F447050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 452 | 274 | 452 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0050495|Ga0495628_0050495_202_750 |
| Length | 182 |
| Sequence | MEYSEAERQRGAIRRLAGSGLAHSVWDILATPGAKAMRAVVQRVSRASVEIDGESVGSIGAGLVVLLGVTHDDTADKAKWLAEKIVGLRIFNDADVKMNRDLTEVGGAMLIVSQFTLYGDCRKGKRPSFIDAAPPPIAIPLYEAFINGVKALGIPVATGRFGADMKVELINDGPVTLIVESK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 185 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 186 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 187 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 192 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 242 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 245 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 253 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 254 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 271 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 94.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10311999 | 3300005289 | Bacteria | 867 |
| 2 | Ga0065707_10006581 | 3300005295 | Bacteria | 4315 |
| 3 | Ga0070676_10008758 | 3300005328 | Bacteria | 5461 |
| 4 | Ga0070670_100025936 | 3300005331 | Bacteria | 5043 |
| 5 | Ga0070670_100046891 | 3300005331 | Bacteria | 3717 |
| 6 | Ga0070670_100187157 | 3300005331 | Bacteria | 1798 |
| 7 | Ga0070670_100450081 | 3300005331 | Bacteria | 1141 |
| 8 | Ga0068869_100017195 | 3300005334 | Bacteria | 4896 |
| 9 | Ga0070666_10045707 | 3300005335 | Bacteria | 2935 |
| 10 | Ga0068868_100701615 | 3300005338 | Bacteria | 905 |
| 11 | Ga0070660_100043284 | 3300005339 | Bacteria | 3441 |
| 12 | Ga0070689_100079681 | 3300005340 | Bacteria | 2569 |
| 13 | Ga0070687_100010350 | 3300005343 | Bacteria | 4031 |
| 14 | Ga0070687_100021899 | 3300005343 | Bacteria | 3013 |
| 15 | Ga0070661_100000724 | 3300005344 | Bacteria | 24118 |
| 16 | Ga0070661_100343890 | 3300005344 | Bacteria | 1169 |
| 17 | Ga0070661_100600434 | 3300005344 | Bacteria | 890 |
| 18 | Ga0070692_10001371 | 3300005345 | Bacteria | 8794 |
| 19 | Ga0070668_100000182 | 3300005347 | Bacteria | 40680 |
| 20 | Ga0070668_100214254 | 3300005347 | Bacteria | 1586 |
| 21 | Ga0070668_100313867 | 3300005347 | Bacteria | 1318 |
| 22 | Ga0070669_100026730 | 3300005353 | Bacteria | 4152 |
| 23 | Ga0070669_100324249 | 3300005353 | Bacteria | 1244 |
| 24 | Ga0070671_100781160 | 3300005355 | Bacteria | 831 |
| 25 | Ga0070673_100133537 | 3300005364 | Bacteria | 2086 |
| 26 | Ga0070688_100040021 | 3300005365 | Bacteria | 2871 |
| 27 | Ga0070688_100066368 | 3300005365 | Bacteria | 2296 |
| 28 | Ga0070667_100025028 | 3300005367 | Bacteria | 4960 |
| 29 | Ga0070709_10037792 | 3300005434 | Bacteria | 2951 |
| 30 | Ga0070709_10187972 | 3300005434 | Bacteria | 1455 |
| 31 | Ga0070714_100018598 | 3300005435 | Bacteria | 5648 |
| 32 | Ga0070714_101792930 | 3300005435 | Unclassified | 599 |
| 33 | Ga0070713_100004065 | 3300005436 | Bacteria | 9738 |
| 34 | Ga0070710_10039803 | 3300005437 | Bacteria | 2588 |
| 35 | Ga0070701_10038473 | 3300005438 | Bacteria | 2421 |
| 36 | Ga0070701_10856628 | 3300005438 | Bacteria | 624 |
| 37 | Ga0070711_100002710 | 3300005439 | Bacteria | 10161 |
| 38 | Ga0070711_100363650 | 3300005439 | Bacteria | 1166 |
| 39 | Ga0070711_100479566 | 3300005439 | Bacteria | 1022 |
| 40 | Ga0070705_100365669 | 3300005440 | Bacteria | 1057 |
| 41 | Ga0070700_100017031 | 3300005441 | Bacteria | 4150 |
| 42 | Ga0070700_100297188 | 3300005441 | Bacteria | 1177 |
| 43 | Ga0070700_101558411 | 3300005441 | Bacteria | 563 |
| 44 | Ga0070694_100011220 | 3300005444 | Bacteria | 5548 |
| 45 | Ga0070694_100229779 | 3300005444 | Bacteria | 1395 |
| 46 | Ga0070708_100077595 | 3300005445 | Bacteria | 3002 |
| 47 | Ga0070708_100415978 | 3300005445 | Unclassified | 1268 |
| 48 | Ga0070708_100669903 | 3300005445 | Bacteria | 977 |
| 49 | Ga0070663_100006609 | 3300005455 | Bacteria | 6990 |
| 50 | Ga0070663_100196524 | 3300005455 | Bacteria | 1572 |
| 51 | Ga0070678_100036356 | 3300005456 | Bacteria | 3447 |
| 52 | Ga0070678_100705683 | 3300005456 | Bacteria | 909 |
| 53 | Ga0070662_100004769 | 3300005457 | Bacteria | 8590 |
| 54 | Ga0070662_100378868 | 3300005457 | Bacteria | 1164 |
| 55 | Ga0070706_100047365 | 3300005467 | Bacteria | 3967 |
| 56 | Ga0070706_100048850 | 3300005467 | Bacteria | 3904 |
| 57 | Ga0070706_100778547 | 3300005467 | Bacteria | 886 |
| 58 | Ga0070707_100000704 | 3300005468 | Bacteria | 33310 |
| 59 | Ga0070707_100463783 | 3300005468 | Bacteria | 1228 |
| 60 | Ga0070698_100001198 | 3300005471 | Bacteria | 28769 |
| 61 | Ga0070698_100097114 | 3300005471 | Bacteria | 2922 |
| 62 | Ga0070698_100378030 | 3300005471 | Bacteria | 1349 |
| 63 | Ga0070698_100717785 | 3300005471 | Bacteria | 942 |
| 64 | Ga0070698_100857804 | 3300005471 | Unclassified | 853 |
| 65 | Ga0070699_100000699 | 3300005518 | Bacteria | 31141 |
| 66 | Ga0070699_100167156 | 3300005518 | Bacteria | 1948 |
| 67 | Ga0070699_100331012 | 3300005518 | Bacteria | 1370 |
| 68 | Ga0070699_100653433 | 3300005518 | Bacteria | 960 |
| 69 | Ga0070679_100064781 | 3300005530 | Bacteria | 3642 |
| 70 | Ga0070684_100006603 | 3300005535 | Bacteria | 8986 |
| 71 | Ga0070684_100460518 | 3300005535 | Bacteria | 1176 |
| 72 | Ga0070684_101707560 | 3300005535 | Bacteria | 594 |
| 73 | Ga0070697_100000114 | 3300005536 | Bacteria | 63225 |
| 74 | Ga0070697_100012893 | 3300005536 | Bacteria | 6549 |
| 75 | Ga0070697_100343066 | 3300005536 | Unclassified | 1289 |
| 76 | Ga0070697_100879007 | 3300005536 | Bacteria | 795 |
| 77 | Ga0070697_101052028 | 3300005536 | Unclassified | 724 |
| 78 | Ga0068853_100007829 | 3300005539 | Bacteria | 8569 |
| 79 | Ga0070672_100151044 | 3300005543 | Bacteria | 1921 |
| 80 | Ga0070672_101646838 | 3300005543 | Unclassified | 576 |
| 81 | Ga0070695_100959153 | 3300005545 | Unclassified | 694 |
| 82 | Ga0070696_100005390 | 3300005546 | Bacteria | 8531 |
| 83 | Ga0070665_101085070 | 3300005548 | Unclassified | 812 |
| 84 | Ga0070704_100089729 | 3300005549 | Bacteria | 2287 |
| 85 | Ga0070704_100468722 | 3300005549 | Unclassified | 1088 |
| 86 | Ga0070704_100876213 | 3300005549 | Bacteria | 806 |
| 87 | Ga0068855_100378307 | 3300005563 | Bacteria | 1555 |
| 88 | Ga0070664_100018704 | 3300005564 | Bacteria | 5698 |
| 89 | Ga0070664_100096585 | 3300005564 | Bacteria | 2564 |
| 90 | Ga0068857_100008564 | 3300005577 | Bacteria | 8846 |
| 91 | Ga0068857_100616366 | 3300005577 | Bacteria | 1026 |
| 92 | Ga0068854_100094259 | 3300005578 | Bacteria | 2233 |
| 93 | Ga0068854_100215637 | 3300005578 | Bacteria | 1516 |
| 94 | Ga0068852_100003909 | 3300005616 | Bacteria | 10468 |
| 95 | Ga0068852_102442440 | 3300005616 | Bacteria | 543 |
| 96 | Ga0068859_100157009 | 3300005617 | Bacteria | 2353 |
| 97 | Ga0068859_101816209 | 3300005617 | Bacteria | 673 |
| 98 | Ga0068859_102251957 | 3300005617 | Bacteria | 601 |
| 99 | Ga0068864_101017904 | 3300005618 | Bacteria | 822 |
| 100 | Ga0068864_102185531 | 3300005618 | Bacteria | 560 |
| 101 | Ga0068861_100001153 | 3300005719 | Bacteria | 16459 |
| 102 | Ga0068861_100692609 | 3300005719 | Bacteria | 946 |
| 103 | Ga0068851_10258320 | 3300005834 | Bacteria | 990 |
| 104 | Ga0068863_100004308 | 3300005841 | Bacteria | 14018 |
| 105 | Ga0068860_100167630 | 3300005843 | Bacteria | 2120 |
| 106 | Ga0068862_100006895 | 3300005844 | Bacteria | 9420 |
| 107 | Ga0068862_100332499 | 3300005844 | Bacteria | 1405 |
| 108 | Ga0068862_100897249 | 3300005844 | Bacteria | 871 |
| 109 | Ga0068862_101060861 | 3300005844 | Bacteria | 804 |
| 110 | Ga0081539_10012295 | 3300005985 | Bacteria | 6622 |
| 111 | Ga0081539_10141963 | 3300005985 | Bacteria | 1166 |
| 112 | Ga0081539_10232377 | 3300005985 | Bacteria | 831 |
| 113 | Ga0070717_10001379 | 3300006028 | Bacteria | 16726 |
| 114 | Ga0070717_10150395 | 3300006028 | Bacteria | 2014 |
| 115 | Ga0070717_10250482 | 3300006028 | Bacteria | 1565 |
| 116 | Ga0070717_11325275 | 3300006028 | Bacteria | 654 |
| 117 | Ga0075365_10145244 | 3300006038 | Bacteria | 1648 |
| 118 | Ga0075363_100031344 | 3300006048 | Bacteria | 2756 |
| 119 | Ga0075364_10010210 | 3300006051 | Bacteria | 5663 |
| 120 | Ga0070715_10141694 | 3300006163 | Unclassified | 1168 |
| 121 | Ga0070715_10274260 | 3300006163 | Unclassified | 891 |
| 122 | Ga0070715_10565147 | 3300006163 | Unclassified | 661 |
| 123 | Ga0070716_100000749 | 3300006173 | Bacteria | 13903 |
| 124 | Ga0070716_100057566 | 3300006173 | Unclassified | 2234 |
| 125 | Ga0070712_100000055 | 3300006175 | Bacteria | 57367 |
| 126 | Ga0070712_100238336 | 3300006175 | Bacteria | 1448 |
| 127 | Ga0075362_10000017 | 3300006177 | Bacteria | 77754 |
| 128 | Ga0075428_100209385 | 3300006844 | Bacteria | 2107 |
| 129 | Ga0075428_100753488 | 3300006844 | Bacteria | 1036 |
| 130 | Ga0075434_100057144 | 3300006871 | Bacteria | 3878 |
| 131 | Ga0075434_100691221 | 3300006871 | Unclassified | 1038 |
| 132 | Ga0075429_100271270 | 3300006880 | Bacteria | 1486 |
| 133 | Ga0068865_100000702 | 3300006881 | Bacteria | 18828 |
| 134 | Ga0075436_100058491 | 3300006914 | Bacteria | 2662 |
| 135 | Ga0075436_100507646 | 3300006914 | Bacteria | 882 |
| 136 | Ga0075436_100574284 | 3300006914 | Bacteria | 829 |
| 137 | Ga0097620_100157012 | 3300006931 | Bacteria | 2353 |
| 138 | Ga0097620_101816855 | 3300006931 | Bacteria | 673 |
| 139 | Ga0097620_102251579 | 3300006931 | Bacteria | 601 |
| 140 | Ga0111539_10166833 | 3300009094 | Bacteria | 2574 |
| 141 | Ga0105245_10058536 | 3300009098 | Bacteria | 3468 |
| 142 | Ga0114129_10149064 | 3300009147 | Bacteria | 3202 |
| 143 | Ga0114129_10514732 | 3300009147 | Bacteria | 1561 |
| 144 | Ga0114129_10913867 | 3300009147 | Bacteria | 1111 |
| 145 | Ga0105243_11098941 | 3300009148 | Unclassified | 803 |
| 146 | Ga0105241_10678557 | 3300009174 | Unclassified | 938 |
| 147 | Ga0105241_11931289 | 3300009174 | Unclassified | 579 |
| 148 | Ga0105248_10090358 | 3300009177 | Bacteria | 3448 |
| 149 | Ga0105248_11436448 | 3300009177 | Bacteria | 781 |
| 150 | Ga0105238_10454604 | 3300009551 | Bacteria | 1278 |
| 151 | Ga0105238_12357702 | 3300009551 | Unclassified | 567 |
| 152 | Ga0105249_10005699 | 3300009553 | Bacteria | 10767 |
| 153 | Ga0105249_10274862 | 3300009553 | Bacteria | 1680 |
| 154 | Ga0105249_12009261 | 3300009553 | Bacteria | 651 |
| 155 | Ga0105239_10221683 | 3300010375 | Bacteria | 2121 |
| 156 | Ga0157371_10029672 | 3300013102 | Bacteria | 3952 |
| 157 | Ga0157371_10249366 | 3300013102 | Bacteria | 1278 |
| 158 | Ga0157370_10264783 | 3300013104 | Bacteria | 1588 |
| 159 | Ga0163162_10009031 | 3300013306 | Bacteria | 9687 |
| 160 | Ga0163162_10641653 | 3300013306 | Bacteria | 1186 |
| 161 | Ga0157372_10141429 | 3300013307 | Bacteria | 2772 |
| 162 | Ga0157372_10166063 | 3300013307 | Bacteria | 2553 |
| 163 | Ga0157372_10801799 | 3300013307 | Bacteria | 1094 |
| 164 | Ga0157375_10184589 | 3300013308 | Bacteria | 2238 |
| 165 | Ga0157375_11553587 | 3300013308 | Unclassified | 782 |
| 166 | Ga0163163_10002771 | 3300014325 | Bacteria | 14797 |
| 167 | Ga0163163_10061891 | 3300014325 | Bacteria | 3709 |
| 168 | Ga0157380_10021085 | 3300014326 | Bacteria | 4882 |
| 169 | Ga0157380_11195741 | 3300014326 | Bacteria | 804 |
| 170 | Ga0157379_10001669 | 3300014968 | Bacteria | 18349 |
| 171 | Ga0157376_10969225 | 3300014969 | Bacteria | 872 |
| 172 | Ga0213876_10010704 | 3300021384 | Bacteria | 4914 |
| 173 | Ga0213876_10087550 | 3300021384 | Unclassified | 1649 |
| 174 | Ga0207697_10000742 | 3300025315 | Bacteria | 18463 |
| 175 | Ga0207656_10027736 | 3300025321 | Bacteria | 2318 |
| 176 | Ga0207692_10405866 | 3300025898 | Unclassified | 850 |
| 177 | Ga0207688_10051245 | 3300025901 | Bacteria | 2312 |
| 178 | Ga0207680_10548957 | 3300025903 | Bacteria | 825 |
| 179 | Ga0207647_10024268 | 3300025904 | Bacteria | 4000 |
| 180 | Ga0207685_10141480 | 3300025905 | Unclassified | 1079 |
| 181 | Ga0207685_10162586 | 3300025905 | Unclassified | 1020 |
| 182 | Ga0207699_10126142 | 3300025906 | Bacteria | 1662 |
| 183 | Ga0207699_10382363 | 3300025906 | Unclassified | 999 |
| 184 | Ga0207645_10036966 | 3300025907 | Bacteria | 3135 |
| 185 | Ga0207684_10000274 | 3300025910 | Bacteria | 76497 |
| 186 | Ga0207684_10133284 | 3300025910 | Unclassified | 2133 |
| 187 | Ga0207684_10205201 | 3300025910 | Unclassified | 1700 |
| 188 | Ga0207684_10990611 | 3300025910 | Bacteria | 703 |
| 189 | Ga0207707_10403564 | 3300025912 | Bacteria | 1173 |
| 190 | Ga0207693_10000143 | 3300025915 | Bacteria | 65412 |
| 191 | Ga0207663_10004972 | 3300025916 | Bacteria | 6661 |
| 192 | Ga0207663_10135011 | 3300025916 | Bacteria | 1711 |
| 193 | Ga0207663_10364190 | 3300025916 | Bacteria | 1097 |
| 194 | Ga0207662_10065289 | 3300025918 | Bacteria | 2192 |
| 195 | Ga0207662_10112904 | 3300025918 | Bacteria | 1696 |
| 196 | Ga0207657_10029607 | 3300025919 | Bacteria | 4982 |
| 197 | Ga0207657_10101701 | 3300025919 | Bacteria | 2385 |
| 198 | Ga0207649_10003779 | 3300025920 | Bacteria | 8260 |
| 199 | Ga0207649_10191463 | 3300025920 | Bacteria | 1439 |
| 200 | Ga0207649_10948177 | 3300025920 | Bacteria | 676 |
| 201 | Ga0207652_10612107 | 3300025921 | Bacteria | 976 |
| 202 | Ga0207646_10000240 | 3300025922 | Bacteria | 75609 |
| 203 | Ga0207646_10085446 | 3300025922 | Bacteria | 2823 |
| 204 | Ga0207646_10287250 | 3300025922 | Unclassified | 1486 |
| 205 | Ga0207681_10012578 | 3300025923 | Bacteria | 5225 |
| 206 | Ga0207681_10321614 | 3300025923 | Bacteria | 1230 |
| 207 | Ga0207681_11612361 | 3300025923 | Bacteria | 543 |
| 208 | Ga0207650_10010095 | 3300025925 | Bacteria | 6469 |
| 209 | Ga0207650_10115903 | 3300025925 | Bacteria | 2080 |
| 210 | Ga0207650_10122958 | 3300025925 | Bacteria | 2023 |
| 211 | Ga0207650_10329126 | 3300025925 | Bacteria | 1253 |
| 212 | Ga0207659_10051584 | 3300025926 | Bacteria | 2926 |
| 213 | Ga0207687_10040661 | 3300025927 | Bacteria | 3189 |
| 214 | Ga0207700_10007254 | 3300025928 | Bacteria | 6762 |
| 215 | Ga0207700_10071634 | 3300025928 | Bacteria | 2669 |
| 216 | Ga0207664_10005288 | 3300025929 | Bacteria | 8815 |
| 217 | Ga0207690_10084214 | 3300025932 | Bacteria | 2228 |
| 218 | Ga0207706_10000364 | 3300025933 | Bacteria | 48974 |
| 219 | Ga0207706_10136474 | 3300025933 | Bacteria | 2158 |
| 220 | Ga0207706_10378080 | 3300025933 | Unclassified | 1229 |
| 221 | Ga0207670_10222804 | 3300025936 | Bacteria | 1445 |
| 222 | Ga0207704_10013881 | 3300025938 | Bacteria | 4050 |
| 223 | Ga0207665_10004344 | 3300025939 | Bacteria | 9414 |
| 224 | Ga0207665_10078429 | 3300025939 | Bacteria | 2269 |
| 225 | Ga0207691_10000745 | 3300025940 | Bacteria | 32134 |
| 226 | Ga0207711_10030446 | 3300025941 | Bacteria | 4552 |
| 227 | Ga0207689_10003089 | 3300025942 | Bacteria | 15318 |
| 228 | Ga0207661_10045533 | 3300025944 | Bacteria | 3473 |
| 229 | Ga0207661_10102834 | 3300025944 | Bacteria | 2403 |
| 230 | Ga0207661_10180769 | 3300025944 | Bacteria | 1842 |
| 231 | Ga0207679_10005109 | 3300025945 | Bacteria | 8207 |
| 232 | Ga0207667_10095274 | 3300025949 | Bacteria | 3073 |
| 233 | Ga0207667_10301947 | 3300025949 | Bacteria | 1636 |
| 234 | Ga0207651_10274551 | 3300025960 | Bacteria | 1390 |
| 235 | Ga0207651_11197054 | 3300025960 | Bacteria | 682 |
| 236 | Ga0207712_10007974 | 3300025961 | Bacteria | 6693 |
| 237 | Ga0207668_10002709 | 3300025972 | Bacteria | 10367 |
| 238 | Ga0207668_10163160 | 3300025972 | Bacteria | 1739 |
| 239 | Ga0207668_10240223 | 3300025972 | Bacteria | 1465 |
| 240 | Ga0207668_10303211 | 3300025972 | Bacteria | 1319 |
| 241 | Ga0207640_10164215 | 3300025981 | Bacteria | 1647 |
| 242 | Ga0207658_10068953 | 3300025986 | Bacteria | 2670 |
| 243 | Ga0207677_10013812 | 3300026023 | Bacteria | 4691 |
| 244 | Ga0207677_11327860 | 3300026023 | Bacteria | 661 |
| 245 | Ga0207678_10376209 | 3300026067 | Bacteria | 1227 |
| 246 | Ga0207708_10061417 | 3300026075 | Bacteria | 2870 |
| 247 | Ga0207641_10100325 | 3300026088 | Bacteria | 2549 |
| 248 | Ga0207648_10767682 | 3300026089 | Bacteria | 896 |
| 249 | Ga0207674_10000658 | 3300026116 | Bacteria | 44902 |
| 250 | Ga0207674_10164638 | 3300026116 | Bacteria | 2172 |
| 251 | Ga0207675_100000030 | 3300026118 | Bacteria | 109178 |
| 252 | Ga0207683_10082572 | 3300026121 | Bacteria | 2855 |
| 253 | Ga0207683_10247695 | 3300026121 | Bacteria | 1626 |
| 254 | Ga0207698_10035105 | 3300026142 | Bacteria | 3665 |
| 255 | Ga0207698_10807453 | 3300026142 | Bacteria | 941 |
| 256 | Ga0209588_1135723 | 3300027671 | Bacteria | 784 |
| 257 | Ga0268266_10184569 | 3300028379 | Bacteria | 1901 |
| 258 | Ga0268266_10247083 | 3300028379 | Bacteria | 1649 |
| 259 | Ga0268266_10263242 | 3300028379 | Bacteria | 1599 |
| 260 | Ga0268265_10015959 | 3300028380 | Bacteria | 5153 |
| 261 | Ga0268265_10144596 | 3300028380 | Unclassified | 1996 |
| 262 | Ga0265338_10390274 | 3300028800 | Unclassified | 994 |
| 263 | Ga0265339_10022588 | 3300031249 | Bacteria | 3644 |
| 264 | Ga0307408_100149856 | 3300031548 | Bacteria | 1840 |
| 265 | Ga0307408_100639077 | 3300031548 | Bacteria | 950 |
| 266 | Ga0307408_102467710 | 3300031548 | Bacteria | 505 |
| 267 | Ga0316576_10033551 | 3300031727 | Bacteria | 3655 |
| 268 | Ga0307405_10034005 | 3300031731 | Unclassified | 3029 |
| 269 | Ga0316577_10006078 | 3300031733 | Bacteria | 6364 |
| 270 | Ga0307413_10007618 | 3300031824 | Bacteria | 5046 |
| 271 | Ga0307413_10074174 | 3300031824 | Bacteria | 2154 |
| 272 | Ga0307410_10021376 | 3300031852 | Bacteria | 3979 |
| 273 | Ga0307410_10025524 | 3300031852 | Bacteria | 3709 |
| 274 | Ga0307406_10003212 | 3300031901 | Bacteria | 8896 |
| 275 | Ga0307407_10028244 | 3300031903 | Bacteria | 2997 |
| 276 | Ga0307407_10034321 | 3300031903 | Bacteria | 2776 |
| 277 | Ga0307407_10056492 | 3300031903 | Unclassified | 2273 |
| 278 | Ga0307412_10110696 | 3300031911 | Unclassified | 1960 |
| 279 | Ga0307412_10574255 | 3300031911 | Bacteria | 951 |
| 280 | Ga0307409_100059508 | 3300031995 | Bacteria | 2973 |
| 281 | Ga0307409_100152134 | 3300031995 | Bacteria | 2010 |
| 282 | Ga0307409_100180855 | 3300031995 | Unclassified | 1866 |
| 283 | Ga0307416_100052096 | 3300032002 | Bacteria | 3274 |
| 284 | Ga0307416_100630727 | 3300032002 | Bacteria | 1155 |
| 285 | Ga0307414_10012633 | 3300032004 | Bacteria | 5003 |
| 286 | Ga0307411_10021705 | 3300032005 | Bacteria | 3763 |
| 287 | Ga0307411_11153274 | 3300032005 | Bacteria | 701 |
| 288 | Ga0373926_0373424 | 3300035083 | Unclassified | 561 |
| 289 | Ga0373934_0146473 | 3300035086 | Bacteria | 966 |
| 290 | Ga0373940_0110408 | 3300035088 | Bacteria | 844 |
| 291 | Ga0373944_0061946 | 3300035089 | Unclassified | 1202 |
| 292 | Ga0373923_0009530 | 3300035111 | Bacteria | 3508 |
| 293 | Ga0373936_0003338 | 3300035113 | Bacteria | 6018 |
| 294 | Ga0373939_0281701 | 3300035114 | Bacteria | 657 |
| 295 | Ga0373953_0069078 | 3300035117 | Bacteria | 1455 |
| 296 | Ga0373954_0017999 | 3300035118 | Bacteria | 3177 |
| 297 | Ga0373956_0011117 | 3300035119 | Bacteria | 3706 |
| 298 | Ga0373943_0067783 | 3300035170 | Unclassified | 1800 |
| 299 | Ga0373943_0617821 | 3300035170 | Unclassified | 639 |
| 300 | Ga0373946_0097046 | 3300035171 | Bacteria | 1315 |
| 301 | Ga0373955_0005390 | 3300035172 | Bacteria | 5747 |
| 302 | Ga0373962_0022101 | 3300035242 | Bacteria | 1684 |
| 303 | Ga0373924_0042781 | 3300035410 | Bacteria | 1859 |
| 304 | Ga0373931_0088630 | 3300035691 | Bacteria | 1720 |
| 305 | Ga0373935_0171553 | 3300035692 | Bacteria | 1484 |
| 306 | Ga0373935_0369768 | 3300035692 | Unclassified | 1025 |
| 307 | Ga0373927_0061342 | 3300035695 | Bacteria | 2433 |
| 308 | Ga0373927_0090697 | 3300035695 | Bacteria | 1985 |
| 309 | Ga0373933_0176506 | 3300035724 | Bacteria | 1361 |
| 310 | Ga0373933_0208104 | 3300035724 | Unclassified | 1253 |
| 311 | Ga0373933_0702519 | 3300035724 | Unclassified | 665 |
| 312 | Ga0373947_0027915 | 3300035725 | Bacteria | 3306 |
| 313 | Ga0373937_0021479 | 3300036401 | Bacteria | 5793 |
| 314 | Ga0373937_0091454 | 3300036401 | Bacteria | 2820 |
| 315 | Ga0373937_0430218 | 3300036401 | Bacteria | 1253 |
| 316 | Ga0316584_0010650 | 3300036712 | Bacteria | 6437 |
| 317 | Ga0373925_0095858 | 3300037068 | Unclassified | 2273 |
| 318 | Ga0373925_0247942 | 3300037068 | Bacteria | 1428 |
| 319 | Ga0373925_0713950 | 3300037068 | Unclassified | 826 |
| 320 | Ga0395905_0044260 | 3300037471 | Bacteria | 4178 |
| 321 | Ga0395905_0184749 | 3300037471 | Bacteria | 1957 |
| 322 | Ga0436364_0107785 | 3300037853 | Unclassified | 2189 |
| 323 | Ga0436364_0864451 | 3300037853 | Bacteria | 627 |
| 324 | Ga0395901_0104363 | 3300038443 | Bacteria | 2975 |
| 325 | Ga0400485_20631 | 3300038735 | Bacteria | 5934 |
| 326 | Ga0400486_07431 | 3300038742 | Bacteria | 24844 |
| 327 | Ga0400483_050187 | 3300039062 | Bacteria | 12634 |
| 328 | Ga0400483_205332 | 3300039062 | Bacteria | 2720 |
| 329 | Ga0400489_90984 | 3300039093 | Bacteria | 13397 |
| 330 | Ga0436365_0329605 | 3300039437 | Bacteria | 1167 |
| 331 | Ga0436365_1152567 | 3300039437 | Bacteria | 4660 |
| 332 | Ga0436365_1453400 | 3300039437 | Bacteria | 5494 |
| 333 | Ga0436363_1042578 | 3300039450 | Bacteria | 684 |
| 334 | Ga0436362_0525528 | 3300039453 | Bacteria | 816 |
| 335 | Ga0451795_0313244 | 3300041456 | Bacteria | 3354 |
| 336 | Ga0439458_0123929 | 3300042157 | Bacteria | 682 |
| 337 | Ga0439458_0126524 | 3300042157 | Unclassified | 675 |
| 338 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 339 | Ga0451577_0160829 | 3300042876 | Bacteria | 2022 |
| 340 | Ga0453683_0005031 | 3300044673 | Bacteria | 9287 |
| 341 | Ga0453683_0206009 | 3300044673 | Bacteria | 1249 |
| 342 | Ga0466963_0778378 | 3300044694 | Bacteria | 675 |
| 343 | Ga0453684_0009782 | 3300044712 | Bacteria | 16639 |
| 344 | Ga0453684_0287752 | 3300044712 | Bacteria | 1872 |
| 345 | Ga0453684_1502406 | 3300044712 | Bacteria | 695 |
| 346 | Ga0451576_0804773 | 3300045051 | Unclassified | 987 |
| 347 | Ga0495629_0008416 | 3300046459 | Bacteria | 7591 |
| 348 | Ga0495629_0200744 | 3300046459 | Bacteria | 1379 |
| 349 | Ga0495580_0000561 | 3300046472 | Bacteria | 31371 |
| 350 | Ga0495639_0294179 | 3300046475 | Bacteria | 809 |
| 351 | Ga0495664_0093401 | 3300046477 | Bacteria | 1810 |
| 352 | Ga0495628_0050495 | 3300046516 | Bacteria | 3290 |
| 353 | Ga0495628_0280617 | 3300046516 | Bacteria | 1237 |
| 354 | Ga0495630_0009697 | 3300046517 | Bacteria | 6925 |
| 355 | Ga0495632_0018499 | 3300046519 | Bacteria | 3824 |
| 356 | Ga0495665_0165597 | 3300046531 | Bacteria | 1152 |
| 357 | Ga0495640_0575746 | 3300046533 | Unclassified | 681 |
| 358 | Ga0495645_0395077 | 3300046543 | Unclassified | 882 |
| 359 | Ga0495599_0031278 | 3300046678 | Bacteria | 3341 |
| 360 | Ga0495599_0054564 | 3300046678 | Bacteria | 2504 |
| 361 | Ga0495646_0205914 | 3300046680 | Bacteria | 1070 |
| 362 | Ga0495658_0014703 | 3300046683 | Bacteria | 4002 |
| 363 | Ga0495658_0065433 | 3300046683 | Unclassified | 2097 |
| 364 | Ga0495658_0611372 | 3300046683 | Unclassified | 698 |
| 365 | Ga0495613_0400058 | 3300046689 | Unclassified | 937 |
| 366 | Ga0495674_0009019 | 3300047319 | Bacteria | 9477 |
| 367 | Ga0495672_0001915 | 3300047320 | Bacteria | 19735 |
| 368 | Ga0496104_0247123 | 3300048907 | Bacteria | 1697 |
| 369 | Ga0496105_0335441 | 3300048908 | Bacteria | 1210 |
| 370 | Ga0496109_0438452 | 3300048912 | Bacteria | 1234 |
| 371 | Ga0496109_0714961 | 3300048912 | Bacteria | 939 |
| 372 | Ga0496112_0455512 | 3300048915 | Bacteria | 1217 |
| 373 | Ga0496115_0006349 | 3300048918 | Bacteria | 8658 |
| 374 | Ga0501298_036947 | 3300049521 | Bacteria | 979 |
| 375 | Ga0501033_0014379 | 3300049570 | Bacteria | 6012 |
| 376 | Ga0501034_0003338 | 3300049571 | Bacteria | 18320 |
| 377 | Ga0501034_0450814 | 3300049571 | Unclassified | 1204 |
| 378 | Ga0501034_0543814 | 3300049571 | Bacteria | 1071 |
| 379 | Ga0501034_0594696 | 3300049571 | Bacteria | 1012 |
| 380 | Ga0501037_0238012 | 3300049573 | Bacteria | 1276 |
| 381 | Ga0501038_0380071 | 3300049574 | Bacteria | 1096 |
| 382 | Ga0501039_1373805 | 3300049575 | Bacteria | 544 |
| 383 | Ga0501040_0016522 | 3300049576 | Bacteria | 4887 |
| 384 | Ga0501041_0205404 | 3300049577 | Bacteria | 1235 |
| 385 | Ga0501042_0012747 | 3300049578 | Bacteria | 5704 |
| 386 | Ga0501043_0136833 | 3300049579 | Bacteria | 1919 |
| 387 | Ga0501046_0295187 | 3300049580 | Bacteria | 1185 |
| 388 | Ga0501047_0302078 | 3300049581 | Unclassified | 1443 |
| 389 | Ga0501047_0971826 | 3300049581 | Bacteria | 662 |
| 390 | Ga0501067_0005478 | 3300049583 | Bacteria | 7039 |
| 391 | Ga0501067_0006189 | 3300049583 | Bacteria | 6636 |
| 392 | Ga0501068_0000339 | 3300049584 | Bacteria | 23563 |
| 393 | Ga0501068_0000537 | 3300049584 | Bacteria | 19150 |
| 394 | Ga0501069_0000336 | 3300049585 | Bacteria | 21210 |
| 395 | Ga0501069_0101611 | 3300049585 | Bacteria | 1632 |
| 396 | Ga0501070_0010846 | 3300049586 | Bacteria | 7697 |
| 397 | Ga0501070_0039481 | 3300049586 | Bacteria | 3937 |
| 398 | Ga0501071_0006402 | 3300049587 | Bacteria | 7642 |
| 399 | Ga0501071_0006897 | 3300049587 | Bacteria | 7407 |
| 400 | Ga0501071_0208871 | 3300049587 | Unclassified | 1468 |
| 401 | Ga0501072_0002957 | 3300049588 | Bacteria | 12799 |
| 402 | Ga0501072_0014524 | 3300049588 | Bacteria | 6034 |
| 403 | Ga0501072_0354762 | 3300049588 | Bacteria | 1164 |
| 404 | Ga0501072_1174879 | 3300049588 | Bacteria | 596 |
| 405 | Ga0501073_0011604 | 3300049589 | Bacteria | 6439 |
| 406 | Ga0501074_0000291 | 3300049590 | Bacteria | 29100 |
| 407 | Ga0501074_0009434 | 3300049590 | Bacteria | 7087 |
| 408 | Ga0501076_0160203 | 3300049592 | Bacteria | 1833 |
| 409 | Ga0501198_037481 | 3300049649 | Bacteria | 830 |
| 410 | Ga0501230_004055 | 3300049667 | Bacteria | 1987 |
| 411 | Ga0501239_000163 | 3300049672 | Bacteria | 4658 |
| 412 | Ga0501248_040130 | 3300049678 | Bacteria | 570 |
| 413 | Ga0501257_047651 | 3300049686 | Unclassified | 1063 |
| 414 | Ga0501234_007414 | 3300049707 | Unclassified | 1716 |
| 415 | Ga0501079_0377557 | 3300049741 | Bacteria | 1111 |
| 416 | Ga0501079_1125100 | 3300049741 | Bacteria | 619 |
| 417 | Ga0501080_0014656 | 3300049742 | Bacteria | 7220 |
| 418 | Ga0501080_0099834 | 3300049742 | Bacteria | 2693 |
| 419 | Ga0501080_1423131 | 3300049742 | Bacteria | 591 |
| 420 | Ga0501081_0006873 | 3300049743 | Bacteria | 7400 |
| 421 | Ga0501083_0001706 | 3300049744 | Bacteria | 14979 |
| 422 | Ga0501262_005084 | 3300049759 | Unclassified | 1543 |
| 423 | Ga0501268_181934 | 3300049765 | Bacteria | 501 |
| 424 | Ga0501273_000881 | 3300049770 | Unclassified | 2644 |
| 425 | Ga0501275_001516 | 3300049772 | Bacteria | 2269 |
| 426 | Ga0501280_011180 | 3300049776 | Unclassified | 1254 |
| 427 | Ga0501283_000944 | 3300049779 | Bacteria | 3862 |
| 428 | Ga0501044_0093774 | 3300049823 | Unclassified | 3027 |
| 429 | Ga0501045_0446618 | 3300049824 | Bacteria | 961 |
| 430 | nmdc:mga00v17_1648_c1 | 3300050491 | Bacteria | 11661 |
| 431 | nmdc:mga0yw44_146612_c1 | 3300050492 | Bacteria | 1537 |
| 432 | nmdc:mga05p37_563959_c1 | 3300050507 | Bacteria | 1293 |
| 433 | nmdc:mga09592_833497_c1 | 3300050508 | Bacteria | 778 |
| 434 | nmdc:mga08y16_21058_c1 | 3300050511 | Bacteria | 6884 |
| 435 | nmdc:mga0n895_10726_c1 | 3300050512 | Bacteria | 8120 |
| 436 | nmdc:mga0n895_58732_c1 | 3300050512 | Bacteria | 3793 |
| 437 | nmdc:mga0rr50_554298_c1 | 3300050513 | Bacteria | 979 |
| 438 | nmdc:mga08x19_3311_c1 | 3300050514 | Bacteria | 9630 |
| 439 | nmdc:mga08x19_439364_c1 | 3300050514 | Bacteria | 918 |
| 440 | nmdc:mga0a205_268417_c1 | 3300050515 | Bacteria | 1583 |
| 441 | nmdc:mga0a205_527450_c1 | 3300050515 | Bacteria | 1037 |
| 442 | Ga0495619_0433999 | 3300053085 | Bacteria | 906 |
| 443 | Ga0501084_0000549 | 3300054114 | Bacteria | 28603 |
| 444 | Ga0590071_000752 | 3300059421 | Bacteria | 9067 |
| 445 | Ga0590074_005829 | 3300059423 | Bacteria | 2044 |
| 446 | Ga0590075_000724 | 3300059424 | Bacteria | 8763 |
| 447 | Ga0590075_038090 | 3300059424 | Unclassified | 1227 |
| 448 | Ga0590077_000579 | 3300059426 | Bacteria | 10124 |
| 449 | Ga0501082_0023190 | 3300060353 | Bacteria | 5353 |
| 450 | Ga0501082_0294607 | 3300060353 | Bacteria | 1413 |
| 451 | Ga0530510_0141810 | 3300061734 | Bacteria | 1771 |
| 452 | Ga0530510_1064753 | 3300061734 | Bacteria | 619 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0206009 | Ga0453683_0206009_414_821 | 131 |
| 2 | 3300044712 | Ga0453684_0287752 | Ga0453684_0287752_1234_1641 | 131 |
| 3 | 3300005331 | Ga0070670_100450081 | Ga0070670_1004500812 | 132 |
| 4 | 3300005338 | Ga0068868_100701615 | Ga0068868_1007016152 | 132 |
| 5 | 3300005455 | Ga0070663_100196524 | Ga0070663_1001965242 | 132 |
| 6 | 3300005543 | Ga0070672_101646838 | Ga0070672_1016468381 | 132 |
| 7 | 3300005549 | Ga0070704_100468722 | Ga0070704_1004687222 | 132 |
| 8 | 3300009177 | Ga0105248_11436448 | Ga0105248_114364482 | 132 |
| 9 | 3300009551 | Ga0105238_12357702 | Ga0105238_123577021 | 132 |
| 10 | 3300013306 | Ga0163162_10641653 | Ga0163162_106416532 | 132 |
| 11 | 3300013308 | Ga0157375_11553587 | Ga0157375_115535871 | 132 |
| 12 | 3300014325 | Ga0163163_10061891 | Ga0163163_100618914 | 132 |
| 13 | 3300014969 | Ga0157376_10969225 | Ga0157376_109692252 | 132 |
| 14 | 3300025903 | Ga0207680_10548957 | Ga0207680_105489572 | 132 |
| 15 | 3300025925 | Ga0207650_10329126 | Ga0207650_103291262 | 132 |
| 16 | 3300025941 | Ga0207711_10030446 | Ga0207711_100304461 | 132 |
| 17 | 3300026023 | Ga0207677_11327860 | Ga0207677_113278601 | 132 |
| 18 | 3300026067 | Ga0207678_10376209 | Ga0207678_103762092 | 132 |
| 19 | 3300028379 | Ga0268266_10247083 | Ga0268266_102470832 | 132 |
| 20 | 3300048907 | Ga0496104_0247123 | Ga0496104_0247123_956_1408 | 132 |
| 21 | 3300005445 | Ga0070708_100415978 | Ga0070708_1004159782 | 133 |
| 22 | 3300005518 | Ga0070699_100167156 | Ga0070699_1001671564 | 133 |
| 23 | 3300031824 | Ga0307413_10074174 | Ga0307413_100741743 | 133 |
| 24 | 3300031852 | Ga0307410_10025524 | Ga0307410_100255245 | 133 |
| 25 | 3300031903 | Ga0307407_10034321 | Ga0307407_100343214 | 133 |
| 26 | 3300031995 | Ga0307409_100059508 | Ga0307409_1000595084 | 133 |
| 27 | 3300032005 | Ga0307411_10021705 | Ga0307411_100217053 | 133 |
| 28 | 3300021384 | Ga0213876_10087550 | Ga0213876_100875504 | 136 |
| 29 | 3300039437 | Ga0436365_1152567 | Ga0436365_1152567_1175_1642 | 136 |
| 30 | 3300005439 | Ga0070711_100479566 | Ga0070711_1004795662 | 141 |
| 31 | 3300005536 | Ga0070697_100879007 | Ga0070697_1008790071 | 141 |
| 32 | 3300006175 | Ga0070712_100238336 | Ga0070712_1002383362 | 141 |
| 33 | 3300025916 | Ga0207663_10135011 | Ga0207663_101350112 | 141 |
| 34 | 3300027671 | Ga0209588_1135723 | Ga0209588_11357231 | 141 |
| 35 | 3300005444 | Ga0070694_100011220 | Ga0070694_1000112205 | 142 |
| 36 | 3300005518 | Ga0070699_100331012 | Ga0070699_1003310122 | 142 |
| 37 | 3300035086 | Ga0373934_0146473 | Ga0373934_0146473_331_777 | 142 |
| 38 | 3300035111 | Ga0373923_0009530 | Ga0373923_0009530_1142_1588 | 142 |
| 39 | 3300035117 | Ga0373953_0069078 | Ga0373953_0069078_509_955 | 142 |
| 40 | 3300035118 | Ga0373954_0017999 | Ga0373954_0017999_588_1034 | 142 |
| 41 | 3300035119 | Ga0373956_0011117 | Ga0373956_0011117_3076_3522 | 142 |
| 42 | 3300035172 | Ga0373955_0005390 | Ga0373955_0005390_1340_1786 | 142 |
| 43 | 3300035695 | Ga0373927_0090697 | Ga0373927_0090697_1447_1893 | 142 |
| 44 | 3300035724 | Ga0373933_0176506 | Ga0373933_0176506_233_679 | 142 |
| 45 | 3300036401 | Ga0373937_0021479 | Ga0373937_0021479_2890_3336 | 142 |
| 46 | 3300036401 | Ga0373937_0430218 | Ga0373937_0430218_605_1045 | 142 |
| 47 | 3300046683 | Ga0495658_0014703 | Ga0495658_0014703_2778_3224 | 142 |
| 48 | 3300005441 | Ga0070700_101558411 | Ga0070700_1015584111 | 144 |
| 49 | 3300009147 | Ga0114129_10514732 | Ga0114129_105147321 | 144 |
| 50 | 3300009553 | Ga0105249_10274862 | Ga0105249_102748622 | 144 |
| 51 | 3300031548 | Ga0307408_102467710 | Ga0307408_1024677101 | 144 |
| 52 | 3300035724 | Ga0373933_0208104 | Ga0373933_0208104_567_1025 | 144 |
| 53 | 3300037068 | Ga0373925_0247942 | Ga0373925_0247942_56_508 | 144 |
| 54 | 3300046475 | Ga0495639_0294179 | Ga0495639_0294179_22_456 | 144 |
| 55 | 3300049575 | Ga0501039_1373805 | Ga0501039_1373805_16_465 | 144 |
| 56 | 3300049742 | Ga0501080_1423131 | Ga0501080_1423131_94_543 | 144 |
| 57 | 3300005331 | Ga0070670_100187157 | Ga0070670_1001871574 | 145 |
| 58 | 3300005343 | Ga0070687_100021899 | Ga0070687_1000218992 | 145 |
| 59 | 3300005344 | Ga0070661_100343890 | Ga0070661_1003438901 | 145 |
| 60 | 3300005347 | Ga0070668_100214254 | Ga0070668_1002142542 | 145 |
| 61 | 3300005347 | Ga0070668_100313867 | Ga0070668_1003138671 | 145 |
| 62 | 3300005353 | Ga0070669_100324249 | Ga0070669_1003242492 | 145 |
| 63 | 3300005365 | Ga0070688_100066368 | Ga0070688_1000663682 | 145 |
| 64 | 3300005434 | Ga0070709_10037792 | Ga0070709_100377923 | 145 |
| 65 | 3300005434 | Ga0070709_10187972 | Ga0070709_101879722 | 145 |
| 66 | 3300005435 | Ga0070714_100018598 | Ga0070714_1000185982 | 145 |
| 67 | 3300005435 | Ga0070714_101792930 | Ga0070714_1017929301 | 145 |
| 68 | 3300005436 | Ga0070713_100004065 | Ga0070713_1000040658 | 145 |
| 69 | 3300005437 | Ga0070710_10039803 | Ga0070710_100398034 | 145 |
| 70 | 3300005438 | Ga0070701_10856628 | Ga0070701_108566281 | 145 |
| 71 | 3300005439 | Ga0070711_100002710 | Ga0070711_10000271010 | 145 |
| 72 | 3300005439 | Ga0070711_100363650 | Ga0070711_1003636502 | 145 |
| 73 | 3300005440 | Ga0070705_100365669 | Ga0070705_1003656691 | 145 |
| 74 | 3300005441 | Ga0070700_100297188 | Ga0070700_1002971881 | 145 |
| 75 | 3300005444 | Ga0070694_100229779 | Ga0070694_1002297791 | 145 |
| 76 | 3300005445 | Ga0070708_100077595 | Ga0070708_1000775952 | 145 |
| 77 | 3300005445 | Ga0070708_100669903 | Ga0070708_1006699031 | 145 |
| 78 | 3300005456 | Ga0070678_100036356 | Ga0070678_1000363562 | 145 |
| 79 | 3300005456 | Ga0070678_100705683 | Ga0070678_1007056832 | 145 |
| 80 | 3300005457 | Ga0070662_100378868 | Ga0070662_1003788682 | 145 |
| 81 | 3300005467 | Ga0070706_100047365 | Ga0070706_1000473654 | 145 |
| 82 | 3300005467 | Ga0070706_100048850 | Ga0070706_1000488501 | 145 |
| 83 | 3300005468 | Ga0070707_100000704 | Ga0070707_10000070426 | 145 |
| 84 | 3300005468 | Ga0070707_100463783 | Ga0070707_1004637832 | 145 |
| 85 | 3300005471 | Ga0070698_100001198 | Ga0070698_10000119813 | 145 |
| 86 | 3300005471 | Ga0070698_100097114 | Ga0070698_1000971145 | 145 |
| 87 | 3300005471 | Ga0070698_100378030 | Ga0070698_1003780302 | 145 |
| 88 | 3300005471 | Ga0070698_100717785 | Ga0070698_1007177852 | 145 |
| 89 | 3300005471 | Ga0070698_100857804 | Ga0070698_1008578041 | 145 |
| 90 | 3300005518 | Ga0070699_100000699 | Ga0070699_1000006992 | 145 |
| 91 | 3300005518 | Ga0070699_100653433 | Ga0070699_1006534332 | 145 |
| 92 | 3300005530 | Ga0070679_100064781 | Ga0070679_1000647812 | 145 |
| 93 | 3300005535 | Ga0070684_101707560 | Ga0070684_1017075601 | 145 |
| 94 | 3300005536 | Ga0070697_100000114 | Ga0070697_10000011436 | 145 |
| 95 | 3300005536 | Ga0070697_100012893 | Ga0070697_1000128935 | 145 |
| 96 | 3300005536 | Ga0070697_100343066 | Ga0070697_1003430662 | 145 |
| 97 | 3300005536 | Ga0070697_101052028 | Ga0070697_1010520281 | 145 |
| 98 | 3300005545 | Ga0070695_100959153 | Ga0070695_1009591532 | 145 |
| 99 | 3300005546 | Ga0070696_100005390 | Ga0070696_1000053902 | 145 |
| 100 | 3300005548 | Ga0070665_101085070 | Ga0070665_1010850701 | 145 |
| 101 | 3300005549 | Ga0070704_100089729 | Ga0070704_1000897293 | 145 |
| 102 | 3300005549 | Ga0070704_100876213 | Ga0070704_1008762132 | 145 |
| 103 | 3300005563 | Ga0068855_100378307 | Ga0068855_1003783072 | 145 |
| 104 | 3300005577 | Ga0068857_100616366 | Ga0068857_1006163662 | 145 |
| 105 | 3300005578 | Ga0068854_100215637 | Ga0068854_1002156372 | 145 |
| 106 | 3300005617 | Ga0068859_100157009 | Ga0068859_1001570092 | 145 |
| 107 | 3300005617 | Ga0068859_102251957 | Ga0068859_1022519572 | 145 |
| 108 | 3300005618 | Ga0068864_102185531 | Ga0068864_1021855311 | 145 |
| 109 | 3300005719 | Ga0068861_100692609 | Ga0068861_1006926092 | 145 |
| 110 | 3300005843 | Ga0068860_100167630 | Ga0068860_1001676303 | 145 |
| 111 | 3300005844 | Ga0068862_100332499 | Ga0068862_1003324993 | 145 |
| 112 | 3300005844 | Ga0068862_100897249 | Ga0068862_1008972492 | 145 |
| 113 | 3300005844 | Ga0068862_101060861 | Ga0068862_1010608612 | 145 |
| 114 | 3300005985 | Ga0081539_10141963 | Ga0081539_101419632 | 145 |
| 115 | 3300006028 | Ga0070717_10001379 | Ga0070717_1000137910 | 145 |
| 116 | 3300006028 | Ga0070717_10150395 | Ga0070717_101503953 | 145 |
| 117 | 3300006028 | Ga0070717_10250482 | Ga0070717_102504823 | 145 |
| 118 | 3300006028 | Ga0070717_11325275 | Ga0070717_113252751 | 145 |
| 119 | 3300006038 | Ga0075365_10145244 | Ga0075365_101452442 | 145 |
| 120 | 3300006048 | Ga0075363_100031344 | Ga0075363_1000313443 | 145 |
| 121 | 3300006051 | Ga0075364_10010210 | Ga0075364_100102104 | 145 |
| 122 | 3300006163 | Ga0070715_10141694 | Ga0070715_101416943 | 145 |
| 123 | 3300006163 | Ga0070715_10274260 | Ga0070715_102742602 | 145 |
| 124 | 3300006163 | Ga0070715_10565147 | Ga0070715_105651472 | 145 |
| 125 | 3300006173 | Ga0070716_100000749 | Ga0070716_10000074910 | 145 |
| 126 | 3300006173 | Ga0070716_100057566 | Ga0070716_1000575662 | 145 |
| 127 | 3300006175 | Ga0070712_100000055 | Ga0070712_10000005526 | 145 |
| 128 | 3300006177 | Ga0075362_10000017 | Ga0075362_100000174 | 145 |
| 129 | 3300006844 | Ga0075428_100209385 | Ga0075428_1002093852 | 145 |
| 130 | 3300006871 | Ga0075434_100691221 | Ga0075434_1006912212 | 145 |
| 131 | 3300006914 | Ga0075436_100058491 | Ga0075436_1000584914 | 145 |
| 132 | 3300006914 | Ga0075436_100507646 | Ga0075436_1005076462 | 145 |
| 133 | 3300006914 | Ga0075436_100574284 | Ga0075436_1005742841 | 145 |
| 134 | 3300006931 | Ga0097620_100157012 | Ga0097620_1001570122 | 145 |
| 135 | 3300006931 | Ga0097620_102251579 | Ga0097620_1022515792 | 145 |
| 136 | 3300009147 | Ga0114129_10913867 | Ga0114129_109138672 | 145 |
| 137 | 3300009148 | Ga0105243_11098941 | Ga0105243_110989412 | 145 |
| 138 | 3300009174 | Ga0105241_10678557 | Ga0105241_106785572 | 145 |
| 139 | 3300009174 | Ga0105241_11931289 | Ga0105241_119312891 | 145 |
| 140 | 3300009551 | Ga0105238_10454604 | Ga0105238_104546042 | 145 |
| 141 | 3300009553 | Ga0105249_12009261 | Ga0105249_120092611 | 145 |
| 142 | 3300013102 | Ga0157371_10029672 | Ga0157371_100296723 | 145 |
| 143 | 3300013102 | Ga0157371_10249366 | Ga0157371_102493663 | 145 |
| 144 | 3300013104 | Ga0157370_10264783 | Ga0157370_102647832 | 145 |
| 145 | 3300013307 | Ga0157372_10141429 | Ga0157372_101414294 | 145 |
| 146 | 3300013307 | Ga0157372_10166063 | Ga0157372_101660632 | 145 |
| 147 | 3300013307 | Ga0157372_10801799 | Ga0157372_108017992 | 145 |
| 148 | 3300014326 | Ga0157380_11195741 | Ga0157380_111957412 | 145 |
| 149 | 3300021384 | Ga0213876_10010704 | Ga0213876_100107045 | 145 |
| 150 | 3300025898 | Ga0207692_10405866 | Ga0207692_104058662 | 145 |
| 151 | 3300025905 | Ga0207685_10141480 | Ga0207685_101414802 | 145 |
| 152 | 3300025905 | Ga0207685_10162586 | Ga0207685_101625863 | 145 |
| 153 | 3300025906 | Ga0207699_10126142 | Ga0207699_101261422 | 145 |
| 154 | 3300025906 | Ga0207699_10382363 | Ga0207699_103823632 | 145 |
| 155 | 3300025910 | Ga0207684_10000274 | Ga0207684_1000027463 | 145 |
| 156 | 3300025910 | Ga0207684_10133284 | Ga0207684_101332842 | 145 |
| 157 | 3300025910 | Ga0207684_10205201 | Ga0207684_102052012 | 145 |
| 158 | 3300025910 | Ga0207684_10990611 | Ga0207684_109906111 | 145 |
| 159 | 3300025912 | Ga0207707_10403564 | Ga0207707_104035642 | 145 |
| 160 | 3300025915 | Ga0207693_10000143 | Ga0207693_1000014334 | 145 |
| 161 | 3300025916 | Ga0207663_10004972 | Ga0207663_100049728 | 145 |
| 162 | 3300025916 | Ga0207663_10364190 | Ga0207663_103641902 | 145 |
| 163 | 3300025918 | Ga0207662_10065289 | Ga0207662_100652893 | 145 |
| 164 | 3300025919 | Ga0207657_10101701 | Ga0207657_101017013 | 145 |
| 165 | 3300025920 | Ga0207649_10191463 | Ga0207649_101914632 | 145 |
| 166 | 3300025921 | Ga0207652_10612107 | Ga0207652_106121072 | 145 |
| 167 | 3300025922 | Ga0207646_10000240 | Ga0207646_1000024062 | 145 |
| 168 | 3300025922 | Ga0207646_10085446 | Ga0207646_100854462 | 145 |
| 169 | 3300025922 | Ga0207646_10287250 | Ga0207646_102872502 | 145 |
| 170 | 3300025923 | Ga0207681_10321614 | Ga0207681_103216142 | 145 |
| 171 | 3300025923 | Ga0207681_11612361 | Ga0207681_116123611 | 145 |
| 172 | 3300025925 | Ga0207650_10115903 | Ga0207650_101159034 | 145 |
| 173 | 3300025928 | Ga0207700_10007254 | Ga0207700_100072542 | 145 |
| 174 | 3300025928 | Ga0207700_10071634 | Ga0207700_100716342 | 145 |
| 175 | 3300025929 | Ga0207664_10005288 | Ga0207664_100052886 | 145 |
| 176 | 3300025933 | Ga0207706_10136474 | Ga0207706_101364742 | 145 |
| 177 | 3300025933 | Ga0207706_10378080 | Ga0207706_103780803 | 145 |
| 178 | 3300025936 | Ga0207670_10222804 | Ga0207670_102228042 | 145 |
| 179 | 3300025939 | Ga0207665_10004344 | Ga0207665_1000434410 | 145 |
| 180 | 3300025939 | Ga0207665_10078429 | Ga0207665_100784292 | 145 |
| 181 | 3300025944 | Ga0207661_10180769 | Ga0207661_101807692 | 145 |
| 182 | 3300025949 | Ga0207667_10301947 | Ga0207667_103019472 | 145 |
| 183 | 3300025960 | Ga0207651_11197054 | Ga0207651_111970542 | 145 |
| 184 | 3300025972 | Ga0207668_10163160 | Ga0207668_101631602 | 145 |
| 185 | 3300025972 | Ga0207668_10240223 | Ga0207668_102402232 | 145 |
| 186 | 3300025972 | Ga0207668_10303211 | Ga0207668_103032111 | 145 |
| 187 | 3300026116 | Ga0207674_10164638 | Ga0207674_101646382 | 145 |
| 188 | 3300026121 | Ga0207683_10082572 | Ga0207683_100825723 | 145 |
| 189 | 3300026121 | Ga0207683_10247695 | Ga0207683_102476953 | 145 |
| 190 | 3300028379 | Ga0268266_10263242 | Ga0268266_102632423 | 145 |
| 191 | 3300028380 | Ga0268265_10144596 | Ga0268265_101445963 | 145 |
| 192 | 3300028800 | Ga0265338_10390274 | Ga0265338_103902742 | 145 |
| 193 | 3300031249 | Ga0265339_10022588 | Ga0265339_100225883 | 145 |
| 194 | 3300031548 | Ga0307408_100149856 | Ga0307408_1001498562 | 145 |
| 195 | 3300031727 | Ga0316576_10033551 | Ga0316576_100335512 | 145 |
| 196 | 3300031731 | Ga0307405_10034005 | Ga0307405_100340055 | 145 |
| 197 | 3300031733 | Ga0316577_10006078 | Ga0316577_100060782 | 145 |
| 198 | 3300031824 | Ga0307413_10007618 | Ga0307413_100076183 | 145 |
| 199 | 3300031852 | Ga0307410_10021376 | Ga0307410_100213763 | 145 |
| 200 | 3300031901 | Ga0307406_10003212 | Ga0307406_100032125 | 145 |
| 201 | 3300031903 | Ga0307407_10028244 | Ga0307407_100282442 | 145 |
| 202 | 3300031903 | Ga0307407_10056492 | Ga0307407_100564922 | 145 |
| 203 | 3300031911 | Ga0307412_10110696 | Ga0307412_101106962 | 145 |
| 204 | 3300031911 | Ga0307412_10574255 | Ga0307412_105742552 | 145 |
| 205 | 3300031995 | Ga0307409_100152134 | Ga0307409_1001521342 | 145 |
| 206 | 3300031995 | Ga0307409_100180855 | Ga0307409_1001808553 | 145 |
| 207 | 3300032002 | Ga0307416_100052096 | Ga0307416_1000520962 | 145 |
| 208 | 3300032004 | Ga0307414_10012633 | Ga0307414_100126335 | 145 |
| 209 | 3300032005 | Ga0307411_11153274 | Ga0307411_111532741 | 145 |
| 210 | 3300035083 | Ga0373926_0373424 | Ga0373926_0373424_66_515 | 145 |
| 211 | 3300035088 | Ga0373940_0110408 | Ga0373940_0110408_245_694 | 145 |
| 212 | 3300035089 | Ga0373944_0061946 | Ga0373944_0061946_724_1173 | 145 |
| 213 | 3300035113 | Ga0373936_0003338 | Ga0373936_0003338_5476_5925 | 145 |
| 214 | 3300035170 | Ga0373943_0067783 | Ga0373943_0067783_1269_1718 | 145 |
| 215 | 3300035170 | Ga0373943_0617821 | Ga0373943_0617821_18_467 | 145 |
| 216 | 3300035171 | Ga0373946_0097046 | Ga0373946_0097046_636_1085 | 145 |
| 217 | 3300035410 | Ga0373924_0042781 | Ga0373924_0042781_450_899 | 145 |
| 218 | 3300035691 | Ga0373931_0088630 | Ga0373931_0088630_1010_1465 | 145 |
| 219 | 3300035692 | Ga0373935_0171553 | Ga0373935_0171553_402_851 | 145 |
| 220 | 3300035692 | Ga0373935_0369768 | Ga0373935_0369768_175_624 | 145 |
| 221 | 3300035695 | Ga0373927_0061342 | Ga0373927_0061342_769_1218 | 145 |
| 222 | 3300035724 | Ga0373933_0702519 | Ga0373933_0702519_143_592 | 145 |
| 223 | 3300035725 | Ga0373947_0027915 | Ga0373947_0027915_2215_2664 | 145 |
| 224 | 3300036401 | Ga0373937_0091454 | Ga0373937_0091454_183_632 | 145 |
| 225 | 3300036712 | Ga0316584_0010650 | Ga0316584_0010650_2590_3027 | 145 |
| 226 | 3300037068 | Ga0373925_0095858 | Ga0373925_0095858_564_1013 | 145 |
| 227 | 3300037068 | Ga0373925_0713950 | Ga0373925_0713950_64_513 | 145 |
| 228 | 3300037471 | Ga0395905_0044260 | Ga0395905_0044260_3108_3557 | 145 |
| 229 | 3300037853 | Ga0436364_0107785 | Ga0436364_0107785_965_1405 | 145 |
| 230 | 3300037853 | Ga0436364_0864451 | Ga0436364_0864451_49_489 | 145 |
| 231 | 3300038443 | Ga0395901_0104363 | Ga0395901_0104363_500_1006 | 145 |
| 232 | 3300038735 | Ga0400485_20631 | Ga0400485_20631_2039_2479 | 145 |
| 233 | 3300038742 | Ga0400486_07431 | Ga0400486_07431_12928_13368 | 145 |
| 234 | 3300039062 | Ga0400483_050187 | Ga0400483_050187_10475_10927 | 145 |
| 235 | 3300039062 | Ga0400483_205332 | Ga0400483_205332_1927_2370 | 145 |
| 236 | 3300039093 | Ga0400489_90984 | Ga0400489_90984_4527_4967 | 145 |
| 237 | 3300039437 | Ga0436365_0329605 | Ga0436365_0329605_701_1150 | 145 |
| 238 | 3300039437 | Ga0436365_1453400 | Ga0436365_1453400_3417_3866 | 145 |
| 239 | 3300039450 | Ga0436363_1042578 | Ga0436363_1042578_223_666 | 145 |
| 240 | 3300039453 | Ga0436362_0525528 | Ga0436362_0525528_62_511 | 145 |
| 241 | 3300041456 | Ga0451795_0313244 | Ga0451795_0313244_2230_2679 | 145 |
| 242 | 3300042157 | Ga0439458_0126524 | Ga0439458_0126524_45_497 | 145 |
| 243 | 3300042876 | Ga0451577_0160829 | Ga0451577_0160829_1224_1670 | 145 |
| 244 | 3300044673 | Ga0453683_0005031 | Ga0453683_0005031_5755_6204 | 145 |
| 245 | 3300044694 | Ga0466963_0778378 | Ga0466963_0778378_106_555 | 145 |
| 246 | 3300044712 | Ga0453684_0009782 | Ga0453684_0009782_11165_11614 | 145 |
| 247 | 3300045051 | Ga0451576_0804773 | Ga0451576_0804773_10_459 | 145 |
| 248 | 3300046459 | Ga0495629_0008416 | Ga0495629_0008416_4448_4897 | 145 |
| 249 | 3300046459 | Ga0495629_0200744 | Ga0495629_0200744_482_931 | 145 |
| 250 | 3300046472 | Ga0495580_0000561 | Ga0495580_0000561_25683_26132 | 145 |
| 251 | 3300046477 | Ga0495664_0093401 | Ga0495664_0093401_136_585 | 145 |
| 252 | 3300046516 | Ga0495628_0050495 | Ga0495628_0050495_202_750 | 145 |
| 253 | 3300046516 | Ga0495628_0280617 | Ga0495628_0280617_174_623 | 145 |
| 254 | 3300046517 | Ga0495630_0009697 | Ga0495630_0009697_4639_5088 | 145 |
| 255 | 3300046519 | Ga0495632_0018499 | Ga0495632_0018499_2401_2850 | 145 |
| 256 | 3300046531 | Ga0495665_0165597 | Ga0495665_0165597_459_908 | 145 |
| 257 | 3300046533 | Ga0495640_0575746 | Ga0495640_0575746_100_549 | 145 |
| 258 | 3300046543 | Ga0495645_0395077 | Ga0495645_0395077_354_803 | 145 |
| 259 | 3300046678 | Ga0495599_0031278 | Ga0495599_0031278_1118_1666 | 145 |
| 260 | 3300046678 | Ga0495599_0054564 | Ga0495599_0054564_385_834 | 145 |
| 261 | 3300046680 | Ga0495646_0205914 | Ga0495646_0205914_509_958 | 145 |
| 262 | 3300046683 | Ga0495658_0065433 | Ga0495658_0065433_264_713 | 145 |
| 263 | 3300046683 | Ga0495658_0611372 | Ga0495658_0611372_164_610 | 145 |
| 264 | 3300046689 | Ga0495613_0400058 | Ga0495613_0400058_340_789 | 145 |
| 265 | 3300047319 | Ga0495674_0009019 | Ga0495674_0009019_7410_7859 | 145 |
| 266 | 3300047320 | Ga0495672_0001915 | Ga0495672_0001915_929_1378 | 145 |
| 267 | 3300048908 | Ga0496105_0335441 | Ga0496105_0335441_285_734 | 145 |
| 268 | 3300048915 | Ga0496112_0455512 | Ga0496112_0455512_34_483 | 145 |
| 269 | 3300048918 | Ga0496115_0006349 | Ga0496115_0006349_4862_5311 | 145 |
| 270 | 3300049521 | Ga0501298_036947 | Ga0501298_036947_208_657 | 145 |
| 271 | 3300049570 | Ga0501033_0014379 | Ga0501033_0014379_46_495 | 145 |
| 272 | 3300049571 | Ga0501034_0003338 | Ga0501034_0003338_1189_1635 | 145 |
| 273 | 3300049571 | Ga0501034_0450814 | Ga0501034_0450814_697_1146 | 145 |
| 274 | 3300049571 | Ga0501034_0543814 | Ga0501034_0543814_565_1014 | 145 |
| 275 | 3300049571 | Ga0501034_0594696 | Ga0501034_0594696_11_460 | 145 |
| 276 | 3300049573 | Ga0501037_0238012 | Ga0501037_0238012_806_1261 | 145 |
| 277 | 3300049574 | Ga0501038_0380071 | Ga0501038_0380071_380_835 | 145 |
| 278 | 3300049576 | Ga0501040_0016522 | Ga0501040_0016522_2415_2870 | 145 |
| 279 | 3300049577 | Ga0501041_0205404 | Ga0501041_0205404_549_1004 | 145 |
| 280 | 3300049578 | Ga0501042_0012747 | Ga0501042_0012747_2091_2546 | 145 |
| 281 | 3300049579 | Ga0501043_0136833 | Ga0501043_0136833_1295_1750 | 145 |
| 282 | 3300049580 | Ga0501046_0295187 | Ga0501046_0295187_225_680 | 145 |
| 283 | 3300049581 | Ga0501047_0302078 | Ga0501047_0302078_268_714 | 145 |
| 284 | 3300049581 | Ga0501047_0971826 | Ga0501047_0971826_141_590 | 145 |
| 285 | 3300049583 | Ga0501067_0005478 | Ga0501067_0005478_6498_6944 | 145 |
| 286 | 3300049583 | Ga0501067_0006189 | Ga0501067_0006189_1338_1784 | 145 |
| 287 | 3300049584 | Ga0501068_0000339 | Ga0501068_0000339_9127_9573 | 145 |
| 288 | 3300049584 | Ga0501068_0000537 | Ga0501068_0000537_195_641 | 145 |
| 289 | 3300049585 | Ga0501069_0000336 | Ga0501069_0000336_4355_4801 | 145 |
| 290 | 3300049585 | Ga0501069_0101611 | Ga0501069_0101611_1052_1498 | 145 |
| 291 | 3300049586 | Ga0501070_0010846 | Ga0501070_0010846_6752_7198 | 145 |
| 292 | 3300049586 | Ga0501070_0039481 | Ga0501070_0039481_2008_2454 | 145 |
| 293 | 3300049587 | Ga0501071_0006402 | Ga0501071_0006402_5204_5650 | 145 |
| 294 | 3300049587 | Ga0501071_0006897 | Ga0501071_0006897_1558_2004 | 145 |
| 295 | 3300049587 | Ga0501071_0208871 | Ga0501071_0208871_914_1360 | 145 |
| 296 | 3300049588 | Ga0501072_0002957 | Ga0501072_0002957_6537_6983 | 145 |
| 297 | 3300049588 | Ga0501072_0014524 | Ga0501072_0014524_964_1410 | 145 |
| 298 | 3300049588 | Ga0501072_0354762 | Ga0501072_0354762_174_629 | 145 |
| 299 | 3300049588 | Ga0501072_1174879 | Ga0501072_1174879_115_561 | 145 |
| 300 | 3300049589 | Ga0501073_0011604 | Ga0501073_0011604_5494_5940 | 145 |
| 301 | 3300049590 | Ga0501074_0000291 | Ga0501074_0000291_9653_10099 | 145 |
| 302 | 3300049590 | Ga0501074_0009434 | Ga0501074_0009434_6533_6979 | 145 |
| 303 | 3300049592 | Ga0501076_0160203 | Ga0501076_0160203_88_534 | 145 |
| 304 | 3300049649 | Ga0501198_037481 | Ga0501198_037481_159_608 | 145 |
| 305 | 3300049667 | Ga0501230_004055 | Ga0501230_004055_645_1094 | 145 |
| 306 | 3300049672 | Ga0501239_000163 | Ga0501239_000163_1516_1965 | 145 |
| 307 | 3300049678 | Ga0501248_040130 | Ga0501248_040130_74_523 | 145 |
| 308 | 3300049686 | Ga0501257_047651 | Ga0501257_047651_377_826 | 145 |
| 309 | 3300049707 | Ga0501234_007414 | Ga0501234_007414_1123_1572 | 145 |
| 310 | 3300049741 | Ga0501079_0377557 | Ga0501079_0377557_132_578 | 145 |
| 311 | 3300049741 | Ga0501079_1125100 | Ga0501079_1125100_137_583 | 145 |
| 312 | 3300049742 | Ga0501080_0014656 | Ga0501080_0014656_6639_7085 | 145 |
| 313 | 3300049742 | Ga0501080_0099834 | Ga0501080_0099834_500_946 | 145 |
| 314 | 3300049743 | Ga0501081_0006873 | Ga0501081_0006873_5795_6241 | 145 |
| 315 | 3300049744 | Ga0501083_0001706 | Ga0501083_0001706_10232_10678 | 145 |
| 316 | 3300049759 | Ga0501262_005084 | Ga0501262_005084_1040_1489 | 145 |
| 317 | 3300049765 | Ga0501268_181934 | Ga0501268_181934_12_464 | 145 |
| 318 | 3300049770 | Ga0501273_000881 | Ga0501273_000881_1835_2284 | 145 |
| 319 | 3300049772 | Ga0501275_001516 | Ga0501275_001516_1747_2196 | 145 |
| 320 | 3300049776 | Ga0501280_011180 | Ga0501280_011180_580_1029 | 145 |
| 321 | 3300049779 | Ga0501283_000944 | Ga0501283_000944_544_993 | 145 |
| 322 | 3300049823 | Ga0501044_0093774 | Ga0501044_0093774_1161_1610 | 145 |
| 323 | 3300049824 | Ga0501045_0446618 | Ga0501045_0446618_314_769 | 145 |
| 324 | 3300050491 | nmdc:mga00v17_1648_c1 | nmdc:mga00v17_1648_c1_6683_7165 | 145 |
| 325 | 3300050492 | nmdc:mga0yw44_146612_c1 | nmdc:mga0yw44_146612_c1_550_1032 | 145 |
| 326 | 3300050507 | nmdc:mga05p37_563959_c1 | nmdc:mga05p37_563959_c1_699_1139 | 145 |
| 327 | 3300050508 | nmdc:mga09592_833497_c1 | nmdc:mga09592_833497_c1_90_530 | 145 |
| 328 | 3300050512 | nmdc:mga0n895_58732_c1 | nmdc:mga0n895_58732_c1_1575_2024 | 145 |
| 329 | 3300050514 | nmdc:mga08x19_3311_c1 | nmdc:mga08x19_3311_c1_1171_1617 | 145 |
| 330 | 3300050514 | nmdc:mga08x19_439364_c1 | nmdc:mga08x19_439364_c1_160_654 | 145 |
| 331 | 3300050515 | nmdc:mga0a205_268417_c1 | nmdc:mga0a205_268417_c1_221_715 | 145 |
| 332 | 3300050515 | nmdc:mga0a205_527450_c1 | nmdc:mga0a205_527450_c1_100_549 | 145 |
| 333 | 3300053085 | Ga0495619_0433999 | Ga0495619_0433999_422_868 | 145 |
| 334 | 3300054114 | Ga0501084_0000549 | Ga0501084_0000549_26517_26963 | 145 |
| 335 | 3300059421 | Ga0590071_000752 | Ga0590071_000752_1817_2269 | 145 |
| 336 | 3300059423 | Ga0590074_005829 | Ga0590074_005829_36_488 | 145 |
| 337 | 3300059424 | Ga0590075_000724 | Ga0590075_000724_6688_7140 | 145 |
| 338 | 3300059424 | Ga0590075_038090 | Ga0590075_038090_239_691 | 145 |
| 339 | 3300059426 | Ga0590077_000579 | Ga0590077_000579_5911_6363 | 145 |
| 340 | 3300060353 | Ga0501082_0023190 | Ga0501082_0023190_716_1162 | 145 |
| 341 | 3300060353 | Ga0501082_0294607 | Ga0501082_0294607_919_1368 | 145 |
| 342 | 3300061734 | Ga0530510_0141810 | Ga0530510_0141810_1251_1697 | 145 |
| 343 | 3300061734 | Ga0530510_1064753 | Ga0530510_1064753_93_542 | 145 |
| 344 | 3300005985 | Ga0081539_10012295 | Ga0081539_100122952 | 149 |
| 345 | 3300005985 | Ga0081539_10232377 | Ga0081539_102323771 | 149 |
| 346 | 3300031548 | Ga0307408_100639077 | Ga0307408_1006390771 | 149 |
| 347 | 3300032002 | Ga0307416_100630727 | Ga0307416_1006307272 | 149 |
| 348 | 3300037471 | Ga0395905_0184749 | Ga0395905_0184749_512_961 | 149 |
| 349 | 3300005289 | Ga0065704_10311999 | Ga0065704_103119992 | 150 |
| 350 | 3300005295 | Ga0065707_10006581 | Ga0065707_100065813 | 150 |
| 351 | 3300005328 | Ga0070676_10008758 | Ga0070676_100087583 | 150 |
| 352 | 3300005331 | Ga0070670_100025936 | Ga0070670_1000259364 | 150 |
| 353 | 3300005331 | Ga0070670_100046891 | Ga0070670_1000468912 | 150 |
| 354 | 3300005334 | Ga0068869_100017195 | Ga0068869_1000171953 | 150 |
| 355 | 3300005335 | Ga0070666_10045707 | Ga0070666_100457073 | 150 |
| 356 | 3300005339 | Ga0070660_100043284 | Ga0070660_1000432844 | 150 |
| 357 | 3300005340 | Ga0070689_100079681 | Ga0070689_1000796812 | 150 |
| 358 | 3300005343 | Ga0070687_100010350 | Ga0070687_1000103502 | 150 |
| 359 | 3300005344 | Ga0070661_100000724 | Ga0070661_1000007244 | 150 |
| 360 | 3300005344 | Ga0070661_100600434 | Ga0070661_1006004342 | 150 |
| 361 | 3300005345 | Ga0070692_10001371 | Ga0070692_100013713 | 150 |
| 362 | 3300005347 | Ga0070668_100000182 | Ga0070668_1000001826 | 150 |
| 363 | 3300005353 | Ga0070669_100026730 | Ga0070669_1000267303 | 150 |
| 364 | 3300005355 | Ga0070671_100781160 | Ga0070671_1007811602 | 150 |
| 365 | 3300005364 | Ga0070673_100133537 | Ga0070673_1001335373 | 150 |
| 366 | 3300005365 | Ga0070688_100040021 | Ga0070688_1000400212 | 150 |
| 367 | 3300005367 | Ga0070667_100025028 | Ga0070667_1000250285 | 150 |
| 368 | 3300005438 | Ga0070701_10038473 | Ga0070701_100384732 | 150 |
| 369 | 3300005441 | Ga0070700_100017031 | Ga0070700_1000170315 | 150 |
| 370 | 3300005455 | Ga0070663_100006609 | Ga0070663_1000066093 | 150 |
| 371 | 3300005457 | Ga0070662_100004769 | Ga0070662_1000047694 | 150 |
| 372 | 3300005467 | Ga0070706_100778547 | Ga0070706_1007785472 | 150 |
| 373 | 3300005535 | Ga0070684_100006603 | Ga0070684_1000066037 | 150 |
| 374 | 3300005535 | Ga0070684_100460518 | Ga0070684_1004605182 | 150 |
| 375 | 3300005539 | Ga0068853_100007829 | Ga0068853_1000078295 | 150 |
| 376 | 3300005543 | Ga0070672_100151044 | Ga0070672_1001510442 | 150 |
| 377 | 3300005564 | Ga0070664_100018704 | Ga0070664_1000187042 | 150 |
| 378 | 3300005564 | Ga0070664_100096585 | Ga0070664_1000965852 | 150 |
| 379 | 3300005577 | Ga0068857_100008564 | Ga0068857_1000085645 | 150 |
| 380 | 3300005578 | Ga0068854_100094259 | Ga0068854_1000942593 | 150 |
| 381 | 3300005616 | Ga0068852_100003909 | Ga0068852_1000039094 | 150 |
| 382 | 3300005616 | Ga0068852_102442440 | Ga0068852_1024424401 | 150 |
| 383 | 3300005617 | Ga0068859_101816209 | Ga0068859_1018162092 | 150 |
| 384 | 3300005618 | Ga0068864_101017904 | Ga0068864_1010179042 | 150 |
| 385 | 3300005719 | Ga0068861_100001153 | Ga0068861_1000011535 | 150 |
| 386 | 3300005834 | Ga0068851_10258320 | Ga0068851_102583202 | 150 |
| 387 | 3300005841 | Ga0068863_100004308 | Ga0068863_1000043089 | 150 |
| 388 | 3300005844 | Ga0068862_100006895 | Ga0068862_1000068954 | 150 |
| 389 | 3300006844 | Ga0075428_100753488 | Ga0075428_1007534882 | 150 |
| 390 | 3300006871 | Ga0075434_100057144 | Ga0075434_1000571443 | 150 |
| 391 | 3300006880 | Ga0075429_100271270 | Ga0075429_1002712701 | 150 |
| 392 | 3300006881 | Ga0068865_100000702 | Ga0068865_1000007022 | 150 |
| 393 | 3300006931 | Ga0097620_101816855 | Ga0097620_1018168551 | 150 |
| 394 | 3300009094 | Ga0111539_10166833 | Ga0111539_101668333 | 150 |
| 395 | 3300009098 | Ga0105245_10058536 | Ga0105245_100585363 | 150 |
| 396 | 3300009147 | Ga0114129_10149064 | Ga0114129_101490643 | 150 |
| 397 | 3300009177 | Ga0105248_10090358 | Ga0105248_100903583 | 150 |
| 398 | 3300009553 | Ga0105249_10005699 | Ga0105249_100056995 | 150 |
| 399 | 3300010375 | Ga0105239_10221683 | Ga0105239_102216833 | 150 |
| 400 | 3300013306 | Ga0163162_10009031 | Ga0163162_100090314 | 150 |
| 401 | 3300013308 | Ga0157375_10184589 | Ga0157375_101845891 | 150 |
| 402 | 3300014325 | Ga0163163_10002771 | Ga0163163_100027712 | 150 |
| 403 | 3300014326 | Ga0157380_10021085 | Ga0157380_100210855 | 150 |
| 404 | 3300014968 | Ga0157379_10001669 | Ga0157379_100016698 | 150 |
| 405 | 3300025315 | Ga0207697_10000742 | Ga0207697_1000074212 | 150 |
| 406 | 3300025321 | Ga0207656_10027736 | Ga0207656_100277363 | 150 |
| 407 | 3300025901 | Ga0207688_10051245 | Ga0207688_100512452 | 150 |
| 408 | 3300025904 | Ga0207647_10024268 | Ga0207647_100242683 | 150 |
| 409 | 3300025907 | Ga0207645_10036966 | Ga0207645_100369663 | 150 |
| 410 | 3300025918 | Ga0207662_10112904 | Ga0207662_101129042 | 150 |
| 411 | 3300025919 | Ga0207657_10029607 | Ga0207657_100296073 | 150 |
| 412 | 3300025920 | Ga0207649_10003779 | Ga0207649_100037794 | 150 |
| 413 | 3300025920 | Ga0207649_10948177 | Ga0207649_109481772 | 150 |
| 414 | 3300025923 | Ga0207681_10012578 | Ga0207681_100125785 | 150 |
| 415 | 3300025925 | Ga0207650_10010095 | Ga0207650_100100952 | 150 |
| 416 | 3300025925 | Ga0207650_10122958 | Ga0207650_101229582 | 150 |
| 417 | 3300025926 | Ga0207659_10051584 | Ga0207659_100515842 | 150 |
| 418 | 3300025927 | Ga0207687_10040661 | Ga0207687_100406612 | 150 |
| 419 | 3300025932 | Ga0207690_10084214 | Ga0207690_100842142 | 150 |
| 420 | 3300025933 | Ga0207706_10000364 | Ga0207706_1000036431 | 150 |
| 421 | 3300025938 | Ga0207704_10013881 | Ga0207704_100138813 | 150 |
| 422 | 3300025940 | Ga0207691_10000745 | Ga0207691_1000074522 | 150 |
| 423 | 3300025942 | Ga0207689_10003089 | Ga0207689_100030893 | 150 |
| 424 | 3300025944 | Ga0207661_10045533 | Ga0207661_100455332 | 150 |
| 425 | 3300025944 | Ga0207661_10102834 | Ga0207661_101028342 | 150 |
| 426 | 3300025945 | Ga0207679_10005109 | Ga0207679_100051095 | 150 |
| 427 | 3300025949 | Ga0207667_10095274 | Ga0207667_100952744 | 150 |
| 428 | 3300025960 | Ga0207651_10274551 | Ga0207651_102745512 | 150 |
| 429 | 3300025961 | Ga0207712_10007974 | Ga0207712_100079745 | 150 |
| 430 | 3300025972 | Ga0207668_10002709 | Ga0207668_100027095 | 150 |
| 431 | 3300025981 | Ga0207640_10164215 | Ga0207640_101642152 | 150 |
| 432 | 3300025986 | Ga0207658_10068953 | Ga0207658_100689532 | 150 |
| 433 | 3300026023 | Ga0207677_10013812 | Ga0207677_100138125 | 150 |
| 434 | 3300026075 | Ga0207708_10061417 | Ga0207708_100614173 | 150 |
| 435 | 3300026088 | Ga0207641_10100325 | Ga0207641_101003253 | 150 |
| 436 | 3300026089 | Ga0207648_10767682 | Ga0207648_107676822 | 150 |
| 437 | 3300026116 | Ga0207674_10000658 | Ga0207674_1000065828 | 150 |
| 438 | 3300026118 | Ga0207675_100000030 | Ga0207675_10000003060 | 150 |
| 439 | 3300026142 | Ga0207698_10035105 | Ga0207698_100351053 | 150 |
| 440 | 3300026142 | Ga0207698_10807453 | Ga0207698_108074532 | 150 |
| 441 | 3300028379 | Ga0268266_10184569 | Ga0268266_101845692 | 150 |
| 442 | 3300028380 | Ga0268265_10015959 | Ga0268265_100159592 | 150 |
| 443 | 3300035114 | Ga0373939_0281701 | Ga0373939_0281701_17_469 | 150 |
| 444 | 3300035242 | Ga0373962_0022101 | Ga0373962_0022101_892_1344 | 150 |
| 445 | 3300042157 | Ga0439458_0123929 | Ga0439458_0123929_58_510 | 150 |
| 446 | 3300042876 | Ga0451577_0000005 | Ga0451577_0000005_70974_71426 | 150 |
| 447 | 3300044712 | Ga0453684_1502406 | Ga0453684_1502406_39_491 | 150 |
| 448 | 3300048912 | Ga0496109_0438452 | Ga0496109_0438452_574_1026 | 150 |
| 449 | 3300048912 | Ga0496109_0714961 | Ga0496109_0714961_133_585 | 150 |
| 450 | 3300050511 | nmdc:mga08y16_21058_c1 | nmdc:mga08y16_21058_c1_661_1113 | 150 |
| 451 | 3300050512 | nmdc:mga0n895_10726_c1 | nmdc:mga0n895_10726_c1_5284_5736 | 150 |
| 452 | 3300050513 | nmdc:mga0rr50_554298_c1 | nmdc:mga0rr50_554298_c1_20_472 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9661 | 1 | 150 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9628 | 1 | 150 |
| 2dbo-assembly1.cif.gz_A-2 | crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus | 0.9601 | 1 | 149 |
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9596 | 1 | 150 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9563 | 1 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9628 | 1 | 150 | 3.50.80.10 |
| 2dboA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9601 | 1 | 149 | 3.50.80.10 |
| af_Q2FXU2_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.96 | 1 | 150 | 3.50.80.10 |
| af_Q5AEI9_1_136_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9567 | 35 | 146 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9563 | 1 | 150 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524H0K9-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9962 | 1 | 150 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-C0EKJ7-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9954 | 2 | 148 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A154TUE1-F1-model_v4 | deleted | 0.9951 | 2 | 148 |
|
| AF-A0A1C6DGN8-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9949 | 1 | 149 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-R6Z1P1-F1-model_v4 | deleted | 0.9928 | 1 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar