F446250

General Info

Members Datasets Scaffolds Average Seq Length
448 293 408 401

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0182402|Ga0501076_0182402_293_1666
Length 457
Sequence MRPDIVAFSWRPLKGHAAAQKKGSSPNSGIDGLTTAAANLVLSKHQEQEAAVAPRDAMSWLEGWEGYAVSEDRIEVRGSQSWCVIRLEPIAGASRCCSGCGELTRVIHDQEERRIRDLPVFEHAVELIVPRVRVHCRVCGPRLERLVWLDAYARVTRRLAASVSQLCRVASIRHVAQFFGLDWKTVKALDRARLEDEVGSPDLDDLTVIAMDEFAIQKGHRYATVIVEPTRKRVLWVGRGRGRTDVRPFFEQLGAERCARLEAAVMDMNAAFRLEVQAHCPNAAIVFDLFHVVAKYGREVIDRVRVDQANALRTDRKQRKIVKSARWLLLRNRDSLRPEEDASLDELLAANRSLFVVYVLRDALRELWRYRHPGHAQQAWRSWYRKALRSGIAPLRRFARALRPYRSGILAHCRYPLGTNLIEGINNKIKVIKRMAYGFRDDEYFFLKIRAAFPGVG

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
5 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
6 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
7 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
8 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
9 2885266251 Ralstonia sp. SET104 Isolate Nodule
10 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
20 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
174 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
175 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
176 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
177 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
184 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
267 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
268 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
269 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
270 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
271 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
272 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
289 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
290 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
291 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
292 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
293 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.73
Metatranscriptomes 1.34
Isolates 8.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 2.46
Rhizoplane 0.67
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 6.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003077 3300001904 Bacteria 2911
2 JGI24741J21665_1003993 3300001915 Bacteria 3371
3 JGI24746J21847_1007798 3300001977 Bacteria 1629
4 JGI24740J21852_10005697 3300001979 Bacteria 5238
5 JGI24739J22299_10030441 3300001989 Bacteria 1871
6 JGI24748J21848_1006516 3300002074 Bacteria 1360
7 JGI24035J26624_1004702 3300002126 Bacteria 1298
8 JGI24742J22300_10014209 3300002244 Bacteria 1337
9 JGI25154J39366_1008382 3300002738 Bacteria 1336
10 JGI25158J39367_1002144 3300002739 Bacteria 3300
11 JGI25159J45721_1002989 3300002987 Bacteria 6143
12 rootH2_10009100 3300003320 Bacteria 2878
13 rootH2_10160122 3300003320 Bacteria 1919
14 rootL2_10003582 3300003322 Bacteria 8520
15 rootL2_10060793 3300003322 Bacteria 1319
16 rootL2_10300805 3300003322 Bacteria 1350
17 rootH1_10118944 3300003323 Bacteria 1495
18 JGI25161J50226_1003547 3300003374 Bacteria 3529
19 Ga0055534_1011259 3300003784 Bacteria 1828
20 Ga0055534_1013189 3300003784 Bacteria 1596
21 Ga0055534_1015036 3300003784 Bacteria 1430
22 Ga0058692_1009908 3300003856 Bacteria 2380
23 Ga0058692_1020624 3300003856 Bacteria 1381
24 Ga0055543_1000288 3300004625 Bacteria 36504
25 Ga0065165_1000559 3300005262 Bacteria 55415
26 Ga0065704_10002840 3300005289 Bacteria 9754
27 Ga0070658_10207023 3300005327 Bacteria 1656
28 Ga0070658_10300036 3300005327 Bacteria 1370
29 Ga0070677_10070710 3300005333 Bacteria 1467
30 Ga0068869_100013257 3300005334 Bacteria 5478
31 Ga0070680_100278896 3300005336 Bacteria 1416
32 Ga0068868_100277062 3300005338 Unclassified 1418
33 Ga0070660_100257774 3300005339 Bacteria 1423
34 Ga0070689_100223056 3300005340 Bacteria 1547
35 Ga0070668_100174620 3300005347 Bacteria 1751
36 Ga0070675_100296080 3300005354 Bacteria 1425
37 Ga0070674_100038817 3300005356 Bacteria 3211
38 Ga0070674_100121535 3300005356 Bacteria 1934
39 Ga0070709_10019706 3300005434 Bacteria 3903
40 Ga0070714_100237701 3300005435 Bacteria 1681
41 Ga0070700_100026825 3300005441 Bacteria 3407
42 Ga0070694_100016863 3300005444 Bacteria 4606
43 Ga0070694_100074816 3300005444 Bacteria 2341
44 Ga0070678_100231909 3300005456 Bacteria 1539
45 Ga0070678_100233205 3300005456 Bacteria 1535
46 Ga0068867_100019504 3300005459 Bacteria 4831
47 Ga0068867_100172861 3300005459 Bacteria 1712
48 Ga0070706_100239598 3300005467 Bacteria 1694
49 Ga0070706_100240727 3300005467 Bacteria 1690
50 Ga0070707_100296573 3300005468 Bacteria 1571
51 Ga0070707_100347142 3300005468 Bacteria 1441
52 Ga0070698_100071501 3300005471 Bacteria 3479
53 Ga0070699_100215963 3300005518 Bacteria 1708
54 Ga0070679_100167261 3300005530 Bacteria 2172
55 Ga0070684_100113122 3300005535 Bacteria 2435
56 Ga0068853_100080982 3300005539 Bacteria 2842
57 Ga0070695_100084880 3300005545 Bacteria 2101
58 Ga0070695_100096378 3300005545 Bacteria 1985
59 Ga0068855_100139374 3300005563 Bacteria 2766
60 Ga0068855_100226418 3300005563 Bacteria 2095
61 Ga0068855_100269386 3300005563 Bacteria 1894
62 Ga0068854_100049908 3300005578 Bacteria 2991
63 Ga0068859_100392836 3300005617 Bacteria 1483
64 Ga0068861_100258628 3300005719 Bacteria 1489
65 Ga0068870_10133728 3300005840 Bacteria 1443
66 Ga0068858_100223896 3300005842 Bacteria 1782
67 Ga0068862_100172853 3300005844 Bacteria 1935
68 Ga0081455_10018449 3300005937 Bacteria 6647
69 Ga0081539_10082634 3300005985 Bacteria 1683
70 Ga0081539_10088043 3300005985 Bacteria 1612
71 Ga0097621_100302424 3300006237 Bacteria 1413
72 Ga0075428_100181666 3300006844 Bacteria 2276
73 Ga0068865_100048193 3300006881 Unclassified 2931
74 Ga0068865_100121898 3300006881 Bacteria 1940
75 Ga0097620_100392864 3300006931 Bacteria 1483
76 Ga0105244_10062519 3300009036 Bacteria 1871
77 Ga0105240_10301660 3300009093 Bacteria 1832
78 Ga0111539_10458091 3300009094 Bacteria 1485
79 Ga0105245_10262167 3300009098 Bacteria 1682
80 Ga0105243_10276724 3300009148 Bacteria 1510
81 Ga0105242_10327055 3300009176 Bacteria 1408
82 Ga0105237_10191931 3300009545 Bacteria 2042
83 Ga0105238_10224744 3300009551 Bacteria 1854
84 Ga0105238_10252815 3300009551 Bacteria 1741
85 Ga0154012_145278 3300013059 Bacteria 1272
86 Ga0157370_10011880 3300013104 Bacteria 9083
87 Ga0157372_10249261 3300013307 Bacteria 2061
88 Ga0157372_10416765 3300013307 Bacteria 1565
89 Ga0163163_10270075 3300014325 Bacteria 1752
90 Ga0157380_10281676 3300014326 Bacteria 1522
91 Ga0197907_10910350 3300020069 Bacteria 1804
92 Ga0206351_10326828 3300020077 Bacteria 2790
93 Ga0206352_10393391 3300020078 Bacteria 2968
94 Ga0206350_10214115 3300020080 Bacteria 1485
95 Ga0213876_10070055 3300021384 Bacteria 1852
96 Ga0224712_10001108 3300022467 Bacteria 5969
97 Ga0209646_1012011 3300025246 Bacteria 1335
98 Ga0209026_1008710 3300025250 Bacteria 2084
99 Ga0209148_1012158 3300025254 Bacteria 1580
100 Ga0209565_1018131 3300025263 Bacteria 1528
101 Ga0209455_1016183 3300025272 Bacteria 1611
102 Ga0209673_1030295 3300025273 Bacteria 1707
103 Ga0207673_1003312 3300025290 Bacteria 1878
104 Ga0209675_1010149 3300025291 Bacteria 3245
105 Ga0207656_10024119 3300025321 Bacteria 2456
106 Ga0207656_10035352 3300025321 Bacteria 2092
107 Ga0207682_10022863 3300025893 Bacteria 2466
108 Ga0207688_10041638 3300025901 Bacteria 2556
109 Ga0207680_10059697 3300025903 Bacteria 2318
110 Ga0207645_10078105 3300025907 Bacteria 2121
111 Ga0207705_10167400 3300025909 Bacteria 1654
112 Ga0207684_10106845 3300025910 Bacteria 2395
113 Ga0207684_10273375 3300025910 Bacteria 1458
114 Ga0207654_10186142 3300025911 Bacteria 1358
115 Ga0207695_10215168 3300025913 Bacteria 1831
116 Ga0207671_10114918 3300025914 Bacteria 2052
117 Ga0207681_10059315 3300025923 Bacteria 2623
118 Ga0207694_10128099 3300025924 Bacteria 2032
119 Ga0207694_10202776 3300025924 Bacteria 1614
120 Ga0207694_10280272 3300025924 Bacteria 1369
121 Ga0207650_10076282 3300025925 Bacteria 2532
122 Ga0207650_10286949 3300025925 Bacteria 1341
123 Ga0207659_10265017 3300025926 Bacteria 1399
124 Ga0207664_10103489 3300025929 Bacteria 2356
125 Ga0207706_10041546 3300025933 Bacteria 4077
126 Ga0207706_10120232 3300025933 Bacteria 2309
127 Ga0207706_10150085 3300025933 Bacteria 2050
128 Ga0207686_10155208 3300025934 Bacteria 1598
129 Ga0207686_10215305 3300025934 Bacteria 1383
130 Ga0207686_10229374 3300025934 Bacteria 1345
131 Ga0207709_10247288 3300025935 Bacteria 1301
132 Ga0207670_10204961 3300025936 Bacteria 1500
133 Ga0207669_10094954 3300025937 Unclassified 1953
134 Ga0207704_10174915 3300025938 Bacteria 1544
135 Ga0207704_10244502 3300025938 Bacteria 1343
136 Ga0207689_10082740 3300025942 Bacteria 2639
137 Ga0207661_10286850 3300025944 Bacteria 1472
138 Ga0207679_10027414 3300025945 Bacteria 3939
139 Ga0207667_10205217 3300025949 Bacteria 2021
140 Ga0207667_10264113 3300025949 Bacteria 1760
141 Ga0207667_10294265 3300025949 Bacteria 1659
142 Ga0207667_10361030 3300025949 Bacteria 1481
143 Ga0207651_10051443 3300025960 Bacteria 2803
144 Ga0207668_10265629 3300025972 Unclassified 1400
145 Ga0207640_10126809 3300025981 Bacteria 1839
146 Ga0207658_10314106 3300025986 Unclassified 1354
147 Ga0207677_10280568 3300026023 Bacteria 1367
148 Ga0207703_10143847 3300026035 Bacteria 2072
149 Ga0207708_10031041 3300026075 Bacteria 4055
150 Ga0207702_10078604 3300026078 Bacteria 2857
151 Ga0207648_10105483 3300026089 Bacteria 2472
152 Ga0207648_10113584 3300026089 Bacteria 2379
153 Ga0207676_10045651 3300026095 Bacteria 3386
154 Ga0207674_10252861 3300026116 Bacteria 1709
155 Ga0207675_100139170 3300026118 Bacteria 2305
156 Ga0207675_100339544 3300026118 Bacteria 1470
157 Ga0207683_10202125 3300026121 Bacteria 1806
158 Ga0207698_10000358 3300026142 Bacteria 26861
159 Ga0207698_10370781 3300026142 Bacteria 1359
160 Ga0209371_1000325 3300027312 Bacteria 52216
161 Ga0209971_1026211 3300027682 Bacteria 1393
162 Ga0209974_10026570 3300027876 Bacteria 1916
163 Ga0268266_10190880 3300028379 Bacteria 1870
164 Ga0268266_10307868 3300028379 Bacteria 1479
165 Ga0265338_10094648 3300028800 Bacteria 2456
166 Ga0265338_10179401 3300028800 Bacteria 1616
167 Ga0265332_10038996 3300031238 Bacteria 2058
168 Ga0265329_10046864 3300031242 Unclassified 1380
169 Ga0265340_10009572 3300031247 Bacteria 5195
170 Ga0265339_10096187 3300031249 Bacteria 1546
171 Ga0265316_10197843 3300031344 Bacteria 1491
172 Ga0265316_10203550 3300031344 Unclassified 1466
173 Ga0307408_100102408 3300031548 Bacteria 2184
174 Ga0307514_10174201 3300031649 Bacteria 1399
175 Ga0316579_10096389 3300031691 Bacteria 1414
176 Ga0265314_10131843 3300031711 Bacteria 1558
177 Ga0265342_10107136 3300031712 Bacteria 1585
178 Ga0307405_10044088 3300031731 Bacteria 2726
179 Ga0307405_10219245 3300031731 Bacteria 1394
180 Ga0307410_10154212 3300031852 Bacteria 1713
181 Ga0307410_10209006 3300031852 Bacteria 1494
182 Ga0307406_10050161 3300031901 Bacteria 2644
183 Ga0307406_10188414 3300031901 Bacteria 1508
184 Ga0307407_10027806 3300031903 Bacteria 3015
185 Ga0307412_10018096 3300031911 Bacteria 4231
186 Ga0307409_100144584 3300031995 Bacteria 2054
187 Ga0307416_100205750 3300032002 Bacteria 1872
188 Ga0307414_10003263 3300032004 Bacteria 8645
189 Ga0307414_10004914 3300032004 Bacteria 7308
190 Ga0307414_10137479 3300032004 Bacteria 1907
191 Ga0307411_10000112 3300032005 Bacteria 25459
192 Ga0307411_10025149 3300032005 Bacteria 3562
193 Ga0307415_100036355 3300032126 Bacteria 3226
194 Ga0307507_10115185 3300033179 Bacteria 2177
195 Ga0373959_0009713 3300034820 Bacteria 1667
196 Ga0373937_0210463 3300036401 Bacteria 1829
197 Ga0373937_0295947 3300036401 Bacteria 1529
198 Ga0395899_0208154 3300037312 Bacteria 1360
199 Ga0395899_0212304 3300037312 Bacteria 1344
200 Ga0395900_0113539 3300037418 Bacteria 2780
201 Ga0395900_0287347 3300037418 Bacteria 1634
202 Ga0395898_0217766 3300037466 Bacteria 1821
203 Ga0395898_0222760 3300037466 Bacteria 1799
204 Ga0395898_0252072 3300037466 Bacteria 1683
205 Ga0395905_0014429 3300037471 Bacteria 7543
206 Ga0395905_0114752 3300037471 Bacteria 2531
207 Ga0395905_0220645 3300037471 Bacteria 1774
208 Ga0395901_0327099 3300038443 Bacteria 1585
209 Ga0395901_0364879 3300038443 Bacteria 1488
210 Ga0436365_0027044 3300039437 Bacteria 1795
211 Ga0436361_0034387 3300039447 Bacteria 1980
212 Ga0439461_0001646 3300041410 Bacteria 3474
213 Ga0439432_028869 3300042006 Bacteria 1805
214 Ga0439449_0037367 3300042007 Bacteria 1806
215 Ga0439452_018624 3300042010 Bacteria 1847
216 Ga0439452_019116 3300042010 Bacteria 1816
217 Ga0450921_001347 3300042123 Bacteria 1464
218 Ga0450922_003533 3300042124 Bacteria 1438
219 Ga0450922_003899 3300042124 Bacteria 1372
220 Ga0450923_008272 3300042125 Bacteria 1785
221 Ga0450905_004617 3300042142 Bacteria 1828
222 Ga0450910_006263 3300042147 Bacteria 1638
223 Ga0439446_0016900 3300042156 Bacteria 2035
224 Ga0450909_009847 3300042185 Bacteria 1396
225 Ga0451577_0075335 3300042876 Bacteria 3009
226 Ga0466969_0039151 3300044656 Bacteria 2382
227 Ga0466972_0050111 3300044658 Bacteria 2016
228 Ga0466977_0012394 3300044666 Bacteria 4966
229 Ga0466978_0092923 3300044671 Bacteria 1879
230 Ga0466965_0049646 3300044683 Bacteria 2080
231 Ga0466965_0077464 3300044683 Bacteria 1679
232 Ga0466965_0098877 3300044683 Bacteria 1490
233 Ga0466966_0134799 3300044684 Bacteria 1510
234 Ga0466966_0138281 3300044684 Bacteria 1489
235 Ga0466961_0038754 3300044693 Bacteria 3057
236 Ga0453684_0099939 3300044712 Bacteria 3552
237 Ga0453684_0217332 3300044712 Bacteria 2217
238 Ga0466970_0018013 3300044765 Bacteria 3655
239 Ga0466970_0026209 3300044765 Bacteria 3055
240 Ga0466970_0082052 3300044765 Bacteria 1743
241 Ga0466970_0114889 3300044765 Bacteria 1471
242 Ga0466957_0016688 3300044842 Bacteria 4295
243 Ga0466957_0065157 3300044842 Bacteria 2243
244 Ga0466957_0126570 3300044842 Bacteria 1633
245 Ga0466957_0149473 3300044842 Bacteria 1509
246 Ga0466959_0004884 3300045049 Bacteria 9075
247 Ga0466959_0173109 3300045049 Bacteria 1513
248 Ga0466959_0174701 3300045049 Bacteria 1505
249 Ga0466967_0107778 3300045976 Bacteria 2555
250 Ga0466967_0208971 3300045976 Bacteria 1851
251 Ga0466967_0398604 3300045976 Bacteria 1338
252 Ga0495603_0160390 3300046455 Bacteria 1305
253 Ga0495590_0056178 3300046457 Bacteria 1375
254 Ga0495591_000075 3300046458 Bacteria 112616
255 Ga0495638_0033869 3300046460 Bacteria 3263
256 Ga0495638_0113024 3300046460 Bacteria 1611
257 Ga0495651_0181074 3300046462 Bacteria 1491
258 Ga0495653_0179706 3300046463 Bacteria 1453
259 Ga0495580_0156565 3300046472 Bacteria 1577
260 Ga0495605_0000728 3300046474 Bacteria 24222
261 Ga0495584_0002569 3300046491 Bacteria 10242
262 Ga0495585_0000496 3300046492 Bacteria 37202
263 Ga0495585_0005698 3300046492 Bacteria 7816
264 Ga0495607_0118620 3300046501 Bacteria 1392
265 Ga0495607_0131243 3300046501 Bacteria 1303
266 Ga0495606_0092962 3300046507 Bacteria 1851
267 Ga0495616_0062610 3300046513 Bacteria 1821
268 Ga0495620_0035828 3300046515 Bacteria 2227
269 Ga0495631_0097845 3300046518 Bacteria 1263
270 Ga0495632_0089914 3300046519 Bacteria 1456
271 Ga0495648_0134603 3300046524 Bacteria 1309
272 Ga0495663_0030032 3300046525 Bacteria 1608
273 Ga0495654_0062022 3300046530 Bacteria 1793
274 Ga0495587_0136906 3300046536 Bacteria 1399
275 Ga0495587_0177251 3300046536 Bacteria 1209
276 Ga0495598_0022140 3300046537 Bacteria 1697
277 Ga0495609_0001470 3300046538 Bacteria 15620
278 Ga0495621_0031121 3300046539 Bacteria 1828
279 Ga0495621_0043499 3300046539 Bacteria 1584
280 Ga0495597_0011420 3300046542 Bacteria 4306
281 Ga0495597_0076176 3300046542 Bacteria 1439
282 Ga0495645_0172525 3300046543 Bacteria 1488
283 Ga0495635_0098623 3300046663 Bacteria 1997
284 Ga0495659_0000001 3300046664 Bacteria 325846
285 Ga0495661_0000011 3300046665 Bacteria 277997
286 Ga0495657_0149560 3300046675 Bacteria 1450
287 Ga0495599_0031647 3300046678 Bacteria 3320
288 Ga0495599_0138076 3300046678 Bacteria 1512
289 Ga0495669_0045760 3300046684 Bacteria 1952
290 Ga0495671_0014427 3300046692 Bacteria 4252
291 Ga0495649_0002076 3300046694 Bacteria 14395
292 Ga0495649_0090203 3300046694 Bacteria 1634
293 Ga0495600_0070645 3300046809 Bacteria 2281
294 Ga0495636_0075467 3300047318 Bacteria 1445
295 Ga0495680_0038924 3300047322 Bacteria 3797
296 Ga0495680_0223136 3300047322 Bacteria 1344
297 Ga0495683_0000059 3300047323 Bacteria 116530
298 Ga0495686_0088972 3300047472 Bacteria 1876
299 Ga0495602_0216398 3300048088 Bacteria 1449
300 Ga0495615_0018343 3300048090 Bacteria 1538
301 Ga0495626_0014660 3300048091 Bacteria 4035
302 Ga0496100_0083523 3300048903 Bacteria 2162
303 Ga0496101_0207555 3300048904 Bacteria 1516
304 Ga0496102_0143468 3300048905 Bacteria 2240
305 Ga0496119_0122643 3300048922 Bacteria 1426
306 Ga0496121_0006314 3300048924 Bacteria 14804
307 Ga0496124_0017948 3300048927 Bacteria 6649
308 Ga0496126_0153789 3300048929 Bacteria 1970
309 Ga0501291_004306 3300049514 Bacteria 1813
310 Ga0501031_0081473 3300049568 Bacteria 2110
311 Ga0501031_0145681 3300049568 Bacteria 1547
312 Ga0501031_0166932 3300049568 Bacteria 1438
313 Ga0501032_0024498 3300049569 Bacteria 4166
314 Ga0501032_0162851 3300049569 Bacteria 1464
315 Ga0501033_0065039 3300049570 Bacteria 2683
316 Ga0501033_0074161 3300049570 Bacteria 2498
317 Ga0501033_0172185 3300049570 Bacteria 1554
318 Ga0501034_0000178 3300049571 Bacteria 118886
319 Ga0501034_0107658 3300049571 Bacteria 2779
320 Ga0501034_0201429 3300049571 Bacteria 1948
321 Ga0501034_0386753 3300049571 Bacteria 1323
322 Ga0501036_0042898 3300049572 Bacteria 3829
323 Ga0501036_0074432 3300049572 Bacteria 2872
324 Ga0501036_0245082 3300049572 Bacteria 1502
325 Ga0501037_0078962 3300049573 Bacteria 2388
326 Ga0501037_0124295 3300049573 Bacteria 1853
327 Ga0501037_0202925 3300049573 Bacteria 1400
328 Ga0501038_0148101 3300049574 Bacteria 1915
329 Ga0501038_0249852 3300049574 Bacteria 1405
330 Ga0501038_0265311 3300049574 Bacteria 1355
331 Ga0501039_0221233 3300049575 Bacteria 1488
332 Ga0501039_0221836 3300049575 Bacteria 1486
333 Ga0501040_0136434 3300049576 Bacteria 1727
334 Ga0501040_0208044 3300049576 Bacteria 1390
335 Ga0501042_0053958 3300049578 Bacteria 2867
336 Ga0501043_0253650 3300049579 Bacteria 1354
337 Ga0501046_0029041 3300049580 Bacteria 4499
338 Ga0501046_0198495 3300049580 Bacteria 1493
339 Ga0501046_0231084 3300049580 Bacteria 1367
340 Ga0501046_0233385 3300049580 Bacteria 1358
341 Ga0501047_0035644 3300049581 Bacteria 4806
342 Ga0501047_0076706 3300049581 Bacteria 3216
343 Ga0501047_0242941 3300049581 Bacteria 1650
344 Ga0501048_0034755 3300049582 Bacteria 3633
345 Ga0501048_0182527 3300049582 Bacteria 1487
346 Ga0501048_0233532 3300049582 Bacteria 1305
347 Ga0501067_0003594 3300049583 Bacteria 8537
348 Ga0501067_0035203 3300049583 Bacteria 2780
349 Ga0501067_0067251 3300049583 Bacteria 1983
350 Ga0501068_0118504 3300049584 Bacteria 1649
351 Ga0501068_0187748 3300049584 Bacteria 1308
352 Ga0501069_0082531 3300049585 Bacteria 1811
353 Ga0501069_0106259 3300049585 Bacteria 1596
354 Ga0501069_0165486 3300049585 Bacteria 1274
355 Ga0501070_0016011 3300049586 Bacteria 6301
356 Ga0501070_0188565 3300049586 Bacteria 1695
357 Ga0501071_0088899 3300049587 Bacteria 2266
358 Ga0501072_0032635 3300049588 Bacteria 4078
359 Ga0501072_0182620 3300049588 Bacteria 1673
360 Ga0501072_0223251 3300049588 Bacteria 1501
361 Ga0501072_0253959 3300049588 Bacteria 1400
362 Ga0501072_0338590 3300049588 Bacteria 1195
363 Ga0501074_0022222 3300049590 Bacteria 4609
364 Ga0501074_0172703 3300049590 Bacteria 1542
365 Ga0501074_0199128 3300049590 Bacteria 1427
366 Ga0501074_0234688 3300049590 Bacteria 1305
367 Ga0501075_0086468 3300049591 Bacteria 2375
368 Ga0501076_0082124 3300049592 Bacteria 2587
369 Ga0501076_0108362 3300049592 Bacteria 2243
370 Ga0501076_0182402 3300049592 Bacteria 1711
371 Ga0501076_0265247 3300049592 Bacteria 1406
372 Ga0501077_0060600 3300049593 Bacteria 2401
373 Ga0501199_005590 3300049650 Bacteria 1264
374 Ga0501207_008441 3300049654 Bacteria 1489
375 Ga0501211_001691 3300049658 Bacteria 2359
376 Ga0501227_006223 3300049665 Bacteria 2566
377 Ga0501236_010263 3300049670 Bacteria 1223
378 Ga0501248_001679 3300049678 Bacteria 1433
379 Ga0501253_008742 3300049683 Bacteria 1468
380 Ga0501257_016393 3300049686 Bacteria 1718
381 Ga0501225_0029780 3300049705 Bacteria 1500
382 Ga0501234_005694 3300049707 Bacteria 1946
383 Ga0501234_008734 3300049707 Bacteria 1578
384 Ga0501079_0195488 3300049741 Bacteria 1579
385 Ga0501079_0287965 3300049741 Bacteria 1284
386 Ga0501080_0170350 3300049742 Bacteria 2008
387 Ga0501080_0188206 3300049742 Bacteria 1897
388 Ga0501080_0362557 3300049742 Bacteria 1307
389 Ga0501081_0000061 3300049743 Bacteria 42076
390 Ga0501081_0064741 3300049743 Bacteria 2539
391 Ga0501083_0041143 3300049744 Bacteria 3134
392 Ga0501083_0066127 3300049744 Bacteria 2407
393 Ga0501083_0152383 3300049744 Bacteria 1513
394 Ga0501262_000317 3300049759 Bacteria 5869
395 Ga0501035_0139726 3300049822 Bacteria 2106
396 Ga0501035_0210296 3300049822 Bacteria 1664
397 Ga0501035_0220494 3300049822 Bacteria 1619
398 Ga0501044_0056645 3300049823 Bacteria 4024
399 Ga0501044_0149298 3300049823 Bacteria 2320
400 Ga0501045_0235962 3300049824 Bacteria 1361
401 Ga0495619_0076155 3300053085 Bacteria 2252
402 Ga0495619_0203277 3300053085 Bacteria 1371
403 Ga0501084_0255743 3300054114 Bacteria 1478
404 Ga0501084_0305575 3300054114 Bacteria 1343
405 Ga0501082_0003876 3300060353 Bacteria 13061
406 Ga0501082_0255287 3300060353 Bacteria 1525
407 Ga0530510_0024692 3300061734 Bacteria 4292
408 Ga0530510_0191770 3300061734 Bacteria 1517

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002739 JGI25158J39367_1002144 JGI25158J39367_10021442 313
2 3300002987 JGI25159J45721_1002989 JGI25159J45721_10029891 313
3 3300003374 JGI25161J50226_1003547 JGI25161J50226_10035472 313
4 3300004625 Ga0055543_1000288 Ga0055543_100028830 313
5 3300005262 Ga0065165_1000559 Ga0065165_10005591 313
6 3300046665 Ga0495661_0000011 Ga0495661_0000011_276669_277736 318
7 3300042006 Ga0439432_028869 Ga0439432_028869_393_1367 323
8 3300042156 Ga0439446_0016900 Ga0439446_0016900_170_1144 323
9 3300049571 Ga0501034_0201429 Ga0501034_0201429_411_1427 337
10 3300034820 Ga0373959_0009713 Ga0373959_0009713_456_1487 343
11 3300046678 Ga0495599_0031647 Ga0495599_0031647_1295_2329 343
12 3300047318 Ga0495636_0075467 Ga0495636_0075467_29_1066 343
13 3300049514 Ga0501291_004306 Ga0501291_004306_395_1432 343
14 3300049571 Ga0501034_0386753 Ga0501034_0386753_276_1310 343
15 3300049581 Ga0501047_0076706 Ga0501047_0076706_826_1860 343
16 3300049650 Ga0501199_005590 Ga0501199_005590_119_1156 343
17 3300049654 Ga0501207_008441 Ga0501207_008441_408_1445 343
18 3300049665 Ga0501227_006223 Ga0501227_006223_238_1275 343
19 3300049670 Ga0501236_010263 Ga0501236_010263_13_1050 343
20 3300049683 Ga0501253_008742 Ga0501253_008742_421_1458 343
21 3300049705 Ga0501225_0029780 Ga0501225_0029780_391_1428 343
22 3300049707 Ga0501234_008734 Ga0501234_008734_510_1547 343
23 3300049742 Ga0501080_0170350 Ga0501080_0170350_96_1130 343
24 3300049759 Ga0501262_000317 Ga0501262_000317_4802_5839 343
25 3300049822 Ga0501035_0210296 Ga0501035_0210296_97_1131 343
26 3300003320 rootH2_10160122 rootH2_101601221 350
27 3300037471 Ga0395905_0114752 Ga0395905_0114752_299_1357 351
28 3300046501 Ga0495607_0131243 Ga0495607_0131243_114_1172 351
29 3300046513 Ga0495616_0062610 Ga0495616_0062610_740_1798 351
30 3300046536 Ga0495587_0177251 Ga0495587_0177251_125_1183 351
31 3300046542 Ga0495597_0076176 Ga0495597_0076176_247_1305 351
32 3300049582 Ga0501048_0233532 Ga0501048_0233532_103_1170 354
33 3300049588 Ga0501072_0253959 Ga0501072_0253959_73_1140 354
34 3300032004 Ga0307414_10004914 Ga0307414_100049144 358
35 3300044684 Ga0466966_0138281 Ga0466966_0138281_330_1457 374
36 3300049588 Ga0501072_0338590 Ga0501072_0338590_15_1139 374
37 3300005468 Ga0070707_100296573 Ga0070707_1002965731 382
38 3300006844 Ga0075428_100181666 Ga0075428_1001816661 383
39 3300048927 Ga0496124_0017948 Ga0496124_0017948_108_1316 384
40 3300044712 Ga0453684_0217332 Ga0453684_0217332_48_1226 386
41 3300009098 Ga0105245_10262167 Ga0105245_102621672 389
42 3300032126 Ga0307415_100036355 Ga0307415_1000363552 389
43 3300046518 Ga0495631_0097845 Ga0495631_0097845_53_1222 389
44 3300046537 Ga0495598_0022140 Ga0495598_0022140_357_1526 389
45 3300046539 Ga0495621_0031121 Ga0495621_0031121_96_1265 389
46 3300048090 Ga0495615_0018343 Ga0495615_0018343_176_1345 389
47 3300033179 Ga0307507_10115185 Ga0307507_101151852 390
48 3300045976 Ga0466967_0107778 Ga0466967_0107778_465_1685 390
49 3300046492 Ga0495585_0000496 Ga0495585_0000496_34442_35752 390
50 3300031901 Ga0307406_10188414 Ga0307406_101884141 392
51 3300049678 Ga0501248_001679 Ga0501248_001679_51_1253 392
52 3300049686 Ga0501257_016393 Ga0501257_016393_15_1217 392
53 3300002738 JGI25154J39366_1008382 JGI25154J39366_10083821 393
54 3300003322 rootL2_10300805 rootL2_103008051 393
55 3300005459 Ga0068867_100172861 Ga0068867_1001728612 393
56 3300005844 Ga0068862_100172853 Ga0068862_1001728532 393
57 3300006881 Ga0068865_100121898 Ga0068865_1001218981 393
58 3300009148 Ga0105243_10276724 Ga0105243_102767241 393
59 3300025246 Ga0209646_1012011 Ga0209646_10120111 393
60 3300025250 Ga0209026_1008710 Ga0209026_10087103 393
61 3300025934 Ga0207686_10155208 Ga0207686_101552081 393
62 3300026089 Ga0207648_10113584 Ga0207648_101135842 393
63 3300031901 Ga0307406_10050161 Ga0307406_100501612 393
64 3300031903 Ga0307407_10027806 Ga0307407_100278063 393
65 3300031911 Ga0307412_10018096 Ga0307412_100180962 393
66 3300031995 Ga0307409_100144584 Ga0307409_1001445842 393
67 3300032005 Ga0307411_10025149 Ga0307411_100251493 393
68 3300042123 Ga0450921_001347 Ga0450921_001347_237_1445 393
69 3300042124 Ga0450922_003533 Ga0450922_003533_140_1348 393
70 3300046457 Ga0495590_0056178 Ga0495590_0056178_44_1249 393
71 3300046460 Ga0495638_0033869 Ga0495638_0033869_541_1746 393
72 3300046474 Ga0495605_0000728 Ga0495605_0000728_18671_19876 393
73 3300046501 Ga0495607_0118620 Ga0495607_0118620_135_1340 393
74 3300046507 Ga0495606_0092962 Ga0495606_0092962_600_1808 393
75 3300046519 Ga0495632_0089914 Ga0495632_0089914_191_1396 393
76 3300046692 Ga0495671_0014427 Ga0495671_0014427_2208_3413 393
77 3300046694 Ga0495649_0002076 Ga0495649_0002076_48_1304 393
78 3300047323 Ga0495683_0000059 Ga0495683_0000059_7197_8402 393
79 3300048091 Ga0495626_0014660 Ga0495626_0014660_1065_2270 393
80 3300048903 Ga0496100_0083523 Ga0496100_0083523_757_1962 393
81 3300048904 Ga0496101_0207555 Ga0496101_0207555_88_1293 393
82 3300049658 Ga0501211_001691 Ga0501211_001691_988_2193 393
83 3300049707 Ga0501234_005694 Ga0501234_005694_158_1363 393
84 iso_pu_bacteria 2643221638 2644213271 393
85 iso_pu_bacteria 640427133 640487047 393
86 iso_pu_bacteria 640427133 640487873 393
87 iso_pu_bacteria 640427133 640488945 393
88 iso_pu_bacteria 651053060 651174000 393
89 iso_pu_bacteria 651053060 651174475 393
90 iso_pu_bacteria 651053060 651174687 393
91 iso_pu_bacteria 651053060 651175450 393
92 iso_pu_bacteria 651053060 651175605 393
93 iso_pu_bacteria 651053060 651176525 393
94 iso_pu_bacteria 651053060 651177896 393
95 iso_pu_bacteria 651053060 651178005 393
96 iso_pu_bacteria 651053060 651178068 393
97 iso_pu_bacteria 651053060 651178152 393
98 3300003320 rootH2_10009100 rootH2_100091002 394
99 3300003322 rootL2_10003582 rootL2_100035825 394
100 3300003322 rootL2_10060793 rootL2_100607931 394
101 3300003323 rootH1_10118944 rootH1_101189441 394
102 3300003856 Ga0058692_1009908 Ga0058692_10099081 394
103 3300003856 Ga0058692_1020624 Ga0058692_10206241 394
104 3300005563 Ga0068855_100269386 Ga0068855_1002693862 394
105 3300005985 Ga0081539_10082634 Ga0081539_100826342 394
106 3300009036 Ga0105244_10062519 Ga0105244_100625192 394
107 3300013104 Ga0157370_10011880 Ga0157370_100118802 394
108 3300025321 Ga0207656_10035352 Ga0207656_100353522 394
109 3300025949 Ga0207667_10361030 Ga0207667_103610302 394
110 3300027312 Ga0209371_1000325 Ga0209371_100032524 394
111 3300031238 Ga0265332_10038996 Ga0265332_100389962 394
112 3300031247 Ga0265340_10009572 Ga0265340_100095723 394
113 3300031344 Ga0265316_10197843 Ga0265316_101978431 394
114 3300031691 Ga0316579_10096389 Ga0316579_100963891 394
115 3300031852 Ga0307410_10209006 Ga0307410_102090062 394
116 3300032004 Ga0307414_10137479 Ga0307414_101374791 394
117 3300037466 Ga0395898_0217766 Ga0395898_0217766_356_1576 394
118 3300037471 Ga0395905_0220645 Ga0395905_0220645_279_1499 394
119 3300041410 Ga0439461_0001646 Ga0439461_0001646_20_1222 394
120 3300042010 Ga0439452_019116 Ga0439452_019116_504_1706 394
121 3300042124 Ga0450922_003899 Ga0450922_003899_79_1281 394
122 3300042125 Ga0450923_008272 Ga0450923_008272_126_1328 394
123 3300042147 Ga0450910_006263 Ga0450910_006263_416_1618 394
124 3300042185 Ga0450909_009847 Ga0450909_009847_69_1271 394
125 3300044656 Ga0466969_0039151 Ga0466969_0039151_33_1253 394
126 3300044666 Ga0466977_0012394 Ga0466977_0012394_180_1400 394
127 3300044671 Ga0466978_0092923 Ga0466978_0092923_67_1287 394
128 3300044683 Ga0466965_0077464 Ga0466965_0077464_97_1329 394
129 3300044684 Ga0466966_0134799 Ga0466966_0134799_188_1420 394
130 3300044693 Ga0466961_0038754 Ga0466961_0038754_99_1331 394
131 3300044765 Ga0466970_0026209 Ga0466970_0026209_1644_2864 394
132 3300044765 Ga0466970_0114889 Ga0466970_0114889_71_1303 394
133 3300044842 Ga0466957_0065157 Ga0466957_0065157_209_1441 394
134 3300044842 Ga0466957_0126570 Ga0466957_0126570_78_1298 394
135 3300044842 Ga0466957_0149473 Ga0466957_0149473_173_1393 394
136 3300045049 Ga0466959_0173109 Ga0466959_0173109_126_1358 394
137 3300045049 Ga0466959_0174701 Ga0466959_0174701_38_1258 394
138 3300045976 Ga0466967_0398604 Ga0466967_0398604_10_1230 394
139 3300046458 Ga0495591_000075 Ga0495591_000075_59094_60299 394
140 3300046460 Ga0495638_0113024 Ga0495638_0113024_186_1406 394
141 3300046463 Ga0495653_0179706 Ga0495653_0179706_177_1430 394
142 3300046491 Ga0495584_0002569 Ga0495584_0002569_3195_4415 394
143 3300046492 Ga0495585_0005698 Ga0495585_0005698_258_1478 394
144 3300046524 Ga0495648_0134603 Ga0495648_0134603_63_1283 394
145 3300046530 Ga0495654_0062022 Ga0495654_0062022_106_1326 394
146 3300046538 Ga0495609_0001470 Ga0495609_0001470_1744_2964 394
147 3300046542 Ga0495597_0011420 Ga0495597_0011420_2209_3429 394
148 3300046664 Ga0495659_0000001 Ga0495659_0000001_107995_109215 394
149 3300046694 Ga0495649_0090203 Ga0495649_0090203_267_1487 394
150 3300047472 Ga0495686_0088972 Ga0495686_0088972_536_1756 394
151 3300048088 Ga0495602_0216398 Ga0495602_0216398_211_1431 394
152 3300048924 Ga0496121_0006314 Ga0496121_0006314_8743_9963 394
153 3300049568 Ga0501031_0145681 Ga0501031_0145681_73_1293 394
154 3300049569 Ga0501032_0024498 Ga0501032_0024498_2625_3845 394
155 3300049571 Ga0501034_0000178 Ga0501034_0000178_1338_2558 394
156 3300049572 Ga0501036_0042898 Ga0501036_0042898_2300_3520 394
157 3300049576 Ga0501040_0136434 Ga0501040_0136434_157_1377 394
158 3300049578 Ga0501042_0053958 Ga0501042_0053958_10_1230 394
159 3300049580 Ga0501046_0231084 Ga0501046_0231084_108_1328 394
160 3300049582 Ga0501048_0034755 Ga0501048_0034755_346_1566 394
161 3300049583 Ga0501067_0003594 Ga0501067_0003594_17_1237 394
162 3300049585 Ga0501069_0082531 Ga0501069_0082531_563_1783 394
163 3300049587 Ga0501071_0088899 Ga0501071_0088899_19_1239 394
164 3300049588 Ga0501072_0032635 Ga0501072_0032635_2844_4064 394
165 3300049590 Ga0501074_0022222 Ga0501074_0022222_34_1254 394
166 3300049591 Ga0501075_0086468 Ga0501075_0086468_365_1585 394
167 3300049592 Ga0501076_0108362 Ga0501076_0108362_925_2145 394
168 3300049742 Ga0501080_0362557 Ga0501080_0362557_11_1231 394
169 3300049743 Ga0501081_0064741 Ga0501081_0064741_357_1577 394
170 3300049744 Ga0501083_0041143 Ga0501083_0041143_1712_2932 394
171 3300049824 Ga0501045_0235962 Ga0501045_0235962_109_1329 394
172 3300054114 Ga0501084_0305575 Ga0501084_0305575_100_1320 394
173 3300060353 Ga0501082_0003876 Ga0501082_0003876_576_1796 394
174 3300061734 Ga0530510_0024692 Ga0530510_0024692_2291_3511 394
175 iso_pu_bacteria 2519103095 2519458970 394
176 iso_pu_bacteria 2519103095 2519459592 394
177 iso_pu_bacteria 2738541280 2738743039 394
178 iso_pu_bacteria 2816332253 2817260485 394
179 iso_pu_bacteria 2816332253 2817262532 394
180 iso_pu_bacteria 2816332256 2817277974 394
181 iso_pu_bacteria 2816332256 2817279371 394
182 iso_pu_bacteria 2816332256 2817280779 394
183 iso_pu_bacteria 2816332286 2817456011 394
184 iso_pu_bacteria 2857537821 2857542778 394
185 iso_pu_bacteria 2870068957 2870069171 394
186 iso_pu_bacteria 2870068957 2870071816 394
187 iso_pu_bacteria 2870068957 2870077169 394
188 iso_pu_bacteria 2885266251 2885269179 394
189 iso_pu_bacteria 2885266251 2885270868 394
190 iso_pu_bacteria 644736347 644748697 394
191 iso_pu_bacteria 644736347 644749549 394
192 iso_pu_bacteria 644736347 644749695 394
193 iso_pu_bacteria 644736347 644749782 394
194 iso_pu_bacteria 644736347 644749792 394
195 iso_pu_bacteria 644736347 644749799 394
196 iso_pu_bacteria 644736347 644749994 394
197 iso_pu_bacteria 8020807995 8020809176 394
198 iso_pu_bacteria 8040167225 8040169074 394
199 iso_pu_bacteria 8040173305 8040173319 394
200 3300028800 Ga0265338_10179401 Ga0265338_101794012 395
201 3300031249 Ga0265339_10096187 Ga0265339_100961871 395
202 3300031712 Ga0265342_10107136 Ga0265342_101071362 395
203 3300039447 Ga0436361_0034387 Ga0436361_0034387_516_1730 395
204 3300005467 Ga0070706_100240727 Ga0070706_1002407271 396
205 3300005468 Ga0070707_100347142 Ga0070707_1003471422 396
206 iso_pu_bacteria 2895525241 2895526871 396
207 3300005467 Ga0070706_100239598 Ga0070706_1002395981 398
208 3300005471 Ga0070698_100071501 Ga0070698_1000715015 398
209 3300005518 Ga0070699_100215963 Ga0070699_1002159632 398
210 3300005530 Ga0070679_100167261 Ga0070679_1001672611 398
211 3300025910 Ga0207684_10273375 Ga0207684_102733751 398
212 3300028800 Ga0265338_10094648 Ga0265338_100946481 398
213 3300036401 Ga0373937_0295947 Ga0373937_0295947_165_1397 398
214 3300046663 Ga0495635_0098623 Ga0495635_0098623_444_1676 398
215 3300047322 Ga0495680_0038924 Ga0495680_0038924_1268_2500 398
216 3300049585 Ga0501069_0106259 Ga0501069_0106259_163_1410 398
217 3300049588 Ga0501072_0182620 Ga0501072_0182620_48_1295 398
218 3300049744 Ga0501083_0066127 Ga0501083_0066127_643_1890 398
219 3300053085 Ga0495619_0076155 Ga0495619_0076155_547_1779 398
220 3300060353 Ga0501082_0255287 Ga0501082_0255287_197_1444 398
221 3300005435 Ga0070714_100237701 Ga0070714_1002377011 399
222 3300005563 Ga0068855_100226418 Ga0068855_1002264182 399
223 3300009093 Ga0105240_10301660 Ga0105240_103016601 399
224 3300009551 Ga0105238_10252815 Ga0105238_102528151 399
225 3300025913 Ga0207695_10215168 Ga0207695_102151681 399
226 3300025924 Ga0207694_10280272 Ga0207694_102802721 399
227 3300025949 Ga0207667_10205217 Ga0207667_102052171 399
228 3300026142 Ga0207698_10370781 Ga0207698_103707811 399
229 3300037312 Ga0395899_0208154 Ga0395899_0208154_102_1340 399
230 3300037418 Ga0395900_0113539 Ga0395900_0113539_1387_2625 399
231 3300037466 Ga0395898_0222760 Ga0395898_0222760_445_1683 399
232 3300037471 Ga0395905_0014429 Ga0395905_0014429_6198_7436 399
233 3300038443 Ga0395901_0327099 Ga0395901_0327099_235_1473 399
234 3300001904 JGI24736J21556_1003077 JGI24736J21556_10030772 400
235 3300001915 JGI24741J21665_1003993 JGI24741J21665_10039933 400
236 3300001977 JGI24746J21847_1007798 JGI24746J21847_10077981 400
237 3300001979 JGI24740J21852_10005697 JGI24740J21852_100056972 400
238 3300001989 JGI24739J22299_10030441 JGI24739J22299_100304412 400
239 3300002074 JGI24748J21848_1006516 JGI24748J21848_10065161 400
240 3300002126 JGI24035J26624_1004702 JGI24035J26624_10047021 400
241 3300002244 JGI24742J22300_10014209 JGI24742J22300_100142091 400
242 3300003784 Ga0055534_1011259 Ga0055534_10112592 400
243 3300003784 Ga0055534_1013189 Ga0055534_10131892 400
244 3300003784 Ga0055534_1015036 Ga0055534_10150361 400
245 3300005289 Ga0065704_10002840 Ga0065704_100028407 400
246 3300005327 Ga0070658_10207023 Ga0070658_102070232 400
247 3300005327 Ga0070658_10300036 Ga0070658_103000361 400
248 3300005333 Ga0070677_10070710 Ga0070677_100707101 400
249 3300005334 Ga0068869_100013257 Ga0068869_1000132572 400
250 3300005336 Ga0070680_100278896 Ga0070680_1002788961 400
251 3300005338 Ga0068868_100277062 Ga0068868_1002770622 400
252 3300005339 Ga0070660_100257774 Ga0070660_1002577741 400
253 3300005340 Ga0070689_100223056 Ga0070689_1002230561 400
254 3300005347 Ga0070668_100174620 Ga0070668_1001746201 400
255 3300005354 Ga0070675_100296080 Ga0070675_1002960801 400
256 3300005356 Ga0070674_100038817 Ga0070674_1000388174 400
257 3300005356 Ga0070674_100121535 Ga0070674_1001215352 400
258 3300005434 Ga0070709_10019706 Ga0070709_100197062 400
259 3300005441 Ga0070700_100026825 Ga0070700_1000268253 400
260 3300005444 Ga0070694_100016863 Ga0070694_1000168632 400
261 3300005444 Ga0070694_100074816 Ga0070694_1000748162 400
262 3300005456 Ga0070678_100231909 Ga0070678_1002319092 400
263 3300005456 Ga0070678_100233205 Ga0070678_1002332051 400
264 3300005459 Ga0068867_100019504 Ga0068867_1000195042 400
265 3300005535 Ga0070684_100113122 Ga0070684_1001131222 400
266 3300005539 Ga0068853_100080982 Ga0068853_1000809822 400
267 3300005545 Ga0070695_100084880 Ga0070695_1000848802 400
268 3300005545 Ga0070695_100096378 Ga0070695_1000963782 400
269 3300005563 Ga0068855_100139374 Ga0068855_1001393741 400
270 3300005578 Ga0068854_100049908 Ga0068854_1000499083 400
271 3300005617 Ga0068859_100392836 Ga0068859_1003928362 400
272 3300005719 Ga0068861_100258628 Ga0068861_1002586281 400
273 3300005840 Ga0068870_10133728 Ga0068870_101337281 400
274 3300005842 Ga0068858_100223896 Ga0068858_1002238961 400
275 3300005937 Ga0081455_10018449 Ga0081455_100184494 400
276 3300005985 Ga0081539_10088043 Ga0081539_100880432 400
277 3300006237 Ga0097621_100302424 Ga0097621_1003024241 400
278 3300006881 Ga0068865_100048193 Ga0068865_1000481934 400
279 3300006931 Ga0097620_100392864 Ga0097620_1003928642 400
280 3300009094 Ga0111539_10458091 Ga0111539_104580912 400
281 3300009176 Ga0105242_10327055 Ga0105242_103270551 400
282 3300009545 Ga0105237_10191931 Ga0105237_101919312 400
283 3300009551 Ga0105238_10224744 Ga0105238_102247442 400
284 3300013059 Ga0154012_145278 Ga0154012_1452781 400
285 3300013307 Ga0157372_10249261 Ga0157372_102492613 400
286 3300013307 Ga0157372_10416765 Ga0157372_104167651 400
287 3300014325 Ga0163163_10270075 Ga0163163_102700752 400
288 3300014326 Ga0157380_10281676 Ga0157380_102816761 400
289 3300020069 Ga0197907_10910350 Ga0197907_109103502 400
290 3300020077 Ga0206351_10326828 Ga0206351_103268283 400
291 3300020078 Ga0206352_10393391 Ga0206352_103933912 400
292 3300020080 Ga0206350_10214115 Ga0206350_102141151 400
293 3300021384 Ga0213876_10070055 Ga0213876_100700552 400
294 3300022467 Ga0224712_10001108 Ga0224712_100011081 400
295 3300025254 Ga0209148_1012158 Ga0209148_10121581 400
296 3300025263 Ga0209565_1018131 Ga0209565_10181312 400
297 3300025272 Ga0209455_1016183 Ga0209455_10161832 400
298 3300025273 Ga0209673_1030295 Ga0209673_10302951 400
299 3300025290 Ga0207673_1003312 Ga0207673_10033121 400
300 3300025291 Ga0209675_1010149 Ga0209675_10101491 400
301 3300025321 Ga0207656_10024119 Ga0207656_100241192 400
302 3300025893 Ga0207682_10022863 Ga0207682_100228631 400
303 3300025901 Ga0207688_10041638 Ga0207688_100416382 400
304 3300025903 Ga0207680_10059697 Ga0207680_100596971 400
305 3300025907 Ga0207645_10078105 Ga0207645_100781051 400
306 3300025909 Ga0207705_10167400 Ga0207705_101674002 400
307 3300025910 Ga0207684_10106845 Ga0207684_101068451 400
308 3300025911 Ga0207654_10186142 Ga0207654_101861421 400
309 3300025914 Ga0207671_10114918 Ga0207671_101149182 400
310 3300025923 Ga0207681_10059315 Ga0207681_100593154 400
311 3300025924 Ga0207694_10128099 Ga0207694_101280993 400
312 3300025924 Ga0207694_10202776 Ga0207694_102027762 400
313 3300025925 Ga0207650_10076282 Ga0207650_100762823 400
314 3300025925 Ga0207650_10286949 Ga0207650_102869491 400
315 3300025926 Ga0207659_10265017 Ga0207659_102650171 400
316 3300025929 Ga0207664_10103489 Ga0207664_101034892 400
317 3300025933 Ga0207706_10041546 Ga0207706_100415463 400
318 3300025933 Ga0207706_10120232 Ga0207706_101202322 400
319 3300025933 Ga0207706_10150085 Ga0207706_101500852 400
320 3300025934 Ga0207686_10215305 Ga0207686_102153052 400
321 3300025934 Ga0207686_10229374 Ga0207686_102293741 400
322 3300025935 Ga0207709_10247288 Ga0207709_102472881 400
323 3300025936 Ga0207670_10204961 Ga0207670_102049611 400
324 3300025937 Ga0207669_10094954 Ga0207669_100949541 400
325 3300025938 Ga0207704_10174915 Ga0207704_101749152 400
326 3300025938 Ga0207704_10244502 Ga0207704_102445021 400
327 3300025942 Ga0207689_10082740 Ga0207689_100827402 400
328 3300025944 Ga0207661_10286850 Ga0207661_102868502 400
329 3300025945 Ga0207679_10027414 Ga0207679_100274144 400
330 3300025949 Ga0207667_10264113 Ga0207667_102641132 400
331 3300025949 Ga0207667_10294265 Ga0207667_102942652 400
332 3300025960 Ga0207651_10051443 Ga0207651_100514431 400
333 3300025972 Ga0207668_10265629 Ga0207668_102656291 400
334 3300025981 Ga0207640_10126809 Ga0207640_101268092 400
335 3300025986 Ga0207658_10314106 Ga0207658_103141061 400
336 3300026023 Ga0207677_10280568 Ga0207677_102805681 400
337 3300026035 Ga0207703_10143847 Ga0207703_101438471 400
338 3300026075 Ga0207708_10031041 Ga0207708_100310412 400
339 3300026078 Ga0207702_10078604 Ga0207702_100786043 400
340 3300026089 Ga0207648_10105483 Ga0207648_101054831 400
341 3300026095 Ga0207676_10045651 Ga0207676_100456511 400
342 3300026116 Ga0207674_10252861 Ga0207674_102528612 400
343 3300026118 Ga0207675_100139170 Ga0207675_1001391702 400
344 3300026118 Ga0207675_100339544 Ga0207675_1003395442 400
345 3300026121 Ga0207683_10202125 Ga0207683_102021251 400
346 3300026142 Ga0207698_10000358 Ga0207698_1000035827 400
347 3300027682 Ga0209971_1026211 Ga0209971_10262111 400
348 3300027876 Ga0209974_10026570 Ga0209974_100265702 400
349 3300028379 Ga0268266_10190880 Ga0268266_101908801 400
350 3300028379 Ga0268266_10307868 Ga0268266_103078682 400
351 3300031242 Ga0265329_10046864 Ga0265329_100468641 400
352 3300031344 Ga0265316_10203550 Ga0265316_102035501 400
353 3300031548 Ga0307408_100102408 Ga0307408_1001024082 400
354 3300031649 Ga0307514_10174201 Ga0307514_101742011 400
355 3300031711 Ga0265314_10131843 Ga0265314_101318431 400
356 3300031731 Ga0307405_10044088 Ga0307405_100440883 400
357 3300031731 Ga0307405_10219245 Ga0307405_102192451 400
358 3300031852 Ga0307410_10154212 Ga0307410_101542121 400
359 3300032002 Ga0307416_100205750 Ga0307416_1002057502 400
360 3300032004 Ga0307414_10003263 Ga0307414_100032638 400
361 3300032005 Ga0307411_10000112 Ga0307411_1000011218 400
362 3300036401 Ga0373937_0210463 Ga0373937_0210463_596_1798 400
363 3300037312 Ga0395899_0212304 Ga0395899_0212304_22_1224 400
364 3300037418 Ga0395900_0287347 Ga0395900_0287347_24_1226 400
365 3300037466 Ga0395898_0252072 Ga0395898_0252072_325_1527 400
366 3300038443 Ga0395901_0364879 Ga0395901_0364879_155_1357 400
367 3300039437 Ga0436365_0027044 Ga0436365_0027044_244_1446 400
368 3300042007 Ga0439449_0037367 Ga0439449_0037367_346_1548 400
369 3300042010 Ga0439452_018624 Ga0439452_018624_248_1450 400
370 3300042142 Ga0450905_004617 Ga0450905_004617_474_1676 400
371 3300042876 Ga0451577_0075335 Ga0451577_0075335_114_1337 400
372 3300044658 Ga0466972_0050111 Ga0466972_0050111_252_1454 400
373 3300044683 Ga0466965_0049646 Ga0466965_0049646_325_1527 400
374 3300044683 Ga0466965_0098877 Ga0466965_0098877_215_1441 400
375 3300044712 Ga0453684_0099939 Ga0453684_0099939_763_2022 400
376 3300044765 Ga0466970_0018013 Ga0466970_0018013_128_1354 400
377 3300044765 Ga0466970_0082052 Ga0466970_0082052_135_1337 400
378 3300044842 Ga0466957_0016688 Ga0466957_0016688_1596_2798 400
379 3300045049 Ga0466959_0004884 Ga0466959_0004884_1807_3009 400
380 3300045976 Ga0466967_0208971 Ga0466967_0208971_241_1464 400
381 3300046455 Ga0495603_0160390 Ga0495603_0160390_39_1259 400
382 3300046462 Ga0495651_0181074 Ga0495651_0181074_217_1419 400
383 3300046472 Ga0495580_0156565 Ga0495580_0156565_258_1478 400
384 3300046515 Ga0495620_0035828 Ga0495620_0035828_249_1535 400
385 3300046525 Ga0495663_0030032 Ga0495663_0030032_143_1429 400
386 3300046536 Ga0495587_0136906 Ga0495587_0136906_24_1226 400
387 3300046539 Ga0495621_0043499 Ga0495621_0043499_85_1371 400
388 3300046543 Ga0495645_0172525 Ga0495645_0172525_236_1438 400
389 3300046675 Ga0495657_0149560 Ga0495657_0149560_40_1242 400
390 3300046678 Ga0495599_0138076 Ga0495599_0138076_103_1305 400
391 3300046684 Ga0495669_0045760 Ga0495669_0045760_588_1874 400
392 3300046809 Ga0495600_0070645 Ga0495600_0070645_603_1805 400
393 3300047322 Ga0495680_0223136 Ga0495680_0223136_109_1311 400
394 3300048905 Ga0496102_0143468 Ga0496102_0143468_1002_2210 400
395 3300048922 Ga0496119_0122643 Ga0496119_0122643_163_1365 400
396 3300048929 Ga0496126_0153789 Ga0496126_0153789_571_1773 400
397 3300049568 Ga0501031_0081473 Ga0501031_0081473_465_1667 400
398 3300049568 Ga0501031_0166932 Ga0501031_0166932_123_1325 400
399 3300049569 Ga0501032_0162851 Ga0501032_0162851_103_1305 400
400 3300049570 Ga0501033_0065039 Ga0501033_0065039_195_1397 400
401 3300049570 Ga0501033_0074161 Ga0501033_0074161_694_1896 400
402 3300049570 Ga0501033_0172185 Ga0501033_0172185_210_1412 400
403 3300049571 Ga0501034_0107658 Ga0501034_0107658_1009_2211 400
404 3300049572 Ga0501036_0074432 Ga0501036_0074432_97_1299 400
405 3300049572 Ga0501036_0245082 Ga0501036_0245082_88_1290 400
406 3300049573 Ga0501037_0078962 Ga0501037_0078962_46_1248 400
407 3300049573 Ga0501037_0124295 Ga0501037_0124295_525_1727 400
408 3300049573 Ga0501037_0202925 Ga0501037_0202925_44_1246 400
409 3300049574 Ga0501038_0148101 Ga0501038_0148101_396_1742 400
410 3300049574 Ga0501038_0249852 Ga0501038_0249852_77_1300 400
411 3300049574 Ga0501038_0265311 Ga0501038_0265311_124_1326 400
412 3300049575 Ga0501039_0221233 Ga0501039_0221233_168_1370 400
413 3300049575 Ga0501039_0221836 Ga0501039_0221836_184_1407 400
414 3300049576 Ga0501040_0208044 Ga0501040_0208044_147_1370 400
415 3300049579 Ga0501043_0253650 Ga0501043_0253650_132_1334 400
416 3300049580 Ga0501046_0029041 Ga0501046_0029041_3162_4364 400
417 3300049580 Ga0501046_0198495 Ga0501046_0198495_85_1308 400
418 3300049580 Ga0501046_0233385 Ga0501046_0233385_87_1289 400
419 3300049581 Ga0501047_0035644 Ga0501047_0035644_3157_4380 400
420 3300049581 Ga0501047_0242941 Ga0501047_0242941_108_1310 400
421 3300049582 Ga0501048_0182527 Ga0501048_0182527_160_1362 400
422 3300049583 Ga0501067_0035203 Ga0501067_0035203_1132_2412 400
423 3300049583 Ga0501067_0067251 Ga0501067_0067251_143_1345 400
424 3300049584 Ga0501068_0118504 Ga0501068_0118504_388_1590 400
425 3300049584 Ga0501068_0187748 Ga0501068_0187748_14_1216 400
426 3300049585 Ga0501069_0165486 Ga0501069_0165486_29_1231 400
427 3300049586 Ga0501070_0016011 Ga0501070_0016011_4078_5280 400
428 3300049586 Ga0501070_0188565 Ga0501070_0188565_245_1447 400
429 3300049588 Ga0501072_0223251 Ga0501072_0223251_110_1333 400
430 3300049590 Ga0501074_0172703 Ga0501074_0172703_211_1413 400
431 3300049590 Ga0501074_0199128 Ga0501074_0199128_192_1394 400
432 3300049590 Ga0501074_0234688 Ga0501074_0234688_79_1281 400
433 3300049592 Ga0501076_0082124 Ga0501076_0082124_1178_2401 400
434 3300049592 Ga0501076_0182402 Ga0501076_0182402_293_1666 400
435 3300049592 Ga0501076_0265247 Ga0501076_0265247_178_1380 400
436 3300049593 Ga0501077_0060600 Ga0501077_0060600_274_1476 400
437 3300049741 Ga0501079_0195488 Ga0501079_0195488_195_1418 400
438 3300049741 Ga0501079_0287965 Ga0501079_0287965_19_1221 400
439 3300049742 Ga0501080_0188206 Ga0501080_0188206_481_1683 400
440 3300049743 Ga0501081_0000061 Ga0501081_0000061_16712_17935 400
441 3300049744 Ga0501083_0152383 Ga0501083_0152383_287_1489 400
442 3300049822 Ga0501035_0139726 Ga0501035_0139726_483_1685 400
443 3300049822 Ga0501035_0220494 Ga0501035_0220494_114_1436 400
444 3300049823 Ga0501044_0056645 Ga0501044_0056645_1654_2856 400
445 3300049823 Ga0501044_0149298 Ga0501044_0149298_139_1341 400
446 3300053085 Ga0495619_0203277 Ga0495619_0203277_53_1255 400
447 3300054114 Ga0501084_0255743 Ga0501084_0255743_204_1406 400
448 3300061734 Ga0530510_0191770 Ga0530510_0191770_169_1392 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01610

DDE_Tnp_ISL3

Transposase

209

449

0.97

PF14690

zf-ISL3

zinc-finger of transposase IS204/IS1001/IS1096/IS1165

93

139

0.97

PF13542

HTH_Tnp_ISL3

Helix-turn-helix domain of transposase family ISL3

144

194

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.7384 197 228
4fw1-assembly1.cif.gz_B crystal structure of two-domain rsv integrase covalently linked with dna 0.6668 149 230
5y6i-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa hmgr 0.6457 101 147
8cty-assembly3.cif.gz_H-4 12-mer dna structure of exbim bound to rnase-h 0.6361 148 216
1c0m-assembly1.cif.gz_A crystal structure of rsv two-domain integrase 0.6358 143 230
ID Description Score Start End Superfamily
af_K7LV62_47_129_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8365 183 237 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8188 149 183 3.30.420.10
af_I1MFY3_263_357_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8039 152 237 3.30.420.10
af_A0A1D6JGA3_259_353_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7713 152 237 3.30.420.10
af_Q969U6_63_192_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7502 154 184 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A843TBM9-F1-model_v4 Transposase IS204/IS1001/IS1096/IS1165 DDE domain-containing protein 0.9768 154 231
AF-N6WY91-F1-model_v4 Transposase for insertion sequence element IS1001 0.9734 189 398
AF-A0A829EMN6-F1-model_v4 deleted 0.9724 117 400
AF-A0A2E2HTC5-F1-model_v4 deleted 0.9716 175 400
AF-A0A2S4THX3-F1-model_v4 deleted 0.9707 170 400

Feature Viewer

pLDDT pTM Quality
90.79 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map