F446649

General Info

Members Datasets Scaffolds Average Seq Length
450 264 900 269

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0015255|Ga0466967_0015255_3208_4011
Length 258
Sequence VEQAGRAPKARLSSVANSMRLLTSFSGDEDELAITTLAQRLGLAKSTVHRLASTLVSAGFLEQNRDTGRYRLGVALFELGALVRRRMDVANEARPHLRELLEKTGETVQLGIVDHYSVLYVYEMESRRAIRMAAAVGARAPLHCTAVGKVLLAFQAADYIREVLDRGLTSFTEKTVTRRDAVLALLEDVRSRDYAIDDEESEIGLRAIAAPVRNQNGLVIAALGKKVMQTSVPSVISIAQAVSARLGYQPVRRKAFHE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.33
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0015255 3300045976 Bacteria 6018
2 JGI25406J46586_10043060 3300003203 Bacteria 1575
3 Ga0065707_10150126 3300005295 Bacteria 1659
4 Ga0070658_10210709 3300005327 Bacteria 1641
5 Ga0070690_100001141 3300005330 Bacteria 13673
6 Ga0070690_100106024 3300005330 Bacteria 1869
7 Ga0070690_100361798 3300005330 Bacteria 1056
8 Ga0070677_10050730 3300005333 Bacteria 1677
9 Ga0068869_100000089 3300005334 Bacteria 41752
10 Ga0070666_10185769 3300005335 Bacteria 1459
11 Ga0070680_100000807 3300005336 Bacteria 22103
12 Ga0070680_100056354 3300005336 Bacteria 3213
13 Ga0070680_100086257 3300005336 Bacteria 2595
14 Ga0070682_100014137 3300005337 Bacteria 4610
15 Ga0068868_100000554 3300005338 Bacteria 25023
16 Ga0070689_100000185 3300005340 Bacteria 37751
17 Ga0070689_100023944 3300005340 Bacteria 4577
18 Ga0070689_100073688 3300005340 Bacteria 2671
19 Ga0070689_100259121 3300005340 Bacteria 1437
20 Ga0070689_100409348 3300005340 Bacteria 1148
21 Ga0070691_10002337 3300005341 Bacteria 8406
22 Ga0070687_100000307 3300005343 Bacteria 16612
23 Ga0070687_100195383 3300005343 Bacteria 1222
24 Ga0070692_10000165 3300005345 Bacteria 16818
25 Ga0070692_10079641 3300005345 Bacteria 1762
26 Ga0070675_100004786 3300005354 Bacteria 10321
27 Ga0070675_100317115 3300005354 Bacteria 1377
28 Ga0070671_100490342 3300005355 Unclassified 1056
29 Ga0070673_100112695 3300005364 Bacteria 2258
30 Ga0070659_100038956 3300005366 Bacteria 3709
31 Ga0070701_10000413 3300005438 Bacteria 14514
32 Ga0070701_10035418 3300005438 Bacteria 2507
33 Ga0070705_100000541 3300005440 Bacteria 21859
34 Ga0070705_100159385 3300005440 Bacteria 1506
35 Ga0070700_100000398 3300005441 Bacteria 22486
36 Ga0070700_100027382 3300005441 Bacteria 3379
37 Ga0070700_100250674 3300005441 Bacteria 1270
38 Ga0070694_100000089 3300005444 Bacteria 43372
39 Ga0070694_100101766 3300005444 Bacteria 2033
40 Ga0070694_100250348 3300005444 Bacteria 1340
41 Ga0070694_100436936 3300005444 Bacteria 1031
42 Ga0070708_100047371 3300005445 Bacteria 3797
43 Ga0070681_10004952 3300005458 Bacteria 12806
44 Ga0070681_10006508 3300005458 Bacteria 11369
45 Ga0070681_10039880 3300005458 Bacteria 4708
46 Ga0070681_10065178 3300005458 Bacteria 3612
47 Ga0070681_10104476 3300005458 Bacteria 2775
48 Ga0070681_10170111 3300005458 Bacteria 2101
49 Ga0068867_100000803 3300005459 Bacteria 21184
50 Ga0068867_100246750 3300005459 Bacteria 1450
51 Ga0070685_10343006 3300005466 Bacteria 1019
52 Ga0070706_100008902 3300005467 Bacteria 9347
53 Ga0070706_100175971 3300005467 Bacteria 1998
54 Ga0070707_100096915 3300005468 Bacteria 2857
55 Ga0070707_100193028 3300005468 Bacteria 1986
56 Ga0070699_100007817 3300005518 Bacteria 9293
57 Ga0070699_100042427 3300005518 Bacteria 3937
58 Ga0070699_100157095 3300005518 Bacteria 2012
59 Ga0070699_100177886 3300005518 Unclassified 1887
60 Ga0070699_100569104 3300005518 Bacteria 1032
61 Ga0070679_100002303 3300005530 Bacteria 17267
62 Ga0070679_100004206 3300005530 Bacteria 13276
63 Ga0070679_100020254 3300005530 Bacteria 6483
64 Ga0070679_100182007 3300005530 Bacteria 2073
65 Ga0070684_100220695 3300005535 Bacteria 1730
66 Ga0070697_100368380 3300005536 Bacteria 1243
67 Ga0068853_100073359 3300005539 Bacteria 2984
68 Ga0070672_100364851 3300005543 Bacteria 1233
69 Ga0070686_100015485 3300005544 Bacteria 4419
70 Ga0070695_100000187 3300005545 Bacteria 29864
71 Ga0070695_100012890 3300005545 Bacteria 5018
72 Ga0070696_100001338 3300005546 Bacteria 16061
73 Ga0070696_100032326 3300005546 Bacteria 3590
74 Ga0070693_100000125 3300005547 Bacteria 34456
75 Ga0070693_100146137 3300005547 Unclassified 1493
76 Ga0070704_100000051 3300005549 Bacteria 37969
77 Ga0070704_100037038 3300005549 Bacteria 3329
78 Ga0070704_100095354 3300005549 Bacteria 2228
79 Ga0068855_100000741 3300005563 Bacteria 40118
80 Ga0068855_100008189 3300005563 Bacteria 12635
81 Ga0068855_100318145 3300005563 Bacteria 1721
82 Ga0068855_100324154 3300005563 Bacteria 1702
83 Ga0068854_100004113 3300005578 Bacteria 9142
84 Ga0068856_100303682 3300005614 Bacteria 1614
85 Ga0070702_100000541 3300005615 Bacteria 13675
86 Ga0070702_100256679 3300005615 Bacteria 1188
87 Ga0068852_100001065 3300005616 Bacteria 18109
88 Ga0068852_100071329 3300005616 Bacteria 3050
89 Ga0068852_100092079 3300005616 Bacteria 2714
90 Ga0068852_100289184 3300005616 Bacteria 1583
91 Ga0068859_100001531 3300005617 Bacteria 23584
92 Ga0068859_100142583 3300005617 Bacteria 2470
93 Ga0068864_100011457 3300005618 Bacteria 7325
94 Ga0068866_10000255 3300005718 Bacteria 24960
95 Ga0068861_100000466 3300005719 Bacteria 23683
96 Ga0068870_10096558 3300005840 Bacteria 1662
97 Ga0068863_100224661 3300005841 Bacteria 1810
98 Ga0068863_100355585 3300005841 Bacteria 1427
99 Ga0068858_100003050 3300005842 Bacteria 16786
100 Ga0068858_100172481 3300005842 Bacteria 2040
101 Ga0068858_100260116 3300005842 Bacteria 1649
102 Ga0068860_100000810 3300005843 Bacteria 34973
103 Ga0068860_100168700 3300005843 Bacteria 2114
104 Ga0068860_100301336 3300005843 Bacteria 1570
105 Ga0068862_100000622 3300005844 Bacteria 36814
106 Ga0081539_10000784 3300005985 Bacteria 61876
107 Ga0081539_10071362 3300005985 Bacteria 1860
108 Ga0075432_10048644 3300006058 Bacteria 1492
109 Ga0097621_100001560 3300006237 Bacteria 15661
110 Ga0097621_100008366 3300006237 Bacteria 7446
111 Ga0068871_100001324 3300006358 Bacteria 16559
112 Ga0075428_100000835 3300006844 Bacteria 32292
113 Ga0075430_100000498 3300006846 Bacteria 29452
114 Ga0075430_100017098 3300006846 Bacteria 6178
115 Ga0075430_100164059 3300006846 Bacteria 1849
116 Ga0075431_100053565 3300006847 Bacteria 4160
117 Ga0075433_10001421 3300006852 Bacteria 17640
118 Ga0075433_10199581 3300006852 Unclassified 1779
119 Ga0075434_100000621 3300006871 Bacteria 27353
120 Ga0075434_100232796 3300006871 Bacteria 1862
121 Ga0075434_100337016 3300006871 Bacteria 1529
122 Ga0075434_100378632 3300006871 Bacteria 1436
123 Ga0075429_100000096 3300006880 Bacteria 47975
124 Ga0068865_100000149 3300006881 Bacteria 37769
125 Ga0068865_100060475 3300006881 Bacteria 2653
126 Ga0068865_100076304 3300006881 Bacteria 2392
127 Ga0068865_100208602 3300006881 Unclassified 1521
128 Ga0075436_100002057 3300006914 Bacteria 13866
129 Ga0075436_100002295 3300006914 Bacteria 13196
130 Ga0075436_100004725 3300006914 Bacteria 9344
131 Ga0075436_100016335 3300006914 Bacteria 5082
132 Ga0075436_100018953 3300006914 Bacteria 4712
133 Ga0097620_100001531 3300006931 Bacteria 23584
134 Ga0097620_100142579 3300006931 Bacteria 2470
135 Ga0075435_100000485 3300007076 Bacteria 24143
136 Ga0075435_100070358 3300007076 Bacteria 2856
137 Ga0075435_100346564 3300007076 Bacteria 1273
138 Ga0099795_10037098 3300007788 Bacteria 1714
139 Ga0099795_10060513 3300007788 Bacteria 1404
140 Ga0105240_10296262 3300009093 Bacteria 1852
141 Ga0111539_10086522 3300009094 Bacteria 3683
142 Ga0105245_10004647 3300009098 Bacteria 12131
143 Ga0105245_10109153 3300009098 Unclassified 2571
144 Ga0114129_10001405 3300009147 Bacteria 32472
145 Ga0105243_10000577 3300009148 Bacteria 36910
146 Ga0105243_10076683 3300009148 Bacteria 2717
147 Ga0105241_10029327 3300009174 Bacteria 4105
148 Ga0105242_10001966 3300009176 Bacteria 16164
149 Ga0105242_10007977 3300009176 Bacteria 8156
150 Ga0105242_10567009 3300009176 Bacteria 1091
151 Ga0105242_10739365 3300009176 Bacteria 967
152 Ga0105248_10096986 3300009177 Bacteria 3322
153 Ga0105248_10746969 3300009177 Bacteria 1104
154 Ga0105238_10053881 3300009551 Bacteria 4042
155 Ga0105238_10506695 3300009551 Unclassified 1208
156 Ga0157370_10007069 3300013104 Bacteria 12260
157 Ga0157370_10326146 3300013104 Bacteria 1416
158 Ga0157369_10001315 3300013105 Bacteria 30866
159 Ga0157378_10000498 3300013297 Bacteria 37271
160 Ga0157378_10018846 3300013297 Bacteria 6066
161 Ga0157378_10482211 3300013297 Bacteria 1236
162 Ga0163162_10120206 3300013306 Bacteria 2730
163 Ga0157372_10006079 3300013307 Bacteria 12828
164 Ga0157372_10027785 3300013307 Bacteria 6166
165 Ga0157372_10069065 3300013307 Bacteria 3974
166 Ga0157372_10455407 3300013307 Unclassified 1491
167 Ga0157375_10191791 3300013308 Bacteria 2198
168 Ga0157375_10884178 3300013308 Bacteria 1038
169 Ga0157380_10027480 3300014326 Bacteria 4327
170 Ga0157377_10009874 3300014745 Bacteria 4704
171 Ga0157379_10044048 3300014968 Bacteria 3985
172 Ga0157379_10243386 3300014968 Bacteria 1632
173 Ga0157376_10050371 3300014969 Bacteria 3455
174 Ga0213876_10035289 3300021384 Bacteria 2638
175 Ga0207642_10001078 3300025899 Bacteria 8457
176 Ga0207680_10034095 3300025903 Bacteria 2910
177 Ga0207643_10089030 3300025908 Bacteria 1797
178 Ga0207705_10203627 3300025909 Bacteria 1500
179 Ga0207707_10003327 3300025912 Bacteria 14280
180 Ga0207707_10003466 3300025912 Bacteria 13973
181 Ga0207707_10038175 3300025912 Bacteria 4197
182 Ga0207707_10058386 3300025912 Bacteria 3358
183 Ga0207707_10270087 3300025912 Bacteria 1474
184 Ga0207695_10059044 3300025913 Bacteria 3980
185 Ga0207695_10222089 3300025913 Bacteria 1796
186 Ga0207660_10001260 3300025917 Bacteria 16983
187 Ga0207660_10018374 3300025917 Bacteria 4659
188 Ga0207660_10105726 3300025917 Bacteria 2110
189 Ga0207662_10000099 3300025918 Bacteria 40931
190 Ga0207657_10399965 3300025919 Unclassified 1080
191 Ga0207652_10029949 3300025921 Bacteria 4556
192 Ga0207652_10033989 3300025921 Bacteria 4295
193 Ga0207652_10100535 3300025921 Bacteria 2553
194 Ga0207652_10106744 3300025921 Bacteria 2479
195 Ga0207652_10328221 3300025921 Bacteria 1381
196 Ga0207646_10241329 3300025922 Bacteria 1632
197 Ga0207694_10253298 3300025924 Bacteria 1441
198 Ga0207694_10309434 3300025924 Bacteria 1302
199 Ga0207659_10039288 3300025926 Bacteria 3299
200 Ga0207659_10409667 3300025926 Bacteria 1135
201 Ga0207687_10000777 3300025927 Bacteria 21510
202 Ga0207687_10068080 3300025927 Bacteria 2535
203 Ga0207687_10177460 3300025927 Bacteria 1648
204 Ga0207664_10226554 3300025929 Bacteria 1623
205 Ga0207686_10000295 3300025934 Bacteria 36702
206 Ga0207686_10004657 3300025934 Bacteria 7350
207 Ga0207686_10209887 3300025934 Bacteria 1399
208 Ga0207709_10003302 3300025935 Bacteria 9674
209 Ga0207670_10001165 3300025936 Bacteria 13862
210 Ga0207670_10045016 3300025936 Bacteria 2923
211 Ga0207670_10065568 3300025936 Bacteria 2492
212 Ga0207670_10216470 3300025936 Bacteria 1464
213 Ga0207670_10339035 3300025936 Bacteria 1187
214 Ga0207669_10374201 3300025937 Bacteria 1108
215 Ga0207704_10000641 3300025938 Bacteria 15466
216 Ga0207704_10079626 3300025938 Unclassified 2112
217 Ga0207704_10098183 3300025938 Bacteria 1945
218 Ga0207665_10028700 3300025939 Bacteria 3677
219 Ga0207691_10259461 3300025940 Bacteria 1498
220 Ga0207689_10000432 3300025942 Bacteria 39235
221 Ga0207667_10010246 3300025949 Bacteria 10972
222 Ga0207667_10109099 3300025949 Bacteria 2855
223 Ga0207667_10118954 3300025949 Bacteria 2723
224 Ga0207712_10004115 3300025961 Bacteria 9184
225 Ga0207640_10002706 3300025981 Bacteria 9485
226 Ga0207677_10002882 3300026023 Bacteria 9081
227 Ga0207703_10000781 3300026035 Bacteria 31328
228 Ga0207639_10049445 3300026041 Bacteria 3188
229 Ga0207639_10105843 3300026041 Bacteria 2283
230 Ga0207708_10000412 3300026075 Bacteria 33576
231 Ga0207708_10024888 3300026075 Bacteria 4530
232 Ga0207702_10051811 3300026078 Bacteria 3471
233 Ga0207702_10103297 3300026078 Bacteria 2521
234 Ga0207641_10090571 3300026088 Bacteria 2675
235 Ga0207641_10229371 3300026088 Bacteria 1725
236 Ga0207641_10497928 3300026088 Bacteria 1183
237 Ga0207648_10000603 3300026089 Bacteria 40455
238 Ga0207648_10108076 3300026089 Unclassified 2442
239 Ga0207676_10010309 3300026095 Bacteria 6654
240 Ga0207674_10314950 3300026116 Unclassified 1514
241 Ga0207675_100000509 3300026118 Bacteria 37679
242 Ga0207698_10012296 3300026142 Bacteria 5595
243 Ga0207698_10031342 3300026142 Bacteria 3836
244 Ga0207428_10001166 3300027907 Bacteria 28282
245 Ga0207428_10009266 3300027907 Bacteria 8838
246 Ga0268265_10003883 3300028380 Bacteria 10552
247 Ga0268264_10001100 3300028381 Bacteria 26695
248 Ga0268264_10064756 3300028381 Bacteria 3077
249 Ga0307408_100249630 3300031548 Bacteria 1463
250 Ga0307406_10296671 3300031901 Bacteria 1240
251 Ga0307412_10109447 3300031911 Bacteria 1970
252 Ga0307412_10289456 3300031911 Unclassified 1290
253 Ga0307409_100417642 3300031995 Bacteria 1286
254 Ga0307409_100848735 3300031995 Bacteria 924
255 Ga0307416_100115881 3300032002 Bacteria 2374
256 Ga0373930_0024098 3300034816 Bacteria 1215
257 Ga0373930_0029255 3300034816 Bacteria 1125
258 Ga0373948_0043653 3300034817 Bacteria 945
259 Ga0373938_0011857 3300034957 Bacteria 1628
260 Ga0373926_0001396 3300035083 Bacteria 7315
261 Ga0373934_0001052 3300035086 Bacteria 9979
262 Ga0373934_0069446 3300035086 Bacteria 1408
263 Ga0373944_0065812 3300035089 Bacteria 1171
264 Ga0373951_0037390 3300035091 Bacteria 1161
265 Ga0373932_0002695 3300035112 Bacteria 4420
266 Ga0373936_0008146 3300035113 Bacteria 3940
267 Ga0373939_0054531 3300035114 Bacteria 1252
268 Ga0373941_0119701 3300035115 Bacteria 937
269 Ga0373953_0011569 3300035117 Bacteria 3101
270 Ga0373960_0015714 3300035121 Unclassified 1936
271 Ga0373960_0023563 3300035121 Bacteria 1659
272 Ga0373943_0051722 3300035170 Bacteria 2023
273 Ga0373943_0363834 3300035170 Bacteria 831
274 Ga0373955_0095248 3300035172 Bacteria 1702
275 Ga0373961_0008675 3300035241 Unclassified 2476
276 Ga0373931_0015506 3300035691 Bacteria 3739
277 Ga0373931_0017023 3300035691 Unclassified 3587
278 Ga0373931_0025175 3300035691 Bacteria 3022
279 Ga0373931_0121664 3300035691 Bacteria 1492
280 Ga0373935_0140265 3300035692 Unclassified 1632
281 Ga0373927_0020836 3300035695 Bacteria 4297
282 Ga0373933_0006435 3300035724 Bacteria 6395
283 Ga0373947_0010782 3300035725 Bacteria 5243
284 Ga0373937_0000480 3300036401 Bacteria 36669
285 Ga0373937_0023105 3300036401 Bacteria 5595
286 Ga0373937_0074137 3300036401 Bacteria 3140
287 Ga0373937_0302798 3300036401 Bacteria 1511
288 Ga0373925_0064200 3300037068 Bacteria 2763
289 Ga0395899_0031552 3300037312 Bacteria 3982
290 Ga0395905_0001763 3300037471 Bacteria 25156
291 Ga0395901_0042928 3300038443 Bacteria 4690
292 Ga0436365_0112315 3300039437 Bacteria 5736
293 Ga0439441_007974 3300042001 Bacteria 1720
294 Ga0451577_0041592 3300042876 Bacteria 4125
295 Ga0451577_0483760 3300042876 Unclassified 1124
296 Ga0466966_0185837 3300044684 Bacteria 1260
297 Ga0466961_0261882 3300044693 Bacteria 1060
298 Ga0466957_0043099 3300044842 Bacteria 2731
299 Ga0451576_0000927 3300045051 Bacteria 55291
300 Ga0451576_0129536 3300045051 Bacteria 2629
301 Ga0451576_0490836 3300045051 Bacteria 1290
302 Ga0451576_0701335 3300045051 Bacteria 1063
303 Ga0466958_0069294 3300045836 Bacteria 2156
304 Ga0495592_0009882 3300046454 Bacteria 7185
305 Ga0495592_0034924 3300046454 Bacteria 3789
306 Ga0495592_0045312 3300046454 Bacteria 3282
307 Ga0495592_0144277 3300046454 Bacteria 1652
308 Ga0495603_0005362 3300046455 Bacteria 7647
309 Ga0495629_0062592 3300046459 Bacteria 2599
310 Ga0495651_0008591 3300046462 Bacteria 7828
311 Ga0495651_0033218 3300046462 Bacteria 4025
312 Ga0495580_0028853 3300046472 Bacteria 4031
313 Ga0495639_0056148 3300046475 Bacteria 1797
314 Ga0495584_0051516 3300046491 Bacteria 2072
315 Ga0495585_0000287 3300046492 Bacteria 50518
316 Ga0495585_0001520 3300046492 Bacteria 18010
317 Ga0495594_0068983 3300046499 Bacteria 1964
318 Ga0495596_0002017 3300046500 Bacteria 11179
319 Ga0495583_0017836 3300046506 Bacteria 3756
320 Ga0495608_0040622 3300046511 Bacteria 3116
321 Ga0495608_0049120 3300046511 Unclassified 2801
322 Ga0495628_0034782 3300046516 Bacteria 4051
323 Ga0495628_0088530 3300046516 Bacteria 2399
324 Ga0495628_0169305 3300046516 Bacteria 1657
325 Ga0495630_0021421 3300046517 Bacteria 4773
326 Ga0495630_0103982 3300046517 Bacteria 2149
327 Ga0495631_0003930 3300046518 Bacteria 8029
328 Ga0495643_0024732 3300046522 Bacteria 3404
329 Ga0495644_0014689 3300046523 Bacteria 2999
330 Ga0495648_0016654 3300046524 Bacteria 5290
331 Ga0495666_0040516 3300046526 Bacteria 2258
332 Ga0495642_0083224 3300046528 Bacteria 1350
333 Ga0495652_0022002 3300046529 Bacteria 5664
334 Ga0495652_0045593 3300046529 Bacteria 3768
335 Ga0495640_0055691 3300046533 Bacteria 2705
336 Ga0495586_0002442 3300046535 Bacteria 10085
337 Ga0495586_0013205 3300046535 Bacteria 4379
338 Ga0495586_0030151 3300046535 Bacteria 2903
339 Ga0495587_0003948 3300046536 Bacteria 9836
340 Ga0495587_0131862 3300046536 Bacteria 1428
341 Ga0495598_0079482 3300046537 Bacteria 1049
342 Ga0495609_0002760 3300046538 Bacteria 10570
343 Ga0495609_0040353 3300046538 Unclassified 2100
344 Ga0495621_0026282 3300046539 Bacteria 1962
345 Ga0495645_0000372 3300046543 Bacteria 31206
346 Ga0495645_0013911 3300046543 Bacteria 5703
347 Ga0495667_0014118 3300046559 Bacteria 5391
348 Ga0495667_0042412 3300046559 Unclassified 3017
349 Ga0495656_0056194 3300046615 Bacteria 1700
350 Ga0495668_0033663 3300046616 Bacteria 2877
351 Ga0495611_0064210 3300046648 Bacteria 1671
352 Ga0495635_0048050 3300046663 Bacteria 2942
353 Ga0495635_0050824 3300046663 Bacteria 2857
354 Ga0495659_0000447 3300046664 Bacteria 15414
355 Ga0495659_0012106 3300046664 Bacteria 2789
356 Ga0495661_0092491 3300046665 Unclassified 1718
357 Ga0495661_0189030 3300046665 Unclassified 1086
358 Ga0495588_0024694 3300046674 Bacteria 2987
359 Ga0495657_0050937 3300046675 Unclassified 2782
360 Ga0495599_0006891 3300046678 Bacteria 6867
361 Ga0495599_0061567 3300046678 Bacteria 2345
362 Ga0495623_0014417 3300046679 Bacteria 5115
363 Ga0495658_0028314 3300046683 Bacteria 3023
364 Ga0495658_0124874 3300046683 Bacteria 1560
365 Ga0495669_0059363 3300046684 Bacteria 1727
366 Ga0495624_0217260 3300046690 Bacteria 1159
367 Ga0495670_0082273 3300046691 Unclassified 1641
368 Ga0495589_0022998 3300046794 Bacteria 3176
369 Ga0495600_0040389 3300046809 Bacteria 3038
370 Ga0495581_0032039 3300047315 Bacteria 3044
371 Ga0495604_0061351 3300047317 Bacteria 2876
372 Ga0495636_0014013 3300047318 Bacteria 3186
373 Ga0495636_0080938 3300047318 Unclassified 1398
374 Ga0495636_0211716 3300047318 Unclassified 888
375 Ga0495674_0498678 3300047319 Bacteria 974
376 Ga0495676_0060220 3300047321 Bacteria 2977
377 Ga0495680_0043085 3300047322 Bacteria 3576
378 Ga0495680_0267405 3300047322 Bacteria 1208
379 Ga0495683_0013604 3300047323 Bacteria 4252
380 Ga0495677_0060567 3300047445 Unclassified 1403
381 Ga0495626_0004924 3300048091 Bacteria 8014
382 Ga0495626_0013208 3300048091 Bacteria 4298
383 Ga0496115_0005695 3300048918 Bacteria 9065
384 Ga0501033_0011977 3300049570 Bacteria 6626
385 Ga0501033_0060402 3300049570 Bacteria 2797
386 Ga0501036_0022679 3300049572 Bacteria 5283
387 Ga0501037_0014437 3300049573 Bacteria 5813
388 Ga0501040_0051958 3300049576 Bacteria 2804
389 Ga0501041_0013026 3300049577 Bacteria 4926
390 Ga0501041_0013436 3300049577 Bacteria 4854
391 Ga0501042_0016787 3300049578 Bacteria 5033
392 Ga0501042_0058796 3300049578 Bacteria 2744
393 Ga0501046_0012953 3300049580 Bacteria 7085
394 Ga0501047_0144168 3300049581 Bacteria 2259
395 Ga0501048_0022769 3300049582 Bacteria 4580
396 Ga0501068_0048337 3300049584 Bacteria 2568
397 Ga0501068_0093543 3300049584 Bacteria 1857
398 Ga0501069_0007993 3300049585 Bacteria 5554
399 Ga0501069_0110397 3300049585 Bacteria 1566
400 Ga0501070_0000520 3300049586 Bacteria 35280
401 Ga0501070_0413004 3300049586 Bacteria 1091
402 Ga0501072_0002114 3300049588 Bacteria 14797
403 Ga0501073_0001617 3300049589 Bacteria 16692
404 Ga0501073_0079114 3300049589 Bacteria 2288
405 Ga0501074_0032569 3300049590 Bacteria 3775
406 Ga0501075_0005791 3300049591 Bacteria 8455
407 Ga0501075_0051004 3300049591 Bacteria 3111
408 Ga0501076_0001218 3300049592 Bacteria 17111
409 Ga0501077_0006977 3300049593 Bacteria 6958
410 Ga0501225_0071686 3300049705 Bacteria 985
411 Ga0501079_0001515 3300049741 Bacteria 16443
412 Ga0501079_0211860 3300049741 Bacteria 1513
413 Ga0501080_0010186 3300049742 Bacteria 8595
414 Ga0501080_0077367 3300049742 Bacteria 3094
415 Ga0501080_0109322 3300049742 Bacteria 2562
416 Ga0501081_0014737 3300049743 Bacteria 5157
417 Ga0501081_0084931 3300049743 Bacteria 2221
418 Ga0501083_0001545 3300049744 Bacteria 15735
419 Ga0501044_0647181 3300049823 Bacteria 946
420 Ga0501045_0001660 3300049824 Bacteria 14966
421 nmdc:mga05p37_227111_c1 3300050507 Bacteria 2250
422 nmdc:mga05p37_331_c1 3300050507 Bacteria 50709
423 nmdc:mga09592_618_c1 3300050508 Bacteria 27081
424 nmdc:mga0qj67_7277_c1 3300050509 Bacteria 8177
425 nmdc:mga06r32_23555_c2 3300050510 Bacteria 5180
426 nmdc:mga08y16_13335_c1 3300050511 Bacteria 8646
427 nmdc:mga08y16_35813_c1 3300050511 Bacteria 5213
428 nmdc:mga0n895_22197_c1 3300050512 Bacteria 5950
429 nmdc:mga0n895_279647_c1 3300050512 Bacteria 1692
430 nmdc:mga0n895_38916_c1 3300050512 Bacteria 4610
431 nmdc:mga0n895_45616_c1 3300050512 Bacteria 4278
432 nmdc:mga0rr50_179810_c1 3300050513 Bacteria 1728
433 nmdc:mga0rr50_765_c1 3300050513 Bacteria 17289
434 nmdc:mga08x19_11111_c1 3300050514 Bacteria 4877
435 nmdc:mga08x19_1872_c1 3300050514 Bacteria 12891
436 nmdc:mga08x19_27983_c1 3300050514 Bacteria 3528
437 nmdc:mga08x19_77048_c1 3300050514 Bacteria 2183
438 nmdc:mga08x19_877_c1 3300050514 Bacteria 19125
439 nmdc:mga0a205_2581_c1 3300050515 Bacteria 15986
440 Ga0495601_0011617 3300053077 Bacteria 5275
441 Ga0495601_0046155 3300053077 Bacteria 2742
442 Ga0495601_0148073 3300053077 Bacteria 1532
443 Ga0495655_0101223 3300053083 Bacteria 853
444 Ga0495619_0445877 3300053085 Bacteria 892
445 Ga0501084_0020318 3300054114 Bacteria 5537
446 Ga0501084_0060389 3300054114 Bacteria 3174
447 Ga0501082_0019300 3300060353 Bacteria 5877
448 Ga0501082_0505271 3300060353 Bacteria 1056
449 Ga0466962_0153987 3300061719 Bacteria 1116
450 2895517899 2895511927 Bacteria 6802080
451 Ga0466967_0015255
452 JGI25406J46586_10043060
453 Ga0065707_10150126
454 Ga0070658_10210709
455 Ga0070690_100001141
456 Ga0070690_100106024
457 Ga0070690_100361798
458 Ga0070677_10050730
459 Ga0068869_100000089
460 Ga0070666_10185769
461 Ga0070680_100000807
462 Ga0070680_100056354
463 Ga0070680_100086257
464 Ga0070682_100014137
465 Ga0068868_100000554
466 Ga0070689_100000185
467 Ga0070689_100023944
468 Ga0070689_100073688
469 Ga0070689_100259121
470 Ga0070689_100409348
471 Ga0070691_10002337
472 Ga0070687_100000307
473 Ga0070687_100195383
474 Ga0070692_10000165
475 Ga0070692_10079641
476 Ga0070675_100004786
477 Ga0070675_100317115
478 Ga0070671_100490342
479 Ga0070673_100112695
480 Ga0070659_100038956
481 Ga0070701_10000413
482 Ga0070701_10035418
483 Ga0070705_100000541
484 Ga0070705_100159385
485 Ga0070700_100000398
486 Ga0070700_100027382
487 Ga0070700_100250674
488 Ga0070694_100000089
489 Ga0070694_100101766
490 Ga0070694_100250348
491 Ga0070694_100436936
492 Ga0070708_100047371
493 Ga0070681_10004952
494 Ga0070681_10006508
495 Ga0070681_10039880
496 Ga0070681_10065178
497 Ga0070681_10104476
498 Ga0070681_10170111
499 Ga0068867_100000803
500 Ga0068867_100246750
501 Ga0070685_10343006
502 Ga0070706_100008902
503 Ga0070706_100175971
504 Ga0070707_100096915
505 Ga0070707_100193028
506 Ga0070699_100007817
507 Ga0070699_100042427
508 Ga0070699_100157095
509 Ga0070699_100177886
510 Ga0070699_100569104
511 Ga0070679_100002303
512 Ga0070679_100004206
513 Ga0070679_100020254
514 Ga0070679_100182007
515 Ga0070684_100220695
516 Ga0070697_100368380
517 Ga0068853_100073359
518 Ga0070672_100364851
519 Ga0070686_100015485
520 Ga0070695_100000187
521 Ga0070695_100012890
522 Ga0070696_100001338
523 Ga0070696_100032326
524 Ga0070693_100000125
525 Ga0070693_100146137
526 Ga0070704_100000051
527 Ga0070704_100037038
528 Ga0070704_100095354
529 Ga0068855_100000741
530 Ga0068855_100008189
531 Ga0068855_100318145
532 Ga0068855_100324154
533 Ga0068854_100004113
534 Ga0068856_100303682
535 Ga0070702_100000541
536 Ga0070702_100256679
537 Ga0068852_100001065
538 Ga0068852_100071329
539 Ga0068852_100092079
540 Ga0068852_100289184
541 Ga0068859_100001531
542 Ga0068859_100142583
543 Ga0068864_100011457
544 Ga0068866_10000255
545 Ga0068861_100000466
546 Ga0068870_10096558
547 Ga0068863_100224661
548 Ga0068863_100355585
549 Ga0068858_100003050
550 Ga0068858_100172481
551 Ga0068858_100260116
552 Ga0068860_100000810
553 Ga0068860_100168700
554 Ga0068860_100301336
555 Ga0068862_100000622
556 Ga0081539_10000784
557 Ga0081539_10071362
558 Ga0075432_10048644
559 Ga0097621_100001560
560 Ga0097621_100008366
561 Ga0068871_100001324
562 Ga0075428_100000835
563 Ga0075430_100000498
564 Ga0075430_100017098
565 Ga0075430_100164059
566 Ga0075431_100053565
567 Ga0075433_10001421
568 Ga0075433_10199581
569 Ga0075434_100000621
570 Ga0075434_100232796
571 Ga0075434_100337016
572 Ga0075434_100378632
573 Ga0075429_100000096
574 Ga0068865_100000149
575 Ga0068865_100060475
576 Ga0068865_100076304
577 Ga0068865_100208602
578 Ga0075436_100002057
579 Ga0075436_100002295
580 Ga0075436_100004725
581 Ga0075436_100016335
582 Ga0075436_100018953
583 Ga0097620_100001531
584 Ga0097620_100142579
585 Ga0075435_100000485
586 Ga0075435_100070358
587 Ga0075435_100346564
588 Ga0099795_10037098
589 Ga0099795_10060513
590 Ga0105240_10296262
591 Ga0111539_10086522
592 Ga0105245_10004647
593 Ga0105245_10109153
594 Ga0114129_10001405
595 Ga0105243_10000577
596 Ga0105243_10076683
597 Ga0105241_10029327
598 Ga0105242_10001966
599 Ga0105242_10007977
600 Ga0105242_10567009
601 Ga0105242_10739365
602 Ga0105248_10096986
603 Ga0105248_10746969
604 Ga0105238_10053881
605 Ga0105238_10506695
606 Ga0157370_10007069
607 Ga0157370_10326146
608 Ga0157369_10001315
609 Ga0157378_10000498
610 Ga0157378_10018846
611 Ga0157378_10482211
612 Ga0163162_10120206
613 Ga0157372_10006079
614 Ga0157372_10027785
615 Ga0157372_10069065
616 Ga0157372_10455407
617 Ga0157375_10191791
618 Ga0157375_10884178
619 Ga0157380_10027480
620 Ga0157377_10009874
621 Ga0157379_10044048
622 Ga0157379_10243386
623 Ga0157376_10050371
624 Ga0213876_10035289
625 Ga0207642_10001078
626 Ga0207680_10034095
627 Ga0207643_10089030
628 Ga0207705_10203627
629 Ga0207707_10003327
630 Ga0207707_10003466
631 Ga0207707_10038175
632 Ga0207707_10058386
633 Ga0207707_10270087
634 Ga0207695_10059044
635 Ga0207695_10222089
636 Ga0207660_10001260
637 Ga0207660_10018374
638 Ga0207660_10105726
639 Ga0207662_10000099
640 Ga0207657_10399965
641 Ga0207652_10029949
642 Ga0207652_10033989
643 Ga0207652_10100535
644 Ga0207652_10106744
645 Ga0207652_10328221
646 Ga0207646_10241329
647 Ga0207694_10253298
648 Ga0207694_10309434
649 Ga0207659_10039288
650 Ga0207659_10409667
651 Ga0207687_10000777
652 Ga0207687_10068080
653 Ga0207687_10177460
654 Ga0207664_10226554
655 Ga0207686_10000295
656 Ga0207686_10004657
657 Ga0207686_10209887
658 Ga0207709_10003302
659 Ga0207670_10001165
660 Ga0207670_10045016
661 Ga0207670_10065568
662 Ga0207670_10216470
663 Ga0207670_10339035
664 Ga0207669_10374201
665 Ga0207704_10000641
666 Ga0207704_10079626
667 Ga0207704_10098183
668 Ga0207665_10028700
669 Ga0207691_10259461
670 Ga0207689_10000432
671 Ga0207667_10010246
672 Ga0207667_10109099
673 Ga0207667_10118954
674 Ga0207712_10004115
675 Ga0207640_10002706
676 Ga0207677_10002882
677 Ga0207703_10000781
678 Ga0207639_10049445
679 Ga0207639_10105843
680 Ga0207708_10000412
681 Ga0207708_10024888
682 Ga0207702_10051811
683 Ga0207702_10103297
684 Ga0207641_10090571
685 Ga0207641_10229371
686 Ga0207641_10497928
687 Ga0207648_10000603
688 Ga0207648_10108076
689 Ga0207676_10010309
690 Ga0207674_10314950
691 Ga0207675_100000509
692 Ga0207698_10012296
693 Ga0207698_10031342
694 Ga0207428_10001166
695 Ga0207428_10009266
696 Ga0268265_10003883
697 Ga0268264_10001100
698 Ga0268264_10064756
699 Ga0307408_100249630
700 Ga0307406_10296671
701 Ga0307412_10109447
702 Ga0307412_10289456
703 Ga0307409_100417642
704 Ga0307409_100848735
705 Ga0307416_100115881
706 Ga0373930_0024098
707 Ga0373930_0029255
708 Ga0373948_0043653
709 Ga0373938_0011857
710 Ga0373926_0001396
711 Ga0373934_0001052
712 Ga0373934_0069446
713 Ga0373944_0065812
714 Ga0373951_0037390
715 Ga0373932_0002695
716 Ga0373936_0008146
717 Ga0373939_0054531
718 Ga0373941_0119701
719 Ga0373953_0011569
720 Ga0373960_0015714
721 Ga0373960_0023563
722 Ga0373943_0051722
723 Ga0373943_0363834
724 Ga0373955_0095248
725 Ga0373961_0008675
726 Ga0373931_0015506
727 Ga0373931_0017023
728 Ga0373931_0025175
729 Ga0373931_0121664
730 Ga0373935_0140265
731 Ga0373927_0020836
732 Ga0373933_0006435
733 Ga0373947_0010782
734 Ga0373937_0000480
735 Ga0373937_0023105
736 Ga0373937_0074137
737 Ga0373937_0302798
738 Ga0373925_0064200
739 Ga0395899_0031552
740 Ga0395905_0001763
741 Ga0395901_0042928
742 Ga0436365_0112315
743 Ga0439441_007974
744 Ga0451577_0041592
745 Ga0451577_0483760
746 Ga0466966_0185837
747 Ga0466961_0261882
748 Ga0466957_0043099
749 Ga0451576_0000927
750 Ga0451576_0129536
751 Ga0451576_0490836
752 Ga0451576_0701335
753 Ga0466958_0069294
754 Ga0495592_0009882
755 Ga0495592_0034924
756 Ga0495592_0045312
757 Ga0495592_0144277
758 Ga0495603_0005362
759 Ga0495629_0062592
760 Ga0495651_0008591
761 Ga0495651_0033218
762 Ga0495580_0028853
763 Ga0495639_0056148
764 Ga0495584_0051516
765 Ga0495585_0000287
766 Ga0495585_0001520
767 Ga0495594_0068983
768 Ga0495596_0002017
769 Ga0495583_0017836
770 Ga0495608_0040622
771 Ga0495608_0049120
772 Ga0495628_0034782
773 Ga0495628_0088530
774 Ga0495628_0169305
775 Ga0495630_0021421
776 Ga0495630_0103982
777 Ga0495631_0003930
778 Ga0495643_0024732
779 Ga0495644_0014689
780 Ga0495648_0016654
781 Ga0495666_0040516
782 Ga0495642_0083224
783 Ga0495652_0022002
784 Ga0495652_0045593
785 Ga0495640_0055691
786 Ga0495586_0002442
787 Ga0495586_0013205
788 Ga0495586_0030151
789 Ga0495587_0003948
790 Ga0495587_0131862
791 Ga0495598_0079482
792 Ga0495609_0002760
793 Ga0495609_0040353
794 Ga0495621_0026282
795 Ga0495645_0000372
796 Ga0495645_0013911
797 Ga0495667_0014118
798 Ga0495667_0042412
799 Ga0495656_0056194
800 Ga0495668_0033663
801 Ga0495611_0064210
802 Ga0495635_0048050
803 Ga0495635_0050824
804 Ga0495659_0000447
805 Ga0495659_0012106
806 Ga0495661_0092491
807 Ga0495661_0189030
808 Ga0495588_0024694
809 Ga0495657_0050937
810 Ga0495599_0006891
811 Ga0495599_0061567
812 Ga0495623_0014417
813 Ga0495658_0028314
814 Ga0495658_0124874
815 Ga0495669_0059363
816 Ga0495624_0217260
817 Ga0495670_0082273
818 Ga0495589_0022998
819 Ga0495600_0040389
820 Ga0495581_0032039
821 Ga0495604_0061351
822 Ga0495636_0014013
823 Ga0495636_0080938
824 Ga0495636_0211716
825 Ga0495674_0498678
826 Ga0495676_0060220
827 Ga0495680_0043085
828 Ga0495680_0267405
829 Ga0495683_0013604
830 Ga0495677_0060567
831 Ga0495626_0004924
832 Ga0495626_0013208
833 Ga0496115_0005695
834 Ga0501033_0011977
835 Ga0501033_0060402
836 Ga0501036_0022679
837 Ga0501037_0014437
838 Ga0501040_0051958
839 Ga0501041_0013026
840 Ga0501041_0013436
841 Ga0501042_0016787
842 Ga0501042_0058796
843 Ga0501046_0012953
844 Ga0501047_0144168
845 Ga0501048_0022769
846 Ga0501068_0048337
847 Ga0501068_0093543
848 Ga0501069_0007993
849 Ga0501069_0110397
850 Ga0501070_0000520
851 Ga0501070_0413004
852 Ga0501072_0002114
853 Ga0501073_0001617
854 Ga0501073_0079114
855 Ga0501074_0032569
856 Ga0501075_0005791
857 Ga0501075_0051004
858 Ga0501076_0001218
859 Ga0501077_0006977
860 Ga0501225_0071686
861 Ga0501079_0001515
862 Ga0501079_0211860
863 Ga0501080_0010186
864 Ga0501080_0077367
865 Ga0501080_0109322
866 Ga0501081_0014737
867 Ga0501081_0084931
868 Ga0501083_0001545
869 Ga0501044_0647181
870 Ga0501045_0001660
871 nmdc:mga05p37_227111_c1
872 nmdc:mga05p37_331_c1
873 nmdc:mga09592_618_c1
874 nmdc:mga0qj67_7277_c1
875 nmdc:mga06r32_23555_c2
876 nmdc:mga08y16_13335_c1
877 nmdc:mga08y16_35813_c1
878 nmdc:mga0n895_22197_c1
879 nmdc:mga0n895_279647_c1
880 nmdc:mga0n895_38916_c1
881 nmdc:mga0n895_45616_c1
882 nmdc:mga0rr50_179810_c1
883 nmdc:mga0rr50_765_c1
884 nmdc:mga08x19_11111_c1
885 nmdc:mga08x19_1872_c1
886 nmdc:mga08x19_27983_c1
887 nmdc:mga08x19_77048_c1
888 nmdc:mga08x19_877_c1
889 nmdc:mga0a205_2581_c1
890 Ga0495601_0011617
891 Ga0495601_0046155
892 Ga0495601_0148073
893 Ga0495655_0101223
894 Ga0495619_0445877
895 Ga0501084_0020318
896 Ga0501084_0060389
897 Ga0501082_0019300
898 Ga0501082_0505271
899 Ga0466962_0153987
900 2895517899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01614

IclR

Bacterial transcriptional regulator

81

240

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

14

65

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tf1-assembly2.cif.gz_B crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain 0.9485 85 258
2o99-assembly2.cif.gz_B the crystal structure of e.coli iclr c-terminal fragment in complex with glyoxylate 0.939 90 258
1ysp-assembly1.cif.gz_A crystal structure of the c-terminal domain of e. coli transcriptional regulator kdgr. 0.9253 90 259
1tf1-assembly2.cif.gz_B crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain 0.923 85 258
5hpi-assembly1.cif.gz_A crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter 0.9171 95 254
ID Description Score Start End Superfamily
af_P77300_3_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9682 16 85 1.10.10.10
af_P77732_79_254_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9572 89 260 3.30.450.40
2ia2D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9521 14 64 1.10.10.10
af_P77300_77_251_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9513 90 260 3.30.450.40
1tf1B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9485 85 258 3.30.450.40
ID Description Score Start End GO Terms
AF-X1EUD4-F1-model_v4 IclR-ED domain-containing protein 0.9661 95 264 GO:0003677
GO:0003700
GO:0045892
AF-A0A2V9QTZ5-F1-model_v4 IclR-ED domain-containing protein 0.9564 91 257 GO:0003677
GO:0003700
GO:0045892
AF-A0A840QRB9-F1-model_v4 DNA-binding IclR family transcriptional regulator 0.9542 37 264 GO:0003677
GO:0003700
GO:0045892
AF-A0A530M694-F1-model_v4 deleted 0.9534 143 235
AF-Q32DT8-F1-model_v4 Regulator 0.952 134 262 GO:0003677
GO:0003700
GO:0045892

Map