F446407

General Info

Members Datasets Scaffolds Average Seq Length
449 215 898 120

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_11435513|Ga0207665_114355131
Length 124
Sequence MQVVNLADKFASFNEHYSPKIVGELNNFLMKLVKVKGEFVWHHHDAEDEMFMVTKGELHIQFREADGSERDETIRPGEFIIVPHGVEHKPYAKEEVHVILFEPATTLNTGNVQNERTLPELQKI

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0.67
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 14.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_11435513 3300025939 Unclassified 549
2 JGI24751J29686_10001015 3300002459 Bacteria 6155
3 JGI25406J46586_10148171 3300003203 Bacteria 685
4 rootH1_10022006 3300003316 Bacteria 1631
5 rootH2_10141682 3300003320 Bacteria 5371
6 Ga0055531_10008125 3300003794 Bacteria 5591
7 Ga0065714_10112781 3300005288 Bacteria 1450
8 Ga0065714_10395207 3300005288 Bacteria 595
9 Ga0065704_10597674 3300005289 Bacteria 609
10 Ga0065712_10003671 3300005290 Bacteria 5543
11 Ga0065712_10008445 3300005290 Bacteria 2332
12 Ga0065712_10141959 3300005290 Unclassified 1442
13 Ga0065712_10158374 3300005290 Bacteria 1319
14 Ga0065712_10259384 3300005290 Bacteria 928
15 Ga0065712_10553880 3300005290 Unclassified 597
16 Ga0065715_10750599 3300005293 Bacteria 630
17 Ga0065715_10920564 3300005293 Unclassified 568
18 Ga0065707_10140471 3300005295 Bacteria 1780
19 Ga0065707_10188743 3300005295 Unclassified 1373
20 Ga0065707_10214192 3300005295 Bacteria 1252
21 Ga0065707_10635837 3300005295 Bacteria 671
22 Ga0070658_10045885 3300005327 Bacteria 3535
23 Ga0070676_10213201 3300005328 Unclassified 1272
24 Ga0070690_100151910 3300005330 Bacteria 1581
25 Ga0070670_100602022 3300005331 Bacteria 983
26 Ga0070670_100880098 3300005331 Bacteria 811
27 Ga0068869_100246028 3300005334 Bacteria 1426
28 Ga0070666_10782177 3300005335 Bacteria 702
29 Ga0070666_10909802 3300005335 Bacteria 651
30 Ga0070680_100216172 3300005336 Bacteria 1617
31 Ga0068868_100227876 3300005338 Viruses 1562
32 Ga0070689_100344030 3300005340 Bacteria 1249
33 Ga0070689_100358761 3300005340 Bacteria 1224
34 Ga0070689_100789269 3300005340 Bacteria 834
35 Ga0070689_100891490 3300005340 Bacteria 786
36 Ga0070689_102103910 3300005340 Bacteria 517
37 Ga0070687_100031669 3300005343 Bacteria 2596
38 Ga0070687_100045662 3300005343 Bacteria 2238
39 Ga0070687_100711453 3300005343 Bacteria 703
40 Ga0070692_10162196 3300005345 Bacteria 1282
41 Ga0070692_10380204 3300005345 Bacteria 886
42 Ga0070692_11405749 3300005345 Unclassified 504
43 Ga0070668_101168066 3300005347 Bacteria 696
44 Ga0070669_100031386 3300005353 Bacteria 3838
45 Ga0070669_100118124 3300005353 Bacteria 2019
46 Ga0070669_100152679 3300005353 Bacteria 1789
47 Ga0070669_101725417 3300005353 Bacteria 546
48 Ga0070675_100693057 3300005354 Bacteria 927
49 Ga0070675_100808698 3300005354 Bacteria 857
50 Ga0070671_100467200 3300005355 Bacteria 1083
51 Ga0070674_100789590 3300005356 Bacteria 819
52 Ga0070673_100290067 3300005364 Bacteria 1437
53 Ga0070673_100493626 3300005364 Bacteria 1106
54 Ga0070673_100832145 3300005364 Bacteria 853
55 Ga0070688_100093150 3300005365 Bacteria 1972
56 Ga0070688_100337514 3300005365 Bacteria 1099
57 Ga0070688_101088964 3300005365 Unclassified 638
58 Ga0070701_10179359 3300005438 Bacteria 1239
59 Ga0070711_100036030 3300005439 Bacteria 3313
60 Ga0070711_101389619 3300005439 Bacteria 611
61 Ga0070705_100220659 3300005440 Unclassified 1313
62 Ga0070700_100238279 3300005441 Bacteria 1299
63 Ga0070700_100309182 3300005441 Bacteria 1157
64 Ga0070694_101039935 3300005444 Bacteria 681
65 Ga0070708_100045848 3300005445 Bacteria 3854
66 Ga0070708_100318920 3300005445 Bacteria 1464
67 Ga0070708_100995656 3300005445 Bacteria 786
68 Ga0070708_101179588 3300005445 Bacteria 716
69 Ga0070678_101118971 3300005456 Bacteria 728
70 Ga0070662_100259804 3300005457 Bacteria 1399
71 Ga0068867_100365189 3300005459 Unclassified 1208
72 Ga0068867_101096201 3300005459 Bacteria 727
73 Ga0068867_101288800 3300005459 Bacteria 674
74 Ga0070685_10092865 3300005466 Bacteria 1829
75 Ga0070685_11186962 3300005466 Bacteria 579
76 Ga0070707_100148663 3300005468 Unclassified 2281
77 Ga0070707_100352345 3300005468 Unclassified 1430
78 Ga0070707_100388143 3300005468 Bacteria 1356
79 Ga0070707_100866448 3300005468 Bacteria 867
80 Ga0070698_100004308 3300005471 Bacteria 15657
81 Ga0070698_100008587 3300005471 Bacteria 11019
82 Ga0070698_100011891 3300005471 Bacteria 9234
83 Ga0070698_100070680 3300005471 Bacteria 3502
84 Ga0070699_100009684 3300005518 Bacteria 8343
85 Ga0070699_100514518 3300005518 Unclassified 1088
86 Ga0070697_100003950 3300005536 Bacteria 11393
87 Ga0070697_100008176 3300005536 Bacteria 8167
88 Ga0070697_100025013 3300005536 Bacteria 4758
89 Ga0070672_100014065 3300005543 Bacteria 5663
90 Ga0070672_101794127 3300005543 Bacteria 551
91 Ga0070686_100167737 3300005544 Bacteria 1551
92 Ga0070695_100270349 3300005545 Unclassified 1245
93 Ga0070695_101543322 3300005545 Bacteria 553
94 Ga0070696_100055465 3300005546 Bacteria 2763
95 Ga0070696_100095178 3300005546 Unclassified 2126
96 Ga0070704_100106534 3300005549 Unclassified 2124
97 Ga0070704_100618247 3300005549 Bacteria 954
98 Ga0068857_100495009 3300005577 Unclassified 1147
99 Ga0068857_100518265 3300005577 Bacteria 1120
100 Ga0068854_100569914 3300005578 Bacteria 963
101 Ga0068852_100833098 3300005616 Viruses 938
102 Ga0068859_100644488 3300005617 Bacteria 1151
103 Ga0068859_101010339 3300005617 Bacteria 913
104 Ga0068859_101784493 3300005617 Bacteria 679
105 Ga0068864_100042861 3300005618 Bacteria 3873
106 Ga0068864_100056089 3300005618 Bacteria 3404
107 Ga0068864_100302625 3300005618 Viruses 1497
108 Ga0068864_100496361 3300005618 Bacteria 1174
109 Ga0068866_10750987 3300005718 Bacteria 674
110 Ga0068861_100025080 3300005719 Bacteria 4319
111 Ga0068861_100178793 3300005719 Unclassified 1764
112 Ga0068861_100643526 3300005719 Bacteria 978
113 Ga0068851_10132987 3300005834 Viruses 1347
114 Ga0068870_11267165 3300005840 Bacteria 536
115 Ga0068870_11398378 3300005840 Unclassified 512
116 Ga0068863_100013583 3300005841 Bacteria 7856
117 Ga0068863_100032322 3300005841 Bacteria 4988
118 Ga0068863_100409751 3300005841 Bacteria 1327
119 Ga0068858_100198129 3300005842 Bacteria 1898
120 Ga0068860_100041112 3300005843 Bacteria 4416
121 Ga0068860_101128413 3300005843 Bacteria 804
122 Ga0068860_101358855 3300005843 Unclassified 731
123 Ga0068860_101911149 3300005843 Bacteria 615
124 Ga0068862_100560021 3300005844 Bacteria 1092
125 Ga0068862_100730894 3300005844 Bacteria 961
126 Ga0068862_102070934 3300005844 Unclassified 580
127 Ga0068862_102207566 3300005844 Bacteria 562
128 Ga0068862_102711848 3300005844 Bacteria 507
129 Ga0081455_10555566 3300005937 Bacteria 758
130 Ga0081539_10017620 3300005985 Bacteria 5003
131 Ga0070716_100062603 3300006173 Bacteria 2157
132 Ga0070712_100012851 3300006175 Bacteria 5332
133 Ga0097621_100037629 3300006237 Viruses 3879
134 Ga0068871_100006126 3300006358 Bacteria 8474
135 Ga0068871_100828546 3300006358 Unclassified 854
136 Ga0075428_100005179 3300006844 Bacteria 14478
137 Ga0075428_100014983 3300006844 Bacteria 8617
138 Ga0075428_100030596 3300006844 Bacteria 5953
139 Ga0075428_100039553 3300006844 Bacteria 5190
140 Ga0075428_100045252 3300006844 Bacteria 4835
141 Ga0075428_100094179 3300006844 Bacteria 3265
142 Ga0075428_100999624 3300006844 Unclassified 885
143 Ga0075430_100001059 3300006846 Bacteria 21773
144 Ga0075430_100112209 3300006846 Bacteria 2273
145 Ga0075430_100130915 3300006846 Bacteria 2091
146 Ga0075430_100373156 3300006846 Unclassified 1178
147 Ga0075430_100435638 3300006846 Bacteria 1082
148 Ga0075430_100482178 3300006846 Unclassified 1023
149 Ga0075430_100919885 3300006846 Bacteria 720
150 Ga0075430_101618201 3300006846 Unclassified 532
151 Ga0075431_100000125 3300006847 Bacteria 50843
152 Ga0075431_100000418 3300006847 Bacteria 34609
153 Ga0075431_100009922 3300006847 Bacteria 9566
154 Ga0075431_100034894 3300006847 Bacteria 5182
155 Ga0075431_100437044 3300006847 Bacteria 1306
156 Ga0075433_10002367 3300006852 Bacteria 14326
157 Ga0075433_10327621 3300006852 Bacteria 1355
158 Ga0075433_10692687 3300006852 Unclassified 893
159 Ga0075434_100029401 3300006871 Bacteria 5406
160 Ga0075434_100315305 3300006871 Bacteria 1584
161 Ga0075429_100061485 3300006880 Bacteria 3272
162 Ga0075429_100065925 3300006880 Unclassified 3152
163 Ga0075429_100096358 3300006880 Bacteria 2581
164 Ga0075429_100186928 3300006880 Unclassified 1815
165 Ga0075429_100762384 3300006880 Bacteria 848
166 Ga0075429_100822033 3300006880 Bacteria 813
167 Ga0075429_101161933 3300006880 Bacteria 674
168 Ga0075429_101702980 3300006880 Bacteria 547
169 Ga0068865_100400401 3300006881 Bacteria 1124
170 Ga0068865_101087188 3300006881 Bacteria 704
171 Ga0068865_101571039 3300006881 Bacteria 591
172 Ga0075436_100000150 3300006914 Bacteria 43045
173 Ga0075436_100025816 3300006914 Bacteria 4043
174 Ga0097620_100644516 3300006931 Bacteria 1151
175 Ga0097620_101010310 3300006931 Bacteria 913
176 Ga0097620_101784547 3300006931 Bacteria 679
177 Ga0075435_100008799 3300007076 Bacteria 7271
178 Ga0075435_100027692 3300007076 Bacteria 4436
179 Ga0075435_100147081 3300007076 Unclassified 1979
180 Ga0075435_101015474 3300007076 Bacteria 724
181 Ga0099794_10020316 3300007265 Bacteria 3004
182 Ga0099794_10240267 3300007265 Bacteria 933
183 Ga0105244_10232187 3300009036 Bacteria 863
184 Ga0105250_10152383 3300009092 Unclassified 962
185 Ga0111539_10008414 3300009094 Bacteria 13129
186 Ga0111539_10330013 3300009094 Bacteria 1776
187 Ga0111539_10571298 3300009094 Bacteria 1317
188 Ga0114129_10000003 3300009147 Bacteria 183186
189 Ga0114129_10000044 3300009147 Bacteria 106171
190 Ga0114129_10002039 3300009147 Bacteria 27710
191 Ga0114129_10005583 3300009147 Bacteria 17793
192 Ga0114129_10030913 3300009147 Bacteria 7573
193 Ga0114129_10062285 3300009147 Bacteria 5212
194 Ga0114129_10076345 3300009147 Bacteria 4665
195 Ga0114129_10108380 3300009147 Bacteria 3834
196 Ga0114129_10119744 3300009147 Bacteria 3625
197 Ga0114129_10823906 3300009147 Bacteria 1182
198 Ga0114129_10960408 3300009147 Bacteria 1079
199 Ga0114129_11190627 3300009147 Unclassified 950
200 Ga0114129_11676440 3300009147 Unclassified 776
201 Ga0114129_11748095 3300009147 Bacteria 758
202 Ga0105243_10071142 3300009148 Bacteria 2812
203 Ga0105243_11770170 3300009148 Unclassified 648
204 Ga0105241_10359797 3300009174 Bacteria 1266
205 Ga0105241_10589004 3300009174 Bacteria 1003
206 Ga0105242_10023823 3300009176 Bacteria 4829
207 Ga0105242_10138949 3300009176 Bacteria 2106
208 Ga0105242_10374683 3300009176 Unclassified 1321
209 Ga0105242_10463818 3300009176 Bacteria 1197
210 Ga0105248_10234594 3300009177 Viruses 2065
211 Ga0105248_10501245 3300009177 Bacteria 1369
212 Ga0105238_10508473 3300009551 Viruses 1206
213 Ga0105249_10003840 3300009553 Bacteria 12961
214 Ga0105249_10015267 3300009553 Bacteria 6798
215 Ga0105249_10015629 3300009553 Bacteria 6720
216 Ga0105249_10186740 3300009553 Bacteria 2020
217 Ga0105249_10272284 3300009553 Bacteria 1687
218 Ga0105249_10329261 3300009553 Bacteria 1541
219 Ga0105249_10504565 3300009553 Bacteria 1255
220 Ga0105249_11213151 3300009553 Bacteria 825
221 Ga0105249_12171762 3300009553 Bacteria 628
222 Ga0105246_10458259 3300011119 Bacteria 1073
223 Ga0157378_10273560 3300013297 Bacteria 1625
224 Ga0157378_10353791 3300013297 Bacteria 1435
225 Ga0157378_10497878 3300013297 Bacteria 1217
226 Ga0157378_11042351 3300013297 Bacteria 853
227 Ga0157378_12186371 3300013297 Unclassified 604
228 Ga0163162_10020750 3300013306 Bacteria 6459
229 Ga0163162_10182353 3300013306 Bacteria 2226
230 Ga0163162_10890395 3300013306 Bacteria 1004
231 Ga0157375_10161484 3300013308 Unclassified 2383
232 Ga0157375_10326010 3300013308 Bacteria 1700
233 Ga0157375_10423318 3300013308 Bacteria 1498
234 Ga0157375_12334809 3300013308 Bacteria 638
235 Ga0163163_10097956 3300014325 Bacteria 2954
236 Ga0163163_10203078 3300014325 Bacteria 2030
237 Ga0163163_11041486 3300014325 Bacteria 881
238 Ga0163163_12447071 3300014325 Bacteria 580
239 Ga0157380_10024203 3300014326 Bacteria 4593
240 Ga0157380_10062690 3300014326 Bacteria 2979
241 Ga0157380_10402194 3300014326 Unclassified 1300
242 Ga0157380_11060819 3300014326 Bacteria 847
243 Ga0157380_11305423 3300014326 Bacteria 773
244 Ga0157377_10025169 3300014745 Bacteria 3172
245 Ga0157379_10088588 3300014968 Bacteria 2776
246 Ga0157379_10418114 3300014968 Bacteria 1234
247 Ga0157379_11351378 3300014968 Bacteria 689
248 Ga0157376_10004812 3300014969 Bacteria 9404
249 Ga0163161_10148835 3300017792 Bacteria 1778
250 Ga0163161_10216342 3300017792 Bacteria 1482
251 Ga0163161_10364803 3300017792 Unclassified 1151
252 Ga0209050_1002929 3300025298 Bacteria 13370
253 Ga0209257_1000445 3300025304 Bacteria 77902
254 Ga0207656_10020175 3300025321 Viruses 2646
255 Ga0207642_10317119 3300025899 Bacteria 909
256 Ga0207643_10014215 3300025908 Bacteria 4323
257 Ga0207643_11015218 3300025908 Bacteria 536
258 Ga0207684_10011361 3300025910 Bacteria 7794
259 Ga0207684_10266812 3300025910 Bacteria 1477
260 Ga0207684_10453657 3300025910 Bacteria 1100
261 Ga0207684_11147361 3300025910 Bacteria 645
262 Ga0207654_10166261 3300025911 Bacteria 1429
263 Ga0207693_10122004 3300025915 Bacteria 2047
264 Ga0207663_10050669 3300025916 Bacteria 2581
265 Ga0207663_11486223 3300025916 Bacteria 546
266 Ga0207660_10263332 3300025917 Bacteria 1364
267 Ga0207662_10236767 3300025918 Bacteria 1194
268 Ga0207646_10036398 3300025922 Bacteria 4443
269 Ga0207646_10038468 3300025922 Unclassified 4309
270 Ga0207646_10262695 3300025922 Bacteria 1560
271 Ga0207646_10342326 3300025922 Unclassified 1351
272 Ga0207681_10203277 3300025923 Bacteria 1522
273 Ga0207681_10504741 3300025923 Bacteria 991
274 Ga0207659_10024070 3300025926 Bacteria 4074
275 Ga0207659_10538133 3300025926 Unclassified 992
276 Ga0207706_10550636 3300025933 Bacteria 993
277 Ga0207686_10003530 3300025934 Bacteria 8393
278 Ga0207686_11069034 3300025934 Bacteria 657
279 Ga0207686_11161208 3300025934 Bacteria 631
280 Ga0207709_10309869 3300025935 Bacteria 1177
281 Ga0207670_10126821 3300025936 Bacteria 1863
282 Ga0207670_10390550 3300025936 Bacteria 1110
283 Ga0207669_10383647 3300025937 Bacteria 1096
284 Ga0207665_10502472 3300025939 Unclassified 937
285 Ga0207691_10029071 3300025940 Bacteria 5170
286 Ga0207691_10141204 3300025940 Bacteria 2122
287 Ga0207711_10104643 3300025941 Viruses 2508
288 Ga0207689_10649042 3300025942 Bacteria 889
289 Ga0207651_10043766 3300025960 Bacteria 2991
290 Ga0207651_10061440 3300025960 Unclassified 2613
291 Ga0207651_11740605 3300025960 Bacteria 561
292 Ga0207712_10003365 3300025961 Bacteria 10116
293 Ga0207712_10005499 3300025961 Bacteria 7992
294 Ga0207712_10398202 3300025961 Bacteria 1156
295 Ga0207712_10456736 3300025961 Bacteria 1084
296 Ga0207668_10390357 3300025972 Bacteria 1174
297 Ga0207640_10233716 3300025981 Bacteria 1416
298 Ga0207640_11455031 3300025981 Bacteria 615
299 Ga0207658_10252905 3300025986 Bacteria 1498
300 Ga0207677_10301185 3300026023 Bacteria 1324
301 Ga0207677_10914807 3300026023 Viruses 791
302 Ga0207703_10203746 3300026035 Bacteria 1759
303 Ga0207639_12029454 3300026041 Bacteria 536
304 Ga0207708_10040578 3300026075 Bacteria 3548
305 Ga0207708_10112400 3300026075 Bacteria 2116
306 Ga0207708_10140507 3300026075 Bacteria 1894
307 Ga0207708_10294171 3300026075 Bacteria 1319
308 Ga0207641_10000088 3300026088 Bacteria 131959
309 Ga0207641_11273576 3300026088 Bacteria 735
310 Ga0207648_10052863 3300026089 Bacteria 3552
311 Ga0207648_10238071 3300026089 Bacteria 1620
312 Ga0207648_10869461 3300026089 Bacteria 841
313 Ga0207676_10034992 3300026095 Bacteria 3807
314 Ga0207676_10068859 3300026095 Bacteria 2832
315 Ga0207676_10562819 3300026095 Bacteria 1090
316 Ga0207674_10076254 3300026116 Bacteria 3361
317 Ga0207674_11527315 3300026116 Bacteria 637
318 Ga0207675_100002214 3300026118 Bacteria 19316
319 Ga0207675_100221436 3300026118 Bacteria 1823
320 Ga0207675_100264559 3300026118 Bacteria 1667
321 Ga0207675_101195080 3300026118 Unclassified 781
322 Ga0207698_10458329 3300026142 Viruses 1232
323 Ga0209588_1021847 3300027671 Bacteria 2012
324 Ga0207428_10072916 3300027907 Bacteria 2694
325 Ga0268265_10446345 3300028380 Bacteria 1207
326 Ga0268265_11494624 3300028380 Bacteria 679
327 Ga0268264_10027659 3300028381 Bacteria 4635
328 Ga0268264_10295149 3300028381 Bacteria 1524
329 Ga0268264_10441593 3300028381 Viruses 1259
330 Ga0268264_10535401 3300028381 Bacteria 1147
331 Ga0268264_11524919 3300028381 Bacteria 679
332 Ga0268264_12656916 3300028381 Bacteria 505
333 Ga0307515_10000012 3300028794 Bacteria 582232
334 Ga0307514_10058858 3300031649 Unclassified 2938
335 Ga0307416_101345744 3300032002 Unclassified 820
336 Ga0307414_10005389 3300032004 Bacteria 7042
337 Ga0307414_10369750 3300032004 Bacteria 1236
338 Ga0373932_0147770 3300035112 Unclassified 804
339 Ga0373941_0335351 3300035115 Bacteria 612
340 Ga0373953_0371229 3300035117 Bacteria 628
341 Ga0373946_0022616 3300035171 Bacteria 2449
342 Ga0373961_0338933 3300035241 Unclassified 565
343 Ga0373931_0062726 3300035691 Bacteria 2007
344 Ga0373931_0873800 3300035691 Unclassified 603
345 Ga0373937_0333906 3300036401 Bacteria 1435
346 Ga0395899_0025129 3300037312 Bacteria 4498
347 Ga0395900_0017423 3300037418 Bacteria 7333
348 Ga0395900_0837686 3300037418 Bacteria 846
349 Ga0395900_1280316 3300037418 Bacteria 647
350 Ga0395905_0678985 3300037471 Unclassified 932
351 Ga0395901_0005778 3300038443 Bacteria 12529
352 Ga0400488_21445 3300038741 Bacteria 2959
353 Ga0242420_022995 3300038996 Bacteria 1124
354 Ga0451798_0898072 3300041458 Bacteria 1433
355 Ga0451800_1022601 3300041459 Unclassified 545
356 Ga0451853_2883175 3300041512 Unclassified 705
357 Ga0450923_000816 3300042125 Bacteria 3751
358 Ga0450923_084987 3300042125 Bacteria 716
359 Ga0450918_079493 3300042531 Bacteria 624
360 Ga0451576_0006745 3300045051 Bacteria 13978
361 Ga0451576_0623467 3300045051 Bacteria 1133
362 Ga0495650_0036929 3300046471 Bacteria 2132
363 Ga0495584_0576396 3300046491 Bacteria 574
364 Ga0495598_0385531 3300046537 Bacteria 545
365 Ga0495621_0093150 3300046539 Bacteria 1138
366 Ga0495656_0280513 3300046615 Bacteria 849
367 Ga0495668_0000031 3300046616 Bacteria 256576
368 Ga0495635_1098841 3300046663 Bacteria 503
369 Ga0495669_0080409 3300046684 Bacteria 1495
370 Ga0495670_0450102 3300046691 Bacteria 698
371 Ga0495636_0053842 3300047318 Bacteria 1690
372 Ga0496106_1076126 3300048909 Unclassified 631
373 Ga0496125_0186929 3300048928 Bacteria 1373
374 Ga0501032_0000800 3300049569 Bacteria 25544
375 Ga0501034_0012345 3300049571 Bacteria 8826
376 Ga0501036_0072381 3300049572 Bacteria 2913
377 Ga0501037_0132594 3300049573 Bacteria 1786
378 Ga0501038_0037757 3300049574 Bacteria 4234
379 Ga0501039_0004939 3300049575 Bacteria 10111
380 Ga0501040_0150421 3300049576 Bacteria 1642
381 Ga0501041_0433165 3300049577 Bacteria 834
382 Ga0501042_0472873 3300049578 Bacteria 909
383 Ga0501043_0108536 3300049579 Bacteria 2179
384 Ga0501046_0005511 3300049580 Bacteria 11304
385 Ga0501048_0012515 3300049582 Bacteria 6314
386 Ga0501067_0025454 3300049583 Bacteria 3280
387 Ga0501067_0122707 3300049583 Bacteria 1446
388 Ga0501068_0645448 3300049584 Bacteria 691
389 Ga0501069_0153247 3300049585 Bacteria 1325
390 Ga0501070_0003475 3300049586 Bacteria 13661
391 Ga0501070_0458143 3300049586 Bacteria 1028
392 Ga0501071_0288876 3300049587 Bacteria 1242
393 Ga0501073_0001657 3300049589 Bacteria 16510
394 Ga0501074_0002283 3300049590 Bacteria 13342
395 Ga0501074_0235858 3300049590 Bacteria 1302
396 Ga0501075_0521672 3300049591 Bacteria 906
397 Ga0501075_0810773 3300049591 Bacteria 712
398 Ga0501076_0160171 3300049592 Bacteria 1833
399 Ga0501079_0064088 3300049741 Bacteria 2835
400 Ga0501079_0419521 3300049741 Bacteria 1050
401 Ga0501080_0027738 3300049742 Bacteria 5265
402 Ga0501080_0404134 3300049742 Unclassified 1228
403 Ga0501081_0071228 3300049743 Bacteria 2423
404 Ga0501083_0019595 3300049744 Bacteria 4712
405 Ga0501282_012322 3300049778 Bacteria 923
406 Ga0501035_0005819 3300049822 Bacteria 11623
407 Ga0501044_0005824 3300049823 Bacteria 13650
408 Ga0501045_0078746 3300049824 Bacteria 2430
409 nmdc:mga05p37_1218995_c1 3300050507 Bacteria 775
410 nmdc:mga05p37_148985_c1 3300050507 Bacteria 2864
411 nmdc:mga05p37_153334_c1 3300050507 Unclassified 2817
412 nmdc:mga05p37_1601179_c1 3300050507 Bacteria 642
413 nmdc:mga05p37_198_c1 3300050507 Bacteria 59977
414 nmdc:mga05p37_254_c1 3300050507 Bacteria 55030
415 nmdc:mga05p37_26000_c1 3300050507 Bacteria 1375
416 nmdc:mga05p37_366647_c1 3300050507 Unclassified 1692
417 nmdc:mga05p37_417_c1 3300050507 Bacteria 46047
418 nmdc:mga05p37_466644_c1 3300050507 Bacteria 1458
419 nmdc:mga09592_221633_c1 3300050508 Unclassified 1639
420 nmdc:mga09592_5865_c1 3300050508 Bacteria 10024
421 nmdc:mga09592_668701_c1 3300050508 Bacteria 886
422 nmdc:mga09592_70452_c1 3300050508 Unclassified 2967
423 nmdc:mga09592_965478_c1 3300050508 Bacteria 714
424 nmdc:mga0qj67_109400_c1 3300050509 Bacteria 2230
425 nmdc:mga0qj67_1274597_c1 3300050509 Bacteria 570
426 nmdc:mga0qj67_3711_c1 3300050509 Bacteria 11017
427 nmdc:mga0qj67_433916_c1 3300050509 Bacteria 1059
428 nmdc:mga06r32_133626_c1 3300050510 Unclassified 2455
429 nmdc:mga06r32_175146_c1 3300050510 Bacteria 2129
430 nmdc:mga06r32_2880_c1 3300050510 Bacteria 15430
431 nmdc:mga06r32_32025_c1 3300050510 Bacteria 4942
432 nmdc:mga06r32_3387_c1 3300050510 Bacteria 14255
433 nmdc:mga08y16_1265522_c1 3300050511 Unclassified 706
434 nmdc:mga08y16_206671_c1 3300050511 Bacteria 2034
435 nmdc:mga08y16_350886_c1 3300050511 Bacteria 1515
436 nmdc:mga0n895_1117145_c1 3300050512 Bacteria 765
437 nmdc:mga0n895_1342_c1 3300050512 Bacteria 18240
438 nmdc:mga0n895_152221_c1 3300050512 Unclassified 2344
439 nmdc:mga0n895_615167_c1 3300050512 Bacteria 1088
440 nmdc:mga0rr50_155148_c1 3300050513 Bacteria 1854
441 nmdc:mga0rr50_98889_c1 3300050513 Unclassified 2288
442 nmdc:mga08x19_274_c1 3300050514 Bacteria 38873
443 nmdc:mga0a205_117_c1 3300050515 Bacteria 47476
444 nmdc:mga0a205_204772_c1 3300050515 Unclassified 1863
445 nmdc:mga0a205_564978_c1 3300050515 Unclassified 992
446 nmdc:mga0a205_6393_c2 3300050515 Bacteria 10267
447 Ga0590077_008484 3300059426 Bacteria 2104
448 Ga0501082_0049896 3300060353 Bacteria 3609
449 Ga0530510_0222236 3300061734 Bacteria 1404
450 Ga0207665_11435513
451 JGI24751J29686_10001015
452 JGI25406J46586_10148171
453 rootH1_10022006
454 rootH2_10141682
455 Ga0055531_10008125
456 Ga0065714_10112781
457 Ga0065714_10395207
458 Ga0065704_10597674
459 Ga0065712_10003671
460 Ga0065712_10008445
461 Ga0065712_10141959
462 Ga0065712_10158374
463 Ga0065712_10259384
464 Ga0065712_10553880
465 Ga0065715_10750599
466 Ga0065715_10920564
467 Ga0065707_10140471
468 Ga0065707_10188743
469 Ga0065707_10214192
470 Ga0065707_10635837
471 Ga0070658_10045885
472 Ga0070676_10213201
473 Ga0070690_100151910
474 Ga0070670_100602022
475 Ga0070670_100880098
476 Ga0068869_100246028
477 Ga0070666_10782177
478 Ga0070666_10909802
479 Ga0070680_100216172
480 Ga0068868_100227876
481 Ga0070689_100344030
482 Ga0070689_100358761
483 Ga0070689_100789269
484 Ga0070689_100891490
485 Ga0070689_102103910
486 Ga0070687_100031669
487 Ga0070687_100045662
488 Ga0070687_100711453
489 Ga0070692_10162196
490 Ga0070692_10380204
491 Ga0070692_11405749
492 Ga0070668_101168066
493 Ga0070669_100031386
494 Ga0070669_100118124
495 Ga0070669_100152679
496 Ga0070669_101725417
497 Ga0070675_100693057
498 Ga0070675_100808698
499 Ga0070671_100467200
500 Ga0070674_100789590
501 Ga0070673_100290067
502 Ga0070673_100493626
503 Ga0070673_100832145
504 Ga0070688_100093150
505 Ga0070688_100337514
506 Ga0070688_101088964
507 Ga0070701_10179359
508 Ga0070711_100036030
509 Ga0070711_101389619
510 Ga0070705_100220659
511 Ga0070700_100238279
512 Ga0070700_100309182
513 Ga0070694_101039935
514 Ga0070708_100045848
515 Ga0070708_100318920
516 Ga0070708_100995656
517 Ga0070708_101179588
518 Ga0070678_101118971
519 Ga0070662_100259804
520 Ga0068867_100365189
521 Ga0068867_101096201
522 Ga0068867_101288800
523 Ga0070685_10092865
524 Ga0070685_11186962
525 Ga0070707_100148663
526 Ga0070707_100352345
527 Ga0070707_100388143
528 Ga0070707_100866448
529 Ga0070698_100004308
530 Ga0070698_100008587
531 Ga0070698_100011891
532 Ga0070698_100070680
533 Ga0070699_100009684
534 Ga0070699_100514518
535 Ga0070697_100003950
536 Ga0070697_100008176
537 Ga0070697_100025013
538 Ga0070672_100014065
539 Ga0070672_101794127
540 Ga0070686_100167737
541 Ga0070695_100270349
542 Ga0070695_101543322
543 Ga0070696_100055465
544 Ga0070696_100095178
545 Ga0070704_100106534
546 Ga0070704_100618247
547 Ga0068857_100495009
548 Ga0068857_100518265
549 Ga0068854_100569914
550 Ga0068852_100833098
551 Ga0068859_100644488
552 Ga0068859_101010339
553 Ga0068859_101784493
554 Ga0068864_100042861
555 Ga0068864_100056089
556 Ga0068864_100302625
557 Ga0068864_100496361
558 Ga0068866_10750987
559 Ga0068861_100025080
560 Ga0068861_100178793
561 Ga0068861_100643526
562 Ga0068851_10132987
563 Ga0068870_11267165
564 Ga0068870_11398378
565 Ga0068863_100013583
566 Ga0068863_100032322
567 Ga0068863_100409751
568 Ga0068858_100198129
569 Ga0068860_100041112
570 Ga0068860_101128413
571 Ga0068860_101358855
572 Ga0068860_101911149
573 Ga0068862_100560021
574 Ga0068862_100730894
575 Ga0068862_102070934
576 Ga0068862_102207566
577 Ga0068862_102711848
578 Ga0081455_10555566
579 Ga0081539_10017620
580 Ga0070716_100062603
581 Ga0070712_100012851
582 Ga0097621_100037629
583 Ga0068871_100006126
584 Ga0068871_100828546
585 Ga0075428_100005179
586 Ga0075428_100014983
587 Ga0075428_100030596
588 Ga0075428_100039553
589 Ga0075428_100045252
590 Ga0075428_100094179
591 Ga0075428_100999624
592 Ga0075430_100001059
593 Ga0075430_100112209
594 Ga0075430_100130915
595 Ga0075430_100373156
596 Ga0075430_100435638
597 Ga0075430_100482178
598 Ga0075430_100919885
599 Ga0075430_101618201
600 Ga0075431_100000125
601 Ga0075431_100000418
602 Ga0075431_100009922
603 Ga0075431_100034894
604 Ga0075431_100437044
605 Ga0075433_10002367
606 Ga0075433_10327621
607 Ga0075433_10692687
608 Ga0075434_100029401
609 Ga0075434_100315305
610 Ga0075429_100061485
611 Ga0075429_100065925
612 Ga0075429_100096358
613 Ga0075429_100186928
614 Ga0075429_100762384
615 Ga0075429_100822033
616 Ga0075429_101161933
617 Ga0075429_101702980
618 Ga0068865_100400401
619 Ga0068865_101087188
620 Ga0068865_101571039
621 Ga0075436_100000150
622 Ga0075436_100025816
623 Ga0097620_100644516
624 Ga0097620_101010310
625 Ga0097620_101784547
626 Ga0075435_100008799
627 Ga0075435_100027692
628 Ga0075435_100147081
629 Ga0075435_101015474
630 Ga0099794_10020316
631 Ga0099794_10240267
632 Ga0105244_10232187
633 Ga0105250_10152383
634 Ga0111539_10008414
635 Ga0111539_10330013
636 Ga0111539_10571298
637 Ga0114129_10000003
638 Ga0114129_10000044
639 Ga0114129_10002039
640 Ga0114129_10005583
641 Ga0114129_10030913
642 Ga0114129_10062285
643 Ga0114129_10076345
644 Ga0114129_10108380
645 Ga0114129_10119744
646 Ga0114129_10823906
647 Ga0114129_10960408
648 Ga0114129_11190627
649 Ga0114129_11676440
650 Ga0114129_11748095
651 Ga0105243_10071142
652 Ga0105243_11770170
653 Ga0105241_10359797
654 Ga0105241_10589004
655 Ga0105242_10023823
656 Ga0105242_10138949
657 Ga0105242_10374683
658 Ga0105242_10463818
659 Ga0105248_10234594
660 Ga0105248_10501245
661 Ga0105238_10508473
662 Ga0105249_10003840
663 Ga0105249_10015267
664 Ga0105249_10015629
665 Ga0105249_10186740
666 Ga0105249_10272284
667 Ga0105249_10329261
668 Ga0105249_10504565
669 Ga0105249_11213151
670 Ga0105249_12171762
671 Ga0105246_10458259
672 Ga0157378_10273560
673 Ga0157378_10353791
674 Ga0157378_10497878
675 Ga0157378_11042351
676 Ga0157378_12186371
677 Ga0163162_10020750
678 Ga0163162_10182353
679 Ga0163162_10890395
680 Ga0157375_10161484
681 Ga0157375_10326010
682 Ga0157375_10423318
683 Ga0157375_12334809
684 Ga0163163_10097956
685 Ga0163163_10203078
686 Ga0163163_11041486
687 Ga0163163_12447071
688 Ga0157380_10024203
689 Ga0157380_10062690
690 Ga0157380_10402194
691 Ga0157380_11060819
692 Ga0157380_11305423
693 Ga0157377_10025169
694 Ga0157379_10088588
695 Ga0157379_10418114
696 Ga0157379_11351378
697 Ga0157376_10004812
698 Ga0163161_10148835
699 Ga0163161_10216342
700 Ga0163161_10364803
701 Ga0209050_1002929
702 Ga0209257_1000445
703 Ga0207656_10020175
704 Ga0207642_10317119
705 Ga0207643_10014215
706 Ga0207643_11015218
707 Ga0207684_10011361
708 Ga0207684_10266812
709 Ga0207684_10453657
710 Ga0207684_11147361
711 Ga0207654_10166261
712 Ga0207693_10122004
713 Ga0207663_10050669
714 Ga0207663_11486223
715 Ga0207660_10263332
716 Ga0207662_10236767
717 Ga0207646_10036398
718 Ga0207646_10038468
719 Ga0207646_10262695
720 Ga0207646_10342326
721 Ga0207681_10203277
722 Ga0207681_10504741
723 Ga0207659_10024070
724 Ga0207659_10538133
725 Ga0207706_10550636
726 Ga0207686_10003530
727 Ga0207686_11069034
728 Ga0207686_11161208
729 Ga0207709_10309869
730 Ga0207670_10126821
731 Ga0207670_10390550
732 Ga0207669_10383647
733 Ga0207665_10502472
734 Ga0207691_10029071
735 Ga0207691_10141204
736 Ga0207711_10104643
737 Ga0207689_10649042
738 Ga0207651_10043766
739 Ga0207651_10061440
740 Ga0207651_11740605
741 Ga0207712_10003365
742 Ga0207712_10005499
743 Ga0207712_10398202
744 Ga0207712_10456736
745 Ga0207668_10390357
746 Ga0207640_10233716
747 Ga0207640_11455031
748 Ga0207658_10252905
749 Ga0207677_10301185
750 Ga0207677_10914807
751 Ga0207703_10203746
752 Ga0207639_12029454
753 Ga0207708_10040578
754 Ga0207708_10112400
755 Ga0207708_10140507
756 Ga0207708_10294171
757 Ga0207641_10000088
758 Ga0207641_11273576
759 Ga0207648_10052863
760 Ga0207648_10238071
761 Ga0207648_10869461
762 Ga0207676_10034992
763 Ga0207676_10068859
764 Ga0207676_10562819
765 Ga0207674_10076254
766 Ga0207674_11527315
767 Ga0207675_100002214
768 Ga0207675_100221436
769 Ga0207675_100264559
770 Ga0207675_101195080
771 Ga0207698_10458329
772 Ga0209588_1021847
773 Ga0207428_10072916
774 Ga0268265_10446345
775 Ga0268265_11494624
776 Ga0268264_10027659
777 Ga0268264_10295149
778 Ga0268264_10441593
779 Ga0268264_10535401
780 Ga0268264_11524919
781 Ga0268264_12656916
782 Ga0307515_10000012
783 Ga0307514_10058858
784 Ga0307416_101345744
785 Ga0307414_10005389
786 Ga0307414_10369750
787 Ga0373932_0147770
788 Ga0373941_0335351
789 Ga0373953_0371229
790 Ga0373946_0022616
791 Ga0373961_0338933
792 Ga0373931_0062726
793 Ga0373931_0873800
794 Ga0373937_0333906
795 Ga0395899_0025129
796 Ga0395900_0017423
797 Ga0395900_0837686
798 Ga0395900_1280316
799 Ga0395905_0678985
800 Ga0395901_0005778
801 Ga0400488_21445
802 Ga0242420_022995
803 Ga0451798_0898072
804 Ga0451800_1022601
805 Ga0451853_2883175
806 Ga0450923_000816
807 Ga0450923_084987
808 Ga0450918_079493
809 Ga0451576_0006745
810 Ga0451576_0623467
811 Ga0495650_0036929
812 Ga0495584_0576396
813 Ga0495598_0385531
814 Ga0495621_0093150
815 Ga0495656_0280513
816 Ga0495668_0000031
817 Ga0495635_1098841
818 Ga0495669_0080409
819 Ga0495670_0450102
820 Ga0495636_0053842
821 Ga0496106_1076126
822 Ga0496125_0186929
823 Ga0501032_0000800
824 Ga0501034_0012345
825 Ga0501036_0072381
826 Ga0501037_0132594
827 Ga0501038_0037757
828 Ga0501039_0004939
829 Ga0501040_0150421
830 Ga0501041_0433165
831 Ga0501042_0472873
832 Ga0501043_0108536
833 Ga0501046_0005511
834 Ga0501048_0012515
835 Ga0501067_0025454
836 Ga0501067_0122707
837 Ga0501068_0645448
838 Ga0501069_0153247
839 Ga0501070_0003475
840 Ga0501070_0458143
841 Ga0501071_0288876
842 Ga0501073_0001657
843 Ga0501074_0002283
844 Ga0501074_0235858
845 Ga0501075_0521672
846 Ga0501075_0810773
847 Ga0501076_0160171
848 Ga0501079_0064088
849 Ga0501079_0419521
850 Ga0501080_0027738
851 Ga0501080_0404134
852 Ga0501081_0071228
853 Ga0501083_0019595
854 Ga0501282_012322
855 Ga0501035_0005819
856 Ga0501044_0005824
857 Ga0501045_0078746
858 nmdc:mga05p37_1218995_c1
859 nmdc:mga05p37_148985_c1
860 nmdc:mga05p37_153334_c1
861 nmdc:mga05p37_1601179_c1
862 nmdc:mga05p37_198_c1
863 nmdc:mga05p37_254_c1
864 nmdc:mga05p37_26000_c1
865 nmdc:mga05p37_366647_c1
866 nmdc:mga05p37_417_c1
867 nmdc:mga05p37_466644_c1
868 nmdc:mga09592_221633_c1
869 nmdc:mga09592_5865_c1
870 nmdc:mga09592_668701_c1
871 nmdc:mga09592_70452_c1
872 nmdc:mga09592_965478_c1
873 nmdc:mga0qj67_109400_c1
874 nmdc:mga0qj67_1274597_c1
875 nmdc:mga0qj67_3711_c1
876 nmdc:mga0qj67_433916_c1
877 nmdc:mga06r32_133626_c1
878 nmdc:mga06r32_175146_c1
879 nmdc:mga06r32_2880_c1
880 nmdc:mga06r32_32025_c1
881 nmdc:mga06r32_3387_c1
882 nmdc:mga08y16_1265522_c1
883 nmdc:mga08y16_206671_c1
884 nmdc:mga08y16_350886_c1
885 nmdc:mga0n895_1117145_c1
886 nmdc:mga0n895_1342_c1
887 nmdc:mga0n895_152221_c1
888 nmdc:mga0n895_615167_c1
889 nmdc:mga0rr50_155148_c1
890 nmdc:mga0rr50_98889_c1
891 nmdc:mga08x19_274_c1
892 nmdc:mga0a205_117_c1
893 nmdc:mga0a205_204772_c1
894 nmdc:mga0a205_564978_c1
895 nmdc:mga0a205_6393_c2
896 Ga0590077_008484
897 Ga0501082_0049896
898 Ga0530510_0222236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

29

102

0.84

PF00190

Cupin_1

Cupin

5

123

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9927 4 98
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9198 2 99
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.916 4 98
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9156 2 99
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.9124 3 99
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9733 1 98 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9434 1 98 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9205 28 97 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9113 3 97 2.60.120.10
af_Q9SSE9_506_868_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8962 66 97 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9948 5 93
AF-A0A7W1FG58-F1-model_v4 Cupin domain-containing protein 0.9935 1 92
AF-A0A520N3S9-F1-model_v4 Cupin domain-containing protein 0.9932 1 94
AF-A0A6B3GK81-F1-model_v4 Cupin domain-containing protein 0.9923 2 87
AF-A0A2V9EC22-F1-model_v4 Cupin domain-containing protein 0.9902 1 119

Map