363_1042578_223_666 145
240 3300039453 Ga0436362_0525528 Ga0436362_0525528_62_511 145
241 3300041456 Ga0451795_0313244 Ga0451795_0313244_2230_2679 145
242 3300042157 Ga0439458_0126524 Ga0439458_0126524_45_497 145
243 3300042876 Ga0451577_0160829 Ga0451577_0160829_1224_1670 145
244 3300044673 Ga0453683_0005031 Ga0453683_0005031_5755_6204 145
245 3300044694 Ga0466963_0778378 Ga0466963_0778378_106_555 145
246 3300044712 Ga0453684_0009782 Ga0453684_0009782_11165_11614 145
247 3300045051 Ga0451576_0804773 Ga0451576_0804773_10_459 145
248 3300046459 Ga0495629_0008416 Ga0495629_0008416_4448_4897 145
249 3300046459 Ga0495629_0200744 Ga0495629_0200744_482_931 145
250 3300046472 Ga0495580_0000561 Ga0495580_0000561_25683_26132 145
251 3300046477 Ga0495664_0093401 Ga0495664_0093401_136_585 145
252 3300046516 Ga0495628_0050495 Ga0495628_0050495_202_750 145
253 3300046516 Ga0495628_0280617 Ga0495628_0280617_174_623 145
254 3300046517 Ga0495630_0009697 Ga0495630_0009697_4639_5088 145
255 3300046519 Ga0495632_0018499 Ga0495632_0018499_2401_2850 145
256 3300046531 Ga0495665_0165597 Ga0495665_0165597_459_908 145
257 3300046533 Ga0495640_0575746 Ga0495640_0575746_100_549 145
258 3300046543 Ga0495645_0395077 Ga0495645_0395077_354_803 145
259 3300046678 Ga0495599_0031278 Ga0495599_0031278_1118_1666 145
260 3300046678 Ga0495599_0054564 Ga0495599_0054564_385_834 145
261 3300046680 Ga0495646_0205914 Ga0495646_0205914_509_958 145
262 3300046683 Ga0495658_0065433 Ga0495658_0065433_264_713 145
263 3300046683 Ga0495658_0611372 Ga0495658_0611372_164_610 145
264 3300046689 Ga0495613_0400058 Ga0495613_0400058_340_789 145
265 3300047319 Ga0495674_0009019 Ga0495674_0009019_7410_7859 145
266 3300047320 Ga0495672_0001915 Ga0495672_0001915_929_1378 145
267 3300048908 Ga0496105_0335441 Ga0496105_0335441_285_734 145
268 3300048915 Ga0496112_0455512 Ga0496112_0455512_34_483 145
269 3300048918 Ga0496115_0006349 Ga0496115_0006349_4862_5311 145
270 3300049521 Ga0501298_036947 Ga0501298_036947_208_657 145
271 3300049570 Ga0501033_0014379 Ga0501033_0014379_46_495 145
272 3300049571 Ga0501034_0003338 Ga0501034_0003338_1189_1635 145
273 3300049571 Ga0501034_0450814 Ga0501034_0450814_697_1146 145
274 3300049571 Ga0501034_0543814 Ga0501034_0543814_565_1014 145
275 3300049571 Ga0501034_0594696 Ga0501034_0594696_11_460 145
276 3300049573 Ga0501037_0238012 Ga0501037_0238012_806_1261 145
277 3300049574 Ga0501038_0380071 Ga0501038_0380071_380_835 145
278 3300049576 Ga0501040_0016522 Ga0501040_0016522_2415_2870 145
279 3300049577 Ga0501041_0205404 Ga0501041_0205404_549_1004 145
280 3300049578 Ga0501042_0012747 Ga0501042_0012747_2091_2546 145
281 3300049579 Ga0501043_0136833 Ga0501043_0136833_1295_1750 145
282 3300049580 Ga0501046_0295187 Ga0501046_0295187_225_680 145
283 3300049581 Ga0501047_0302078 Ga0501047_0302078_268_714 145
284 3300049581 Ga0501047_0971826 Ga0501047_0971826_141_590 145
285 3300049583 Ga0501067_0005478 Ga0501067_0005478_6498_6944 145
286 3300049583 Ga0501067_0006189 Ga0501067_0006189_1338_1784 145
287 3300049584 Ga0501068_0000339 Ga0501068_0000339_9127_9573 145
288 3300049584 Ga0501068_0000537 Ga0501068_0000537_195_641 145
289 3300049585 Ga0501069_0000336 Ga0501069_0000336_4355_4801 145
290 3300049585 Ga0501069_0101611 Ga0501069_0101611_1052_1498 145
291 3300049586 Ga0501070_0010846 Ga0501070_0010846_6752_7198 145
292 3300049586 Ga0501070_0039481 Ga0501070_0039481_2008_2454 145
293 3300049587 Ga0501071_0006402 Ga0501071_0006402_5204_5650 145
294 3300049587 Ga0501071_0006897 Ga0501071_0006897_1558_2004 145
295 3300049587 Ga0501071_0208871 Ga0501071_0208871_914_1360 145
296 3300049588 Ga0501072_0002957 Ga0501072_0002957_6537_6983 145
297 3300049588 Ga0501072_0014524 Ga0501072_0014524_964_1410 145
298 3300049588 Ga0501072_0354762 Ga0501072_0354762_174_629 145
299 3300049588 Ga0501072_1174879 Ga0501072_1174879_115_561 145
300 3300049589 Ga0501073_0011604 Ga0501073_0011604_5494_5940 145
301 3300049590 Ga0501074_0000291 Ga0501074_0000291_9653_10099 145
302 3300049590 Ga0501074_0009434 Ga0501074_0009434_6533_6979 145
303 3300049592 Ga0501076_0160203 Ga0501076_0160203_88_534 145
304 3300049649 Ga0501198_037481 Ga0501198_037481_159_608 145
305 3300049667 Ga0501230_004055 Ga0501230_004055_645_1094 145
306 3300049672 Ga0501239_000163 Ga0501239_000163_1516_1965 145
307 3300049678 Ga0501248_040130 Ga0501248_040130_74_523 145
308 3300049686 Ga0501257_047651 Ga0501257_047651_377_826 145
309 3300049707 Ga0501234_007414 Ga0501234_007414_1123_1572 145
310 3300049741 Ga0501079_0377557 Ga0501079_0377557_132_578 145
311 3300049741 Ga0501079_1125100 Ga0501079_1125100_137_583 145
312 3300049742 Ga0501080_0014656 Ga0501080_0014656_6639_7085 145
313 3300049742 Ga0501080_0099834 Ga0501080_0099834_500_946 145
314 3300049743 Ga0501081_0006873 Ga0501081_0006873_5795_6241 145
315 3300049744 Ga0501083_0001706 Ga0501083_0001706_10232_10678 145
316 3300049759 Ga0501262_005084 Ga0501262_005084_1040_1489 145
317 3300049765 Ga0501268_181934 Ga0501268_181934_12_464 145
318 3300049770 Ga0501273_000881 Ga0501273_000881_1835_2284 145
319 3300049772 Ga0501275_001516 Ga0501275_001516_1747_2196 145
320 3300049776 Ga0501280_011180 Ga0501280_011180_580_1029 145
321 3300049779 Ga0501283_000944 Ga0501283_000944_544_993 145
322 3300049823 Ga0501044_0093774 Ga0501044_0093774_1161_1610 145
323 3300049824 Ga0501045_0446618 Ga0501045_0446618_314_769 145
324 3300050491 nmdc:mga00v17_1648_c1 nmdc:mga00v17_1648_c1_6683_7165 145
325 3300050492 nmdc:mga0yw44_146612_c1 nmdc:mga0yw44_146612_c1_550_1032 145
326 3300050507 nmdc:mga05p37_563959_c1 nmdc:mga05p37_563959_c1_699_1139 145
327 3300050508 nmdc:mga09592_833497_c1 nmdc:mga09592_833497_c1_90_530 145
328 3300050512 nmdc:mga0n895_58732_c1 nmdc:mga0n895_58732_c1_1575_2024 145
329 3300050514 nmdc:mga08x19_3311_c1 nmdc:mga08x19_3311_c1_1171_1617 145
330 3300050514 nmdc:mga08x19_439364_c1 nmdc:mga08x19_439364_c1_160_654 145
331 3300050515 nmdc:mga0a205_268417_c1 nmdc:mga0a205_268417_c1_221_715 145
332 3300050515 nmdc:mga0a205_527450_c1 nmdc:mga0a205_527450_c1_100_549 145
333 3300053085 Ga0495619_0433999 Ga0495619_0433999_422_868 145
334 3300054114 Ga0501084_0000549 Ga0501084_0000549_26517_26963 145
335 3300059421 Ga0590071_000752 Ga0590071_000752_1817_2269 145
336 3300059423 Ga0590074_005829 Ga0590074_005829_36_488 145
337 3300059424 Ga0590075_000724 Ga0590075_000724_6688_7140 145
338 3300059424 Ga0590075_038090 Ga0590075_038090_239_691 145
339 3300059426 Ga0590077_000579 Ga0590077_000579_5911_6363 145
340 3300060353 Ga0501082_0023190 Ga0501082_0023190_716_1162 145
341 3300060353 Ga0501082_0294607 Ga0501082_0294607_919_1368 145
342 3300061734 Ga0530510_0141810 Ga0530510_0141810_1251_1697 145
343 3300061734 Ga0530510_1064753 Ga0530510_1064753_93_542 145
344 3300005985 Ga0081539_10012295 Ga0081539_100122952 149
345 3300005985 Ga0081539_10232377 Ga0081539_102323771 149
346 3300031548 Ga0307408_100639077 Ga0307408_1006390771 149
347 3300032002 Ga0307416_100630727 Ga0307416_1006307272 149
348 3300037471 Ga0395905_0184749 Ga0395905_0184749_512_961 149
349 3300005289 Ga0065704_10311999 Ga0065704_103119992 150
350 3300005295 Ga0065707_10006581 Ga0065707_100065813 150
351 3300005328 Ga0070676_10008758 Ga0070676_100087583 150
352 3300005331 Ga0070670_100025936 Ga0070670_1000259364 150
353 3300005331 Ga0070670_100046891 Ga0070670_1000468912 150
354 3300005334 Ga0068869_100017195 Ga0068869_1000171953 150
355 3300005335 Ga0070666_10045707 Ga0070666_100457073 150
356 3300005339 Ga0070660_100043284 Ga0070660_1000432844 150
357 3300005340 Ga0070689_100079681 Ga0070689_1000796812 150
358 3300005343 Ga0070687_100010350 Ga0070687_1000103502 150
359 3300005344 Ga0070661_100000724 Ga0070661_1000007244 150
360 3300005344 Ga0070661_100600434 Ga0070661_1006004342 150
361 3300005345 Ga0070692_10001371 Ga0070692_100013713 150
362 3300005347 Ga0070668_100000182 Ga0070668_1000001826 150
363 3300005353 Ga0070669_100026730 Ga0070669_1000267303 150
364 3300005355 Ga0070671_100781160 Ga0070671_1007811602 150
365 3300005364 Ga0070673_100133537 Ga0070673_1001335373 150
366 3300005365 Ga0070688_100040021 Ga0070688_1000400212 150
367 3300005367 Ga0070667_100025028 Ga0070667_1000250285 150
368 3300005438 Ga0070701_10038473 Ga0070701_100384732 150
369 3300005441 Ga0070700_100017031 Ga0070700_1000170315 150
370 3300005455 Ga0070663_100006609 Ga0070663_1000066093 150
371 3300005457 Ga0070662_100004769 Ga0070662_1000047694 150
372 3300005467 Ga0070706_100778547 Ga0070706_1007785472 150
373 3300005535 Ga0070684_100006603 Ga0070684_1000066037 150
374 3300005535 Ga0070684_100460518 Ga0070684_1004605182 150
375 3300005539 Ga0068853_100007829 Ga0068853_1000078295 150
376 3300005543 Ga0070672_100151044 Ga0070672_1001510442 150
377 3300005564 Ga0070664_100018704 Ga0070664_1000187042 150
378 3300005564 Ga0070664_100096585 Ga0070664_1000965852 150
379 3300005577 Ga0068857_100008564 Ga0068857_1000085645 150
380 3300005578 Ga0068854_100094259 Ga0068854_1000942593 150
381 3300005616 Ga0068852_100003909 Ga0068852_1000039094 150
382 3300005616 Ga0068852_102442440 Ga0068852_1024424401 150
383 3300005617 Ga0068859_101816209 Ga0068859_1018162092 150
384 3300005618 Ga0068864_101017904 Ga0068864_1010179042 150
385 3300005719 Ga0068861_100001153 Ga0068861_1000011535 150
386 3300005834 Ga0068851_10258320 Ga0068851_102583202 150
387 3300005841 Ga0068863_100004308 Ga0068863_1000043089 150
388 3300005844 Ga0068862_100006895 Ga0068862_1000068954 150
389 3300006844 Ga0075428_100753488 Ga0075428_1007534882 150
390 3300006871 Ga0075434_100057144 Ga0075434_1000571443 150
391 3300006880 Ga0075429_100271270 Ga0075429_1002712701 150
392 3300006881 Ga0068865_100000702 Ga0068865_1000007022 150
393 3300006931 Ga0097620_101816855 Ga0097620_1018168551 150
394 3300009094 Ga0111539_10166833 Ga0111539_101668333 150
395 3300009098 Ga0105245_10058536 Ga0105245_100585363 150
396 3300009147 Ga0114129_10149064 Ga0114129_101490643 150
397 3300009177 Ga0105248_10090358 Ga0105248_100903583 150
398 3300009553 Ga0105249_10005699 Ga0105249_100056995 150
399 3300010375 Ga0105239_10221683 Ga0105239_102216833 150
400 3300013306 Ga0163162_10009031 Ga0163162_100090314 150
401 3300013308 Ga0157375_10184589 Ga0157375_101845891 150
402 3300014325 Ga0163163_10002771 Ga0163163_100027712 150
403 3300014326 Ga0157380_10021085 Ga0157380_100210855 150
404 3300014968 Ga0157379_10001669 Ga0157379_100016698 150
405 3300025315 Ga0207697_10000742 Ga0207697_1000074212 150
406 3300025321 Ga0207656_10027736 Ga0207656_100277363 150
407 3300025901 Ga0207688_10051245 Ga0207688_100512452 150
408 3300025904 Ga0207647_10024268 Ga0207647_100242683 150
409 3300025907 Ga0207645_10036966 Ga0207645_100369663 150
410 3300025918 Ga0207662_10112904 Ga0207662_101129042 150
411 3300025919 Ga0207657_10029607 Ga0207657_100296073 150
412 3300025920 Ga0207649_10003779 Ga0207649_100037794 150
413 3300025920 Ga0207649_10948177 Ga0207649_109481772 150
414 3300025923 Ga0207681_10012578 Ga0207681_100125785 150
415 3300025925 Ga0207650_10010095 Ga0207650_100100952 150
416 3300025925 Ga0207650_10122958 Ga0207650_101229582 150
417 3300025926 Ga0207659_10051584 Ga0207659_100515842 150
418 3300025927 Ga0207687_10040661 Ga0207687_100406612 150
419 3300025932 Ga0207690_10084214 Ga0207690_100842142 150
420 3300025933 Ga0207706_10000364 Ga0207706_1000036431 150
421 3300025938 Ga0207704_10013881 Ga0207704_100138813 150
422 3300025940 Ga0207691_10000745 Ga0207691_1000074522 150
423 3300025942 Ga0207689_10003089 Ga0207689_100030893 150
424 3300025944 Ga0207661_10045533 Ga0207661_100455332 150
425 3300025944 Ga0207661_10102834 Ga0207661_101028342 150
426 3300025945 Ga0207679_10005109 Ga0207679_100051095 150
427 3300025949 Ga0207667_10095274 Ga0207667_100952744 150
428 3300025960 Ga0207651_10274551 Ga0207651_102745512 150
429 3300025961 Ga0207712_10007974 Ga0207712_100079745 150
430 3300025972 Ga0207668_10002709 Ga0207668_100027095 150
431 3300025981 Ga0207640_10164215 Ga0207640_101642152 150
432 3300025986 Ga0207658_10068953 Ga0207658_100689532 150
433 3300026023 Ga0207677_10013812 Ga0207677_100138125 150
434 3300026075 Ga0207708_10061417 Ga0207708_100614173 150
435 3300026088 Ga0207641_10100325 Ga0207641_101003253 150
436 3300026089 Ga0207648_10767682 Ga0207648_107676822 150
437 3300026116 Ga0207674_10000658 Ga0207674_1000065828 150
438 3300026118 Ga0207675_100000030 Ga0207675_10000003060 150
439 3300026142 Ga0207698_10035105 Ga0207698_100351053 150
440 3300026142 Ga0207698_10807453 Ga0207698_108074532 150
441 3300028379 Ga0268266_10184569 Ga0268266_101845692 150
442 3300028380 Ga0268265_10015959 Ga0268265_100159592 150
443 3300035114 Ga0373939_0281701 Ga0373939_0281701_17_469 150
444 3300035242 Ga0373962_0022101 Ga0373962_0022101_892_1344 150
445 3300042157 Ga0439458_0123929 Ga0439458_0123929_58_510 150
446 3300042876 Ga0451577_0000005 Ga0451577_0000005_70974_71426 150
447 3300044712 Ga0453684_1502406 Ga0453684_1502406_39_491 150
448 3300048912 Ga0496109_0438452 Ga0496109_0438452_574_1026 150
449 3300048912 Ga0496109_0714961 Ga0496109_0714961_133_585 150
450 3300050511 nmdc:mga08y16_21058_c1 nmdc:mga08y16_21058_c1_661_1113 150
451 3300050512 nmdc:mga0n895_10726_c1 nmdc:mga0n895_10726_c1_5284_5736 150
452 3300050513 nmdc:mga0rr50_554298_c1 nmdc:mga0rr50_554298_c1_20_472 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

38

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9661 1 150
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9628 1 150
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9601 1 149
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9596 1 150
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9563 1 150
ID Description Score Start End Superfamily
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9628 1 150 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9601 1 149 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.96 1 150 3.50.80.10
af_Q5AEI9_1_136_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9567 35 146 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9563 1 150 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A524H0K9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9962 1 150 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-C0EKJ7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9954 2 148 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A154TUE1-F1-model_v4 deleted 0.9951 2 148
AF-A0A1C6DGN8-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9949 1 149 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-R6Z1P1-F1-model_v4 deleted 0.9928 1 150

Feature Viewer

pLDDT pTM Quality
96.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map