F446250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 448 | 293 | 408 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300049592|Ga0501076_0182402|Ga0501076_0182402_293_1666 |
| Length | 457 |
| Sequence | MRPDIVAFSWRPLKGHAAAQKKGSSPNSGIDGLTTAAANLVLSKHQEQEAAVAPRDAMSWLEGWEGYAVSEDRIEVRGSQSWCVIRLEPIAGASRCCSGCGELTRVIHDQEERRIRDLPVFEHAVELIVPRVRVHCRVCGPRLERLVWLDAYARVTRRLAASVSQLCRVASIRHVAQFFGLDWKTVKALDRARLEDEVGSPDLDDLTVIAMDEFAIQKGHRYATVIVEPTRKRVLWVGRGRGRTDVRPFFEQLGAERCARLEAAVMDMNAAFRLEVQAHCPNAAIVFDLFHVVAKYGREVIDRVRVDQANALRTDRKQRKIVKSARWLLLRNRDSLRPEEDASLDELLAANRSLFVVYVLRDALRELWRYRHPGHAQQAWRSWYRKALRSGIAPLRRFARALRPYRSGILAHCRYPLGTNLIEGINNKIKVIKRMAYGFRDDEYFFLKIRAAFPGVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 2 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 3 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 4 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 5 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 6 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 7 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 8 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 9 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 10 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 20 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 146 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 147 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 160 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 170 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 173 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 174 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 175 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 176 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 177 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 178 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 179 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 184 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 242 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 267 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 268 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 273 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 288 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 289 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 290 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 291 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 292 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 293 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.73 |
| Metatranscriptomes | 1.34 |
| Isolates | 8.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.9 |
| Nodule | 2.46 |
| Rhizoplane | 0.67 |
| Rhizosphere | 87.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003077 | 3300001904 | Bacteria | 2911 |
| 2 | JGI24741J21665_1003993 | 3300001915 | Bacteria | 3371 |
| 3 | JGI24746J21847_1007798 | 3300001977 | Bacteria | 1629 |
| 4 | JGI24740J21852_10005697 | 3300001979 | Bacteria | 5238 |
| 5 | JGI24739J22299_10030441 | 3300001989 | Bacteria | 1871 |
| 6 | JGI24748J21848_1006516 | 3300002074 | Bacteria | 1360 |
| 7 | JGI24035J26624_1004702 | 3300002126 | Bacteria | 1298 |
| 8 | JGI24742J22300_10014209 | 3300002244 | Bacteria | 1337 |
| 9 | JGI25154J39366_1008382 | 3300002738 | Bacteria | 1336 |
| 10 | JGI25158J39367_1002144 | 3300002739 | Bacteria | 3300 |
| 11 | JGI25159J45721_1002989 | 3300002987 | Bacteria | 6143 |
| 12 | rootH2_10009100 | 3300003320 | Bacteria | 2878 |
| 13 | rootH2_10160122 | 3300003320 | Bacteria | 1919 |
| 14 | rootL2_10003582 | 3300003322 | Bacteria | 8520 |
| 15 | rootL2_10060793 | 3300003322 | Bacteria | 1319 |
| 16 | rootL2_10300805 | 3300003322 | Bacteria | 1350 |
| 17 | rootH1_10118944 | 3300003323 | Bacteria | 1495 |
| 18 | JGI25161J50226_1003547 | 3300003374 | Bacteria | 3529 |
| 19 | Ga0055534_1011259 | 3300003784 | Bacteria | 1828 |
| 20 | Ga0055534_1013189 | 3300003784 | Bacteria | 1596 |
| 21 | Ga0055534_1015036 | 3300003784 | Bacteria | 1430 |
| 22 | Ga0058692_1009908 | 3300003856 | Bacteria | 2380 |
| 23 | Ga0058692_1020624 | 3300003856 | Bacteria | 1381 |
| 24 | Ga0055543_1000288 | 3300004625 | Bacteria | 36504 |
| 25 | Ga0065165_1000559 | 3300005262 | Bacteria | 55415 |
| 26 | Ga0065704_10002840 | 3300005289 | Bacteria | 9754 |
| 27 | Ga0070658_10207023 | 3300005327 | Bacteria | 1656 |
| 28 | Ga0070658_10300036 | 3300005327 | Bacteria | 1370 |
| 29 | Ga0070677_10070710 | 3300005333 | Bacteria | 1467 |
| 30 | Ga0068869_100013257 | 3300005334 | Bacteria | 5478 |
| 31 | Ga0070680_100278896 | 3300005336 | Bacteria | 1416 |
| 32 | Ga0068868_100277062 | 3300005338 | Unclassified | 1418 |
| 33 | Ga0070660_100257774 | 3300005339 | Bacteria | 1423 |
| 34 | Ga0070689_100223056 | 3300005340 | Bacteria | 1547 |
| 35 | Ga0070668_100174620 | 3300005347 | Bacteria | 1751 |
| 36 | Ga0070675_100296080 | 3300005354 | Bacteria | 1425 |
| 37 | Ga0070674_100038817 | 3300005356 | Bacteria | 3211 |
| 38 | Ga0070674_100121535 | 3300005356 | Bacteria | 1934 |
| 39 | Ga0070709_10019706 | 3300005434 | Bacteria | 3903 |
| 40 | Ga0070714_100237701 | 3300005435 | Bacteria | 1681 |
| 41 | Ga0070700_100026825 | 3300005441 | Bacteria | 3407 |
| 42 | Ga0070694_100016863 | 3300005444 | Bacteria | 4606 |
| 43 | Ga0070694_100074816 | 3300005444 | Bacteria | 2341 |
| 44 | Ga0070678_100231909 | 3300005456 | Bacteria | 1539 |
| 45 | Ga0070678_100233205 | 3300005456 | Bacteria | 1535 |
| 46 | Ga0068867_100019504 | 3300005459 | Bacteria | 4831 |
| 47 | Ga0068867_100172861 | 3300005459 | Bacteria | 1712 |
| 48 | Ga0070706_100239598 | 3300005467 | Bacteria | 1694 |
| 49 | Ga0070706_100240727 | 3300005467 | Bacteria | 1690 |
| 50 | Ga0070707_100296573 | 3300005468 | Bacteria | 1571 |
| 51 | Ga0070707_100347142 | 3300005468 | Bacteria | 1441 |
| 52 | Ga0070698_100071501 | 3300005471 | Bacteria | 3479 |
| 53 | Ga0070699_100215963 | 3300005518 | Bacteria | 1708 |
| 54 | Ga0070679_100167261 | 3300005530 | Bacteria | 2172 |
| 55 | Ga0070684_100113122 | 3300005535 | Bacteria | 2435 |
| 56 | Ga0068853_100080982 | 3300005539 | Bacteria | 2842 |
| 57 | Ga0070695_100084880 | 3300005545 | Bacteria | 2101 |
| 58 | Ga0070695_100096378 | 3300005545 | Bacteria | 1985 |
| 59 | Ga0068855_100139374 | 3300005563 | Bacteria | 2766 |
| 60 | Ga0068855_100226418 | 3300005563 | Bacteria | 2095 |
| 61 | Ga0068855_100269386 | 3300005563 | Bacteria | 1894 |
| 62 | Ga0068854_100049908 | 3300005578 | Bacteria | 2991 |
| 63 | Ga0068859_100392836 | 3300005617 | Bacteria | 1483 |
| 64 | Ga0068861_100258628 | 3300005719 | Bacteria | 1489 |
| 65 | Ga0068870_10133728 | 3300005840 | Bacteria | 1443 |
| 66 | Ga0068858_100223896 | 3300005842 | Bacteria | 1782 |
| 67 | Ga0068862_100172853 | 3300005844 | Bacteria | 1935 |
| 68 | Ga0081455_10018449 | 3300005937 | Bacteria | 6647 |
| 69 | Ga0081539_10082634 | 3300005985 | Bacteria | 1683 |
| 70 | Ga0081539_10088043 | 3300005985 | Bacteria | 1612 |
| 71 | Ga0097621_100302424 | 3300006237 | Bacteria | 1413 |
| 72 | Ga0075428_100181666 | 3300006844 | Bacteria | 2276 |
| 73 | Ga0068865_100048193 | 3300006881 | Unclassified | 2931 |
| 74 | Ga0068865_100121898 | 3300006881 | Bacteria | 1940 |
| 75 | Ga0097620_100392864 | 3300006931 | Bacteria | 1483 |
| 76 | Ga0105244_10062519 | 3300009036 | Bacteria | 1871 |
| 77 | Ga0105240_10301660 | 3300009093 | Bacteria | 1832 |
| 78 | Ga0111539_10458091 | 3300009094 | Bacteria | 1485 |
| 79 | Ga0105245_10262167 | 3300009098 | Bacteria | 1682 |
| 80 | Ga0105243_10276724 | 3300009148 | Bacteria | 1510 |
| 81 | Ga0105242_10327055 | 3300009176 | Bacteria | 1408 |
| 82 | Ga0105237_10191931 | 3300009545 | Bacteria | 2042 |
| 83 | Ga0105238_10224744 | 3300009551 | Bacteria | 1854 |
| 84 | Ga0105238_10252815 | 3300009551 | Bacteria | 1741 |
| 85 | Ga0154012_145278 | 3300013059 | Bacteria | 1272 |
| 86 | Ga0157370_10011880 | 3300013104 | Bacteria | 9083 |
| 87 | Ga0157372_10249261 | 3300013307 | Bacteria | 2061 |
| 88 | Ga0157372_10416765 | 3300013307 | Bacteria | 1565 |
| 89 | Ga0163163_10270075 | 3300014325 | Bacteria | 1752 |
| 90 | Ga0157380_10281676 | 3300014326 | Bacteria | 1522 |
| 91 | Ga0197907_10910350 | 3300020069 | Bacteria | 1804 |
| 92 | Ga0206351_10326828 | 3300020077 | Bacteria | 2790 |
| 93 | Ga0206352_10393391 | 3300020078 | Bacteria | 2968 |
| 94 | Ga0206350_10214115 | 3300020080 | Bacteria | 1485 |
| 95 | Ga0213876_10070055 | 3300021384 | Bacteria | 1852 |
| 96 | Ga0224712_10001108 | 3300022467 | Bacteria | 5969 |
| 97 | Ga0209646_1012011 | 3300025246 | Bacteria | 1335 |
| 98 | Ga0209026_1008710 | 3300025250 | Bacteria | 2084 |
| 99 | Ga0209148_1012158 | 3300025254 | Bacteria | 1580 |
| 100 | Ga0209565_1018131 | 3300025263 | Bacteria | 1528 |
| 101 | Ga0209455_1016183 | 3300025272 | Bacteria | 1611 |
| 102 | Ga0209673_1030295 | 3300025273 | Bacteria | 1707 |
| 103 | Ga0207673_1003312 | 3300025290 | Bacteria | 1878 |
| 104 | Ga0209675_1010149 | 3300025291 | Bacteria | 3245 |
| 105 | Ga0207656_10024119 | 3300025321 | Bacteria | 2456 |
| 106 | Ga0207656_10035352 | 3300025321 | Bacteria | 2092 |
| 107 | Ga0207682_10022863 | 3300025893 | Bacteria | 2466 |
| 108 | Ga0207688_10041638 | 3300025901 | Bacteria | 2556 |
| 109 | Ga0207680_10059697 | 3300025903 | Bacteria | 2318 |
| 110 | Ga0207645_10078105 | 3300025907 | Bacteria | 2121 |
| 111 | Ga0207705_10167400 | 3300025909 | Bacteria | 1654 |
| 112 | Ga0207684_10106845 | 3300025910 | Bacteria | 2395 |
| 113 | Ga0207684_10273375 | 3300025910 | Bacteria | 1458 |
| 114 | Ga0207654_10186142 | 3300025911 | Bacteria | 1358 |
| 115 | Ga0207695_10215168 | 3300025913 | Bacteria | 1831 |
| 116 | Ga0207671_10114918 | 3300025914 | Bacteria | 2052 |
| 117 | Ga0207681_10059315 | 3300025923 | Bacteria | 2623 |
| 118 | Ga0207694_10128099 | 3300025924 | Bacteria | 2032 |
| 119 | Ga0207694_10202776 | 3300025924 | Bacteria | 1614 |
| 120 | Ga0207694_10280272 | 3300025924 | Bacteria | 1369 |
| 121 | Ga0207650_10076282 | 3300025925 | Bacteria | 2532 |
| 122 | Ga0207650_10286949 | 3300025925 | Bacteria | 1341 |
| 123 | Ga0207659_10265017 | 3300025926 | Bacteria | 1399 |
| 124 | Ga0207664_10103489 | 3300025929 | Bacteria | 2356 |
| 125 | Ga0207706_10041546 | 3300025933 | Bacteria | 4077 |
| 126 | Ga0207706_10120232 | 3300025933 | Bacteria | 2309 |
| 127 | Ga0207706_10150085 | 3300025933 | Bacteria | 2050 |
| 128 | Ga0207686_10155208 | 3300025934 | Bacteria | 1598 |
| 129 | Ga0207686_10215305 | 3300025934 | Bacteria | 1383 |
| 130 | Ga0207686_10229374 | 3300025934 | Bacteria | 1345 |
| 131 | Ga0207709_10247288 | 3300025935 | Bacteria | 1301 |
| 132 | Ga0207670_10204961 | 3300025936 | Bacteria | 1500 |
| 133 | Ga0207669_10094954 | 3300025937 | Unclassified | 1953 |
| 134 | Ga0207704_10174915 | 3300025938 | Bacteria | 1544 |
| 135 | Ga0207704_10244502 | 3300025938 | Bacteria | 1343 |
| 136 | Ga0207689_10082740 | 3300025942 | Bacteria | 2639 |
| 137 | Ga0207661_10286850 | 3300025944 | Bacteria | 1472 |
| 138 | Ga0207679_10027414 | 3300025945 | Bacteria | 3939 |
| 139 | Ga0207667_10205217 | 3300025949 | Bacteria | 2021 |
| 140 | Ga0207667_10264113 | 3300025949 | Bacteria | 1760 |
| 141 | Ga0207667_10294265 | 3300025949 | Bacteria | 1659 |
| 142 | Ga0207667_10361030 | 3300025949 | Bacteria | 1481 |
| 143 | Ga0207651_10051443 | 3300025960 | Bacteria | 2803 |
| 144 | Ga0207668_10265629 | 3300025972 | Unclassified | 1400 |
| 145 | Ga0207640_10126809 | 3300025981 | Bacteria | 1839 |
| 146 | Ga0207658_10314106 | 3300025986 | Unclassified | 1354 |
| 147 | Ga0207677_10280568 | 3300026023 | Bacteria | 1367 |
| 148 | Ga0207703_10143847 | 3300026035 | Bacteria | 2072 |
| 149 | Ga0207708_10031041 | 3300026075 | Bacteria | 4055 |
| 150 | Ga0207702_10078604 | 3300026078 | Bacteria | 2857 |
| 151 | Ga0207648_10105483 | 3300026089 | Bacteria | 2472 |
| 152 | Ga0207648_10113584 | 3300026089 | Bacteria | 2379 |
| 153 | Ga0207676_10045651 | 3300026095 | Bacteria | 3386 |
| 154 | Ga0207674_10252861 | 3300026116 | Bacteria | 1709 |
| 155 | Ga0207675_100139170 | 3300026118 | Bacteria | 2305 |
| 156 | Ga0207675_100339544 | 3300026118 | Bacteria | 1470 |
| 157 | Ga0207683_10202125 | 3300026121 | Bacteria | 1806 |
| 158 | Ga0207698_10000358 | 3300026142 | Bacteria | 26861 |
| 159 | Ga0207698_10370781 | 3300026142 | Bacteria | 1359 |
| 160 | Ga0209371_1000325 | 3300027312 | Bacteria | 52216 |
| 161 | Ga0209971_1026211 | 3300027682 | Bacteria | 1393 |
| 162 | Ga0209974_10026570 | 3300027876 | Bacteria | 1916 |
| 163 | Ga0268266_10190880 | 3300028379 | Bacteria | 1870 |
| 164 | Ga0268266_10307868 | 3300028379 | Bacteria | 1479 |
| 165 | Ga0265338_10094648 | 3300028800 | Bacteria | 2456 |
| 166 | Ga0265338_10179401 | 3300028800 | Bacteria | 1616 |
| 167 | Ga0265332_10038996 | 3300031238 | Bacteria | 2058 |
| 168 | Ga0265329_10046864 | 3300031242 | Unclassified | 1380 |
| 169 | Ga0265340_10009572 | 3300031247 | Bacteria | 5195 |
| 170 | Ga0265339_10096187 | 3300031249 | Bacteria | 1546 |
| 171 | Ga0265316_10197843 | 3300031344 | Bacteria | 1491 |
| 172 | Ga0265316_10203550 | 3300031344 | Unclassified | 1466 |
| 173 | Ga0307408_100102408 | 3300031548 | Bacteria | 2184 |
| 174 | Ga0307514_10174201 | 3300031649 | Bacteria | 1399 |
| 175 | Ga0316579_10096389 | 3300031691 | Bacteria | 1414 |
| 176 | Ga0265314_10131843 | 3300031711 | Bacteria | 1558 |
| 177 | Ga0265342_10107136 | 3300031712 | Bacteria | 1585 |
| 178 | Ga0307405_10044088 | 3300031731 | Bacteria | 2726 |
| 179 | Ga0307405_10219245 | 3300031731 | Bacteria | 1394 |
| 180 | Ga0307410_10154212 | 3300031852 | Bacteria | 1713 |
| 181 | Ga0307410_10209006 | 3300031852 | Bacteria | 1494 |
| 182 | Ga0307406_10050161 | 3300031901 | Bacteria | 2644 |
| 183 | Ga0307406_10188414 | 3300031901 | Bacteria | 1508 |
| 184 | Ga0307407_10027806 | 3300031903 | Bacteria | 3015 |
| 185 | Ga0307412_10018096 | 3300031911 | Bacteria | 4231 |
| 186 | Ga0307409_100144584 | 3300031995 | Bacteria | 2054 |
| 187 | Ga0307416_100205750 | 3300032002 | Bacteria | 1872 |
| 188 | Ga0307414_10003263 | 3300032004 | Bacteria | 8645 |
| 189 | Ga0307414_10004914 | 3300032004 | Bacteria | 7308 |
| 190 | Ga0307414_10137479 | 3300032004 | Bacteria | 1907 |
| 191 | Ga0307411_10000112 | 3300032005 | Bacteria | 25459 |
| 192 | Ga0307411_10025149 | 3300032005 | Bacteria | 3562 |
| 193 | Ga0307415_100036355 | 3300032126 | Bacteria | 3226 |
| 194 | Ga0307507_10115185 | 3300033179 | Bacteria | 2177 |
| 195 | Ga0373959_0009713 | 3300034820 | Bacteria | 1667 |
| 196 | Ga0373937_0210463 | 3300036401 | Bacteria | 1829 |
| 197 | Ga0373937_0295947 | 3300036401 | Bacteria | 1529 |
| 198 | Ga0395899_0208154 | 3300037312 | Bacteria | 1360 |
| 199 | Ga0395899_0212304 | 3300037312 | Bacteria | 1344 |
| 200 | Ga0395900_0113539 | 3300037418 | Bacteria | 2780 |
| 201 | Ga0395900_0287347 | 3300037418 | Bacteria | 1634 |
| 202 | Ga0395898_0217766 | 3300037466 | Bacteria | 1821 |
| 203 | Ga0395898_0222760 | 3300037466 | Bacteria | 1799 |
| 204 | Ga0395898_0252072 | 3300037466 | Bacteria | 1683 |
| 205 | Ga0395905_0014429 | 3300037471 | Bacteria | 7543 |
| 206 | Ga0395905_0114752 | 3300037471 | Bacteria | 2531 |
| 207 | Ga0395905_0220645 | 3300037471 | Bacteria | 1774 |
| 208 | Ga0395901_0327099 | 3300038443 | Bacteria | 1585 |
| 209 | Ga0395901_0364879 | 3300038443 | Bacteria | 1488 |
| 210 | Ga0436365_0027044 | 3300039437 | Bacteria | 1795 |
| 211 | Ga0436361_0034387 | 3300039447 | Bacteria | 1980 |
| 212 | Ga0439461_0001646 | 3300041410 | Bacteria | 3474 |
| 213 | Ga0439432_028869 | 3300042006 | Bacteria | 1805 |
| 214 | Ga0439449_0037367 | 3300042007 | Bacteria | 1806 |
| 215 | Ga0439452_018624 | 3300042010 | Bacteria | 1847 |
| 216 | Ga0439452_019116 | 3300042010 | Bacteria | 1816 |
| 217 | Ga0450921_001347 | 3300042123 | Bacteria | 1464 |
| 218 | Ga0450922_003533 | 3300042124 | Bacteria | 1438 |
| 219 | Ga0450922_003899 | 3300042124 | Bacteria | 1372 |
| 220 | Ga0450923_008272 | 3300042125 | Bacteria | 1785 |
| 221 | Ga0450905_004617 | 3300042142 | Bacteria | 1828 |
| 222 | Ga0450910_006263 | 3300042147 | Bacteria | 1638 |
| 223 | Ga0439446_0016900 | 3300042156 | Bacteria | 2035 |
| 224 | Ga0450909_009847 | 3300042185 | Bacteria | 1396 |
| 225 | Ga0451577_0075335 | 3300042876 | Bacteria | 3009 |
| 226 | Ga0466969_0039151 | 3300044656 | Bacteria | 2382 |
| 227 | Ga0466972_0050111 | 3300044658 | Bacteria | 2016 |
| 228 | Ga0466977_0012394 | 3300044666 | Bacteria | 4966 |
| 229 | Ga0466978_0092923 | 3300044671 | Bacteria | 1879 |
| 230 | Ga0466965_0049646 | 3300044683 | Bacteria | 2080 |
| 231 | Ga0466965_0077464 | 3300044683 | Bacteria | 1679 |
| 232 | Ga0466965_0098877 | 3300044683 | Bacteria | 1490 |
| 233 | Ga0466966_0134799 | 3300044684 | Bacteria | 1510 |
| 234 | Ga0466966_0138281 | 3300044684 | Bacteria | 1489 |
| 235 | Ga0466961_0038754 | 3300044693 | Bacteria | 3057 |
| 236 | Ga0453684_0099939 | 3300044712 | Bacteria | 3552 |
| 237 | Ga0453684_0217332 | 3300044712 | Bacteria | 2217 |
| 238 | Ga0466970_0018013 | 3300044765 | Bacteria | 3655 |
| 239 | Ga0466970_0026209 | 3300044765 | Bacteria | 3055 |
| 240 | Ga0466970_0082052 | 3300044765 | Bacteria | 1743 |
| 241 | Ga0466970_0114889 | 3300044765 | Bacteria | 1471 |
| 242 | Ga0466957_0016688 | 3300044842 | Bacteria | 4295 |
| 243 | Ga0466957_0065157 | 3300044842 | Bacteria | 2243 |
| 244 | Ga0466957_0126570 | 3300044842 | Bacteria | 1633 |
| 245 | Ga0466957_0149473 | 3300044842 | Bacteria | 1509 |
| 246 | Ga0466959_0004884 | 3300045049 | Bacteria | 9075 |
| 247 | Ga0466959_0173109 | 3300045049 | Bacteria | 1513 |
| 248 | Ga0466959_0174701 | 3300045049 | Bacteria | 1505 |
| 249 | Ga0466967_0107778 | 3300045976 | Bacteria | 2555 |
| 250 | Ga0466967_0208971 | 3300045976 | Bacteria | 1851 |
| 251 | Ga0466967_0398604 | 3300045976 | Bacteria | 1338 |
| 252 | Ga0495603_0160390 | 3300046455 | Bacteria | 1305 |
| 253 | Ga0495590_0056178 | 3300046457 | Bacteria | 1375 |
| 254 | Ga0495591_000075 | 3300046458 | Bacteria | 112616 |
| 255 | Ga0495638_0033869 | 3300046460 | Bacteria | 3263 |
| 256 | Ga0495638_0113024 | 3300046460 | Bacteria | 1611 |
| 257 | Ga0495651_0181074 | 3300046462 | Bacteria | 1491 |
| 258 | Ga0495653_0179706 | 3300046463 | Bacteria | 1453 |
| 259 | Ga0495580_0156565 | 3300046472 | Bacteria | 1577 |
| 260 | Ga0495605_0000728 | 3300046474 | Bacteria | 24222 |
| 261 | Ga0495584_0002569 | 3300046491 | Bacteria | 10242 |
| 262 | Ga0495585_0000496 | 3300046492 | Bacteria | 37202 |
| 263 | Ga0495585_0005698 | 3300046492 | Bacteria | 7816 |
| 264 | Ga0495607_0118620 | 3300046501 | Bacteria | 1392 |
| 265 | Ga0495607_0131243 | 3300046501 | Bacteria | 1303 |
| 266 | Ga0495606_0092962 | 3300046507 | Bacteria | 1851 |
| 267 | Ga0495616_0062610 | 3300046513 | Bacteria | 1821 |
| 268 | Ga0495620_0035828 | 3300046515 | Bacteria | 2227 |
| 269 | Ga0495631_0097845 | 3300046518 | Bacteria | 1263 |
| 270 | Ga0495632_0089914 | 3300046519 | Bacteria | 1456 |
| 271 | Ga0495648_0134603 | 3300046524 | Bacteria | 1309 |
| 272 | Ga0495663_0030032 | 3300046525 | Bacteria | 1608 |
| 273 | Ga0495654_0062022 | 3300046530 | Bacteria | 1793 |
| 274 | Ga0495587_0136906 | 3300046536 | Bacteria | 1399 |
| 275 | Ga0495587_0177251 | 3300046536 | Bacteria | 1209 |
| 276 | Ga0495598_0022140 | 3300046537 | Bacteria | 1697 |
| 277 | Ga0495609_0001470 | 3300046538 | Bacteria | 15620 |
| 278 | Ga0495621_0031121 | 3300046539 | Bacteria | 1828 |
| 279 | Ga0495621_0043499 | 3300046539 | Bacteria | 1584 |
| 280 | Ga0495597_0011420 | 3300046542 | Bacteria | 4306 |
| 281 | Ga0495597_0076176 | 3300046542 | Bacteria | 1439 |
| 282 | Ga0495645_0172525 | 3300046543 | Bacteria | 1488 |
| 283 | Ga0495635_0098623 | 3300046663 | Bacteria | 1997 |
| 284 | Ga0495659_0000001 | 3300046664 | Bacteria | 325846 |
| 285 | Ga0495661_0000011 | 3300046665 | Bacteria | 277997 |
| 286 | Ga0495657_0149560 | 3300046675 | Bacteria | 1450 |
| 287 | Ga0495599_0031647 | 3300046678 | Bacteria | 3320 |
| 288 | Ga0495599_0138076 | 3300046678 | Bacteria | 1512 |
| 289 | Ga0495669_0045760 | 3300046684 | Bacteria | 1952 |
| 290 | Ga0495671_0014427 | 3300046692 | Bacteria | 4252 |
| 291 | Ga0495649_0002076 | 3300046694 | Bacteria | 14395 |
| 292 | Ga0495649_0090203 | 3300046694 | Bacteria | 1634 |
| 293 | Ga0495600_0070645 | 3300046809 | Bacteria | 2281 |
| 294 | Ga0495636_0075467 | 3300047318 | Bacteria | 1445 |
| 295 | Ga0495680_0038924 | 3300047322 | Bacteria | 3797 |
| 296 | Ga0495680_0223136 | 3300047322 | Bacteria | 1344 |
| 297 | Ga0495683_0000059 | 3300047323 | Bacteria | 116530 |
| 298 | Ga0495686_0088972 | 3300047472 | Bacteria | 1876 |
| 299 | Ga0495602_0216398 | 3300048088 | Bacteria | 1449 |
| 300 | Ga0495615_0018343 | 3300048090 | Bacteria | 1538 |
| 301 | Ga0495626_0014660 | 3300048091 | Bacteria | 4035 |
| 302 | Ga0496100_0083523 | 3300048903 | Bacteria | 2162 |
| 303 | Ga0496101_0207555 | 3300048904 | Bacteria | 1516 |
| 304 | Ga0496102_0143468 | 3300048905 | Bacteria | 2240 |
| 305 | Ga0496119_0122643 | 3300048922 | Bacteria | 1426 |
| 306 | Ga0496121_0006314 | 3300048924 | Bacteria | 14804 |
| 307 | Ga0496124_0017948 | 3300048927 | Bacteria | 6649 |
| 308 | Ga0496126_0153789 | 3300048929 | Bacteria | 1970 |
| 309 | Ga0501291_004306 | 3300049514 | Bacteria | 1813 |
| 310 | Ga0501031_0081473 | 3300049568 | Bacteria | 2110 |
| 311 | Ga0501031_0145681 | 3300049568 | Bacteria | 1547 |
| 312 | Ga0501031_0166932 | 3300049568 | Bacteria | 1438 |
| 313 | Ga0501032_0024498 | 3300049569 | Bacteria | 4166 |
| 314 | Ga0501032_0162851 | 3300049569 | Bacteria | 1464 |
| 315 | Ga0501033_0065039 | 3300049570 | Bacteria | 2683 |
| 316 | Ga0501033_0074161 | 3300049570 | Bacteria | 2498 |
| 317 | Ga0501033_0172185 | 3300049570 | Bacteria | 1554 |
| 318 | Ga0501034_0000178 | 3300049571 | Bacteria | 118886 |
| 319 | Ga0501034_0107658 | 3300049571 | Bacteria | 2779 |
| 320 | Ga0501034_0201429 | 3300049571 | Bacteria | 1948 |
| 321 | Ga0501034_0386753 | 3300049571 | Bacteria | 1323 |
| 322 | Ga0501036_0042898 | 3300049572 | Bacteria | 3829 |
| 323 | Ga0501036_0074432 | 3300049572 | Bacteria | 2872 |
| 324 | Ga0501036_0245082 | 3300049572 | Bacteria | 1502 |
| 325 | Ga0501037_0078962 | 3300049573 | Bacteria | 2388 |
| 326 | Ga0501037_0124295 | 3300049573 | Bacteria | 1853 |
| 327 | Ga0501037_0202925 | 3300049573 | Bacteria | 1400 |
| 328 | Ga0501038_0148101 | 3300049574 | Bacteria | 1915 |
| 329 | Ga0501038_0249852 | 3300049574 | Bacteria | 1405 |
| 330 | Ga0501038_0265311 | 3300049574 | Bacteria | 1355 |
| 331 | Ga0501039_0221233 | 3300049575 | Bacteria | 1488 |
| 332 | Ga0501039_0221836 | 3300049575 | Bacteria | 1486 |
| 333 | Ga0501040_0136434 | 3300049576 | Bacteria | 1727 |
| 334 | Ga0501040_0208044 | 3300049576 | Bacteria | 1390 |
| 335 | Ga0501042_0053958 | 3300049578 | Bacteria | 2867 |
| 336 | Ga0501043_0253650 | 3300049579 | Bacteria | 1354 |
| 337 | Ga0501046_0029041 | 3300049580 | Bacteria | 4499 |
| 338 | Ga0501046_0198495 | 3300049580 | Bacteria | 1493 |
| 339 | Ga0501046_0231084 | 3300049580 | Bacteria | 1367 |
| 340 | Ga0501046_0233385 | 3300049580 | Bacteria | 1358 |
| 341 | Ga0501047_0035644 | 3300049581 | Bacteria | 4806 |
| 342 | Ga0501047_0076706 | 3300049581 | Bacteria | 3216 |
| 343 | Ga0501047_0242941 | 3300049581 | Bacteria | 1650 |
| 344 | Ga0501048_0034755 | 3300049582 | Bacteria | 3633 |
| 345 | Ga0501048_0182527 | 3300049582 | Bacteria | 1487 |
| 346 | Ga0501048_0233532 | 3300049582 | Bacteria | 1305 |
| 347 | Ga0501067_0003594 | 3300049583 | Bacteria | 8537 |
| 348 | Ga0501067_0035203 | 3300049583 | Bacteria | 2780 |
| 349 | Ga0501067_0067251 | 3300049583 | Bacteria | 1983 |
| 350 | Ga0501068_0118504 | 3300049584 | Bacteria | 1649 |
| 351 | Ga0501068_0187748 | 3300049584 | Bacteria | 1308 |
| 352 | Ga0501069_0082531 | 3300049585 | Bacteria | 1811 |
| 353 | Ga0501069_0106259 | 3300049585 | Bacteria | 1596 |
| 354 | Ga0501069_0165486 | 3300049585 | Bacteria | 1274 |
| 355 | Ga0501070_0016011 | 3300049586 | Bacteria | 6301 |
| 356 | Ga0501070_0188565 | 3300049586 | Bacteria | 1695 |
| 357 | Ga0501071_0088899 | 3300049587 | Bacteria | 2266 |
| 358 | Ga0501072_0032635 | 3300049588 | Bacteria | 4078 |
| 359 | Ga0501072_0182620 | 3300049588 | Bacteria | 1673 |
| 360 | Ga0501072_0223251 | 3300049588 | Bacteria | 1501 |
| 361 | Ga0501072_0253959 | 3300049588 | Bacteria | 1400 |
| 362 | Ga0501072_0338590 | 3300049588 | Bacteria | 1195 |
| 363 | Ga0501074_0022222 | 3300049590 | Bacteria | 4609 |
| 364 | Ga0501074_0172703 | 3300049590 | Bacteria | 1542 |
| 365 | Ga0501074_0199128 | 3300049590 | Bacteria | 1427 |
| 366 | Ga0501074_0234688 | 3300049590 | Bacteria | 1305 |
| 367 | Ga0501075_0086468 | 3300049591 | Bacteria | 2375 |
| 368 | Ga0501076_0082124 | 3300049592 | Bacteria | 2587 |
| 369 | Ga0501076_0108362 | 3300049592 | Bacteria | 2243 |
| 370 | Ga0501076_0182402 | 3300049592 | Bacteria | 1711 |
| 371 | Ga0501076_0265247 | 3300049592 | Bacteria | 1406 |
| 372 | Ga0501077_0060600 | 3300049593 | Bacteria | 2401 |
| 373 | Ga0501199_005590 | 3300049650 | Bacteria | 1264 |
| 374 | Ga0501207_008441 | 3300049654 | Bacteria | 1489 |
| 375 | Ga0501211_001691 | 3300049658 | Bacteria | 2359 |
| 376 | Ga0501227_006223 | 3300049665 | Bacteria | 2566 |
| 377 | Ga0501236_010263 | 3300049670 | Bacteria | 1223 |
| 378 | Ga0501248_001679 | 3300049678 | Bacteria | 1433 |
| 379 | Ga0501253_008742 | 3300049683 | Bacteria | 1468 |
| 380 | Ga0501257_016393 | 3300049686 | Bacteria | 1718 |
| 381 | Ga0501225_0029780 | 3300049705 | Bacteria | 1500 |
| 382 | Ga0501234_005694 | 3300049707 | Bacteria | 1946 |
| 383 | Ga0501234_008734 | 3300049707 | Bacteria | 1578 |
| 384 | Ga0501079_0195488 | 3300049741 | Bacteria | 1579 |
| 385 | Ga0501079_0287965 | 3300049741 | Bacteria | 1284 |
| 386 | Ga0501080_0170350 | 3300049742 | Bacteria | 2008 |
| 387 | Ga0501080_0188206 | 3300049742 | Bacteria | 1897 |
| 388 | Ga0501080_0362557 | 3300049742 | Bacteria | 1307 |
| 389 | Ga0501081_0000061 | 3300049743 | Bacteria | 42076 |
| 390 | Ga0501081_0064741 | 3300049743 | Bacteria | 2539 |
| 391 | Ga0501083_0041143 | 3300049744 | Bacteria | 3134 |
| 392 | Ga0501083_0066127 | 3300049744 | Bacteria | 2407 |
| 393 | Ga0501083_0152383 | 3300049744 | Bacteria | 1513 |
| 394 | Ga0501262_000317 | 3300049759 | Bacteria | 5869 |
| 395 | Ga0501035_0139726 | 3300049822 | Bacteria | 2106 |
| 396 | Ga0501035_0210296 | 3300049822 | Bacteria | 1664 |
| 397 | Ga0501035_0220494 | 3300049822 | Bacteria | 1619 |
| 398 | Ga0501044_0056645 | 3300049823 | Bacteria | 4024 |
| 399 | Ga0501044_0149298 | 3300049823 | Bacteria | 2320 |
| 400 | Ga0501045_0235962 | 3300049824 | Bacteria | 1361 |
| 401 | Ga0495619_0076155 | 3300053085 | Bacteria | 2252 |
| 402 | Ga0495619_0203277 | 3300053085 | Bacteria | 1371 |
| 403 | Ga0501084_0255743 | 3300054114 | Bacteria | 1478 |
| 404 | Ga0501084_0305575 | 3300054114 | Bacteria | 1343 |
| 405 | Ga0501082_0003876 | 3300060353 | Bacteria | 13061 |
| 406 | Ga0501082_0255287 | 3300060353 | Bacteria | 1525 |
| 407 | Ga0530510_0024692 | 3300061734 | Bacteria | 4292 |
| 408 | Ga0530510_0191770 | 3300061734 | Bacteria | 1517 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002739 | JGI25158J39367_1002144 | JGI25158J39367_10021442 | 313 |
| 2 | 3300002987 | JGI25159J45721_1002989 | JGI25159J45721_10029891 | 313 |
| 3 | 3300003374 | JGI25161J50226_1003547 | JGI25161J50226_10035472 | 313 |
| 4 | 3300004625 | Ga0055543_1000288 | Ga0055543_100028830 | 313 |
| 5 | 3300005262 | Ga0065165_1000559 | Ga0065165_10005591 | 313 |
| 6 | 3300046665 | Ga0495661_0000011 | Ga0495661_0000011_276669_277736 | 318 |
| 7 | 3300042006 | Ga0439432_028869 | Ga0439432_028869_393_1367 | 323 |
| 8 | 3300042156 | Ga0439446_0016900 | Ga0439446_0016900_170_1144 | 323 |
| 9 | 3300049571 | Ga0501034_0201429 | Ga0501034_0201429_411_1427 | 337 |
| 10 | 3300034820 | Ga0373959_0009713 | Ga0373959_0009713_456_1487 | 343 |
| 11 | 3300046678 | Ga0495599_0031647 | Ga0495599_0031647_1295_2329 | 343 |
| 12 | 3300047318 | Ga0495636_0075467 | Ga0495636_0075467_29_1066 | 343 |
| 13 | 3300049514 | Ga0501291_004306 | Ga0501291_004306_395_1432 | 343 |
| 14 | 3300049571 | Ga0501034_0386753 | Ga0501034_0386753_276_1310 | 343 |
| 15 | 3300049581 | Ga0501047_0076706 | Ga0501047_0076706_826_1860 | 343 |
| 16 | 3300049650 | Ga0501199_005590 | Ga0501199_005590_119_1156 | 343 |
| 17 | 3300049654 | Ga0501207_008441 | Ga0501207_008441_408_1445 | 343 |
| 18 | 3300049665 | Ga0501227_006223 | Ga0501227_006223_238_1275 | 343 |
| 19 | 3300049670 | Ga0501236_010263 | Ga0501236_010263_13_1050 | 343 |
| 20 | 3300049683 | Ga0501253_008742 | Ga0501253_008742_421_1458 | 343 |
| 21 | 3300049705 | Ga0501225_0029780 | Ga0501225_0029780_391_1428 | 343 |
| 22 | 3300049707 | Ga0501234_008734 | Ga0501234_008734_510_1547 | 343 |
| 23 | 3300049742 | Ga0501080_0170350 | Ga0501080_0170350_96_1130 | 343 |
| 24 | 3300049759 | Ga0501262_000317 | Ga0501262_000317_4802_5839 | 343 |
| 25 | 3300049822 | Ga0501035_0210296 | Ga0501035_0210296_97_1131 | 343 |
| 26 | 3300003320 | rootH2_10160122 | rootH2_101601221 | 350 |
| 27 | 3300037471 | Ga0395905_0114752 | Ga0395905_0114752_299_1357 | 351 |
| 28 | 3300046501 | Ga0495607_0131243 | Ga0495607_0131243_114_1172 | 351 |
| 29 | 3300046513 | Ga0495616_0062610 | Ga0495616_0062610_740_1798 | 351 |
| 30 | 3300046536 | Ga0495587_0177251 | Ga0495587_0177251_125_1183 | 351 |
| 31 | 3300046542 | Ga0495597_0076176 | Ga0495597_0076176_247_1305 | 351 |
| 32 | 3300049582 | Ga0501048_0233532 | Ga0501048_0233532_103_1170 | 354 |
| 33 | 3300049588 | Ga0501072_0253959 | Ga0501072_0253959_73_1140 | 354 |
| 34 | 3300032004 | Ga0307414_10004914 | Ga0307414_100049144 | 358 |
| 35 | 3300044684 | Ga0466966_0138281 | Ga0466966_0138281_330_1457 | 374 |
| 36 | 3300049588 | Ga0501072_0338590 | Ga0501072_0338590_15_1139 | 374 |
| 37 | 3300005468 | Ga0070707_100296573 | Ga0070707_1002965731 | 382 |
| 38 | 3300006844 | Ga0075428_100181666 | Ga0075428_1001816661 | 383 |
| 39 | 3300048927 | Ga0496124_0017948 | Ga0496124_0017948_108_1316 | 384 |
| 40 | 3300044712 | Ga0453684_0217332 | Ga0453684_0217332_48_1226 | 386 |
| 41 | 3300009098 | Ga0105245_10262167 | Ga0105245_102621672 | 389 |
| 42 | 3300032126 | Ga0307415_100036355 | Ga0307415_1000363552 | 389 |
| 43 | 3300046518 | Ga0495631_0097845 | Ga0495631_0097845_53_1222 | 389 |
| 44 | 3300046537 | Ga0495598_0022140 | Ga0495598_0022140_357_1526 | 389 |
| 45 | 3300046539 | Ga0495621_0031121 | Ga0495621_0031121_96_1265 | 389 |
| 46 | 3300048090 | Ga0495615_0018343 | Ga0495615_0018343_176_1345 | 389 |
| 47 | 3300033179 | Ga0307507_10115185 | Ga0307507_101151852 | 390 |
| 48 | 3300045976 | Ga0466967_0107778 | Ga0466967_0107778_465_1685 | 390 |
| 49 | 3300046492 | Ga0495585_0000496 | Ga0495585_0000496_34442_35752 | 390 |
| 50 | 3300031901 | Ga0307406_10188414 | Ga0307406_101884141 | 392 |
| 51 | 3300049678 | Ga0501248_001679 | Ga0501248_001679_51_1253 | 392 |
| 52 | 3300049686 | Ga0501257_016393 | Ga0501257_016393_15_1217 | 392 |
| 53 | 3300002738 | JGI25154J39366_1008382 | JGI25154J39366_10083821 | 393 |
| 54 | 3300003322 | rootL2_10300805 | rootL2_103008051 | 393 |
| 55 | 3300005459 | Ga0068867_100172861 | Ga0068867_1001728612 | 393 |
| 56 | 3300005844 | Ga0068862_100172853 | Ga0068862_1001728532 | 393 |
| 57 | 3300006881 | Ga0068865_100121898 | Ga0068865_1001218981 | 393 |
| 58 | 3300009148 | Ga0105243_10276724 | Ga0105243_102767241 | 393 |
| 59 | 3300025246 | Ga0209646_1012011 | Ga0209646_10120111 | 393 |
| 60 | 3300025250 | Ga0209026_1008710 | Ga0209026_10087103 | 393 |
| 61 | 3300025934 | Ga0207686_10155208 | Ga0207686_101552081 | 393 |
| 62 | 3300026089 | Ga0207648_10113584 | Ga0207648_101135842 | 393 |
| 63 | 3300031901 | Ga0307406_10050161 | Ga0307406_100501612 | 393 |
| 64 | 3300031903 | Ga0307407_10027806 | Ga0307407_100278063 | 393 |
| 65 | 3300031911 | Ga0307412_10018096 | Ga0307412_100180962 | 393 |
| 66 | 3300031995 | Ga0307409_100144584 | Ga0307409_1001445842 | 393 |
| 67 | 3300032005 | Ga0307411_10025149 | Ga0307411_100251493 | 393 |
| 68 | 3300042123 | Ga0450921_001347 | Ga0450921_001347_237_1445 | 393 |
| 69 | 3300042124 | Ga0450922_003533 | Ga0450922_003533_140_1348 | 393 |
| 70 | 3300046457 | Ga0495590_0056178 | Ga0495590_0056178_44_1249 | 393 |
| 71 | 3300046460 | Ga0495638_0033869 | Ga0495638_0033869_541_1746 | 393 |
| 72 | 3300046474 | Ga0495605_0000728 | Ga0495605_0000728_18671_19876 | 393 |
| 73 | 3300046501 | Ga0495607_0118620 | Ga0495607_0118620_135_1340 | 393 |
| 74 | 3300046507 | Ga0495606_0092962 | Ga0495606_0092962_600_1808 | 393 |
| 75 | 3300046519 | Ga0495632_0089914 | Ga0495632_0089914_191_1396 | 393 |
| 76 | 3300046692 | Ga0495671_0014427 | Ga0495671_0014427_2208_3413 | 393 |
| 77 | 3300046694 | Ga0495649_0002076 | Ga0495649_0002076_48_1304 | 393 |
| 78 | 3300047323 | Ga0495683_0000059 | Ga0495683_0000059_7197_8402 | 393 |
| 79 | 3300048091 | Ga0495626_0014660 | Ga0495626_0014660_1065_2270 | 393 |
| 80 | 3300048903 | Ga0496100_0083523 | Ga0496100_0083523_757_1962 | 393 |
| 81 | 3300048904 | Ga0496101_0207555 | Ga0496101_0207555_88_1293 | 393 |
| 82 | 3300049658 | Ga0501211_001691 | Ga0501211_001691_988_2193 | 393 |
| 83 | 3300049707 | Ga0501234_005694 | Ga0501234_005694_158_1363 | 393 |
| 84 | iso_pu_bacteria | 2643221638 | 2644213271 | 393 |
| 85 | iso_pu_bacteria | 640427133 | 640487047 | 393 |
| 86 | iso_pu_bacteria | 640427133 | 640487873 | 393 |
| 87 | iso_pu_bacteria | 640427133 | 640488945 | 393 |
| 88 | iso_pu_bacteria | 651053060 | 651174000 | 393 |
| 89 | iso_pu_bacteria | 651053060 | 651174475 | 393 |
| 90 | iso_pu_bacteria | 651053060 | 651174687 | 393 |
| 91 | iso_pu_bacteria | 651053060 | 651175450 | 393 |
| 92 | iso_pu_bacteria | 651053060 | 651175605 | 393 |
| 93 | iso_pu_bacteria | 651053060 | 651176525 | 393 |
| 94 | iso_pu_bacteria | 651053060 | 651177896 | 393 |
| 95 | iso_pu_bacteria | 651053060 | 651178005 | 393 |
| 96 | iso_pu_bacteria | 651053060 | 651178068 | 393 |
| 97 | iso_pu_bacteria | 651053060 | 651178152 | 393 |
| 98 | 3300003320 | rootH2_10009100 | rootH2_100091002 | 394 |
| 99 | 3300003322 | rootL2_10003582 | rootL2_100035825 | 394 |
| 100 | 3300003322 | rootL2_10060793 | rootL2_100607931 | 394 |
| 101 | 3300003323 | rootH1_10118944 | rootH1_101189441 | 394 |
| 102 | 3300003856 | Ga0058692_1009908 | Ga0058692_10099081 | 394 |
| 103 | 3300003856 | Ga0058692_1020624 | Ga0058692_10206241 | 394 |
| 104 | 3300005563 | Ga0068855_100269386 | Ga0068855_1002693862 | 394 |
| 105 | 3300005985 | Ga0081539_10082634 | Ga0081539_100826342 | 394 |
| 106 | 3300009036 | Ga0105244_10062519 | Ga0105244_100625192 | 394 |
| 107 | 3300013104 | Ga0157370_10011880 | Ga0157370_100118802 | 394 |
| 108 | 3300025321 | Ga0207656_10035352 | Ga0207656_100353522 | 394 |
| 109 | 3300025949 | Ga0207667_10361030 | Ga0207667_103610302 | 394 |
| 110 | 3300027312 | Ga0209371_1000325 | Ga0209371_100032524 | 394 |
| 111 | 3300031238 | Ga0265332_10038996 | Ga0265332_100389962 | 394 |
| 112 | 3300031247 | Ga0265340_10009572 | Ga0265340_100095723 | 394 |
| 113 | 3300031344 | Ga0265316_10197843 | Ga0265316_101978431 | 394 |
| 114 | 3300031691 | Ga0316579_10096389 | Ga0316579_100963891 | 394 |
| 115 | 3300031852 | Ga0307410_10209006 | Ga0307410_102090062 | 394 |
| 116 | 3300032004 | Ga0307414_10137479 | Ga0307414_101374791 | 394 |
| 117 | 3300037466 | Ga0395898_0217766 | Ga0395898_0217766_356_1576 | 394 |
| 118 | 3300037471 | Ga0395905_0220645 | Ga0395905_0220645_279_1499 | 394 |
| 119 | 3300041410 | Ga0439461_0001646 | Ga0439461_0001646_20_1222 | 394 |
| 120 | 3300042010 | Ga0439452_019116 | Ga0439452_019116_504_1706 | 394 |
| 121 | 3300042124 | Ga0450922_003899 | Ga0450922_003899_79_1281 | 394 |
| 122 | 3300042125 | Ga0450923_008272 | Ga0450923_008272_126_1328 | 394 |
| 123 | 3300042147 | Ga0450910_006263 | Ga0450910_006263_416_1618 | 394 |
| 124 | 3300042185 | Ga0450909_009847 | Ga0450909_009847_69_1271 | 394 |
| 125 | 3300044656 | Ga0466969_0039151 | Ga0466969_0039151_33_1253 | 394 |
| 126 | 3300044666 | Ga0466977_0012394 | Ga0466977_0012394_180_1400 | 394 |
| 127 | 3300044671 | Ga0466978_0092923 | Ga0466978_0092923_67_1287 | 394 |
| 128 | 3300044683 | Ga0466965_0077464 | Ga0466965_0077464_97_1329 | 394 |
| 129 | 3300044684 | Ga0466966_0134799 | Ga0466966_0134799_188_1420 | 394 |
| 130 | 3300044693 | Ga0466961_0038754 | Ga0466961_0038754_99_1331 | 394 |
| 131 | 3300044765 | Ga0466970_0026209 | Ga0466970_0026209_1644_2864 | 394 |
| 132 | 3300044765 | Ga0466970_0114889 | Ga0466970_0114889_71_1303 | 394 |
| 133 | 3300044842 | Ga0466957_0065157 | Ga0466957_0065157_209_1441 | 394 |
| 134 | 3300044842 | Ga0466957_0126570 | Ga0466957_0126570_78_1298 | 394 |
| 135 | 3300044842 | Ga0466957_0149473 | Ga0466957_0149473_173_1393 | 394 |
| 136 | 3300045049 | Ga0466959_0173109 | Ga0466959_0173109_126_1358 | 394 |
| 137 | 3300045049 | Ga0466959_0174701 | Ga0466959_0174701_38_1258 | 394 |
| 138 | 3300045976 | Ga0466967_0398604 | Ga0466967_0398604_10_1230 | 394 |
| 139 | 3300046458 | Ga0495591_000075 | Ga0495591_000075_59094_60299 | 394 |
| 140 | 3300046460 | Ga0495638_0113024 | Ga0495638_0113024_186_1406 | 394 |
| 141 | 3300046463 | Ga0495653_0179706 | Ga0495653_0179706_177_1430 | 394 |
| 142 | 3300046491 | Ga0495584_0002569 | Ga0495584_0002569_3195_4415 | 394 |
| 143 | 3300046492 | Ga0495585_0005698 | Ga0495585_0005698_258_1478 | 394 |
| 144 | 3300046524 | Ga0495648_0134603 | Ga0495648_0134603_63_1283 | 394 |
| 145 | 3300046530 | Ga0495654_0062022 | Ga0495654_0062022_106_1326 | 394 |
| 146 | 3300046538 | Ga0495609_0001470 | Ga0495609_0001470_1744_2964 | 394 |
| 147 | 3300046542 | Ga0495597_0011420 | Ga0495597_0011420_2209_3429 | 394 |
| 148 | 3300046664 | Ga0495659_0000001 | Ga0495659_0000001_107995_109215 | 394 |
| 149 | 3300046694 | Ga0495649_0090203 | Ga0495649_0090203_267_1487 | 394 |
| 150 | 3300047472 | Ga0495686_0088972 | Ga0495686_0088972_536_1756 | 394 |
| 151 | 3300048088 | Ga0495602_0216398 | Ga0495602_0216398_211_1431 | 394 |
| 152 | 3300048924 | Ga0496121_0006314 | Ga0496121_0006314_8743_9963 | 394 |
| 153 | 3300049568 | Ga0501031_0145681 | Ga0501031_0145681_73_1293 | 394 |
| 154 | 3300049569 | Ga0501032_0024498 | Ga0501032_0024498_2625_3845 | 394 |
| 155 | 3300049571 | Ga0501034_0000178 | Ga0501034_0000178_1338_2558 | 394 |
| 156 | 3300049572 | Ga0501036_0042898 | Ga0501036_0042898_2300_3520 | 394 |
| 157 | 3300049576 | Ga0501040_0136434 | Ga0501040_0136434_157_1377 | 394 |
| 158 | 3300049578 | Ga0501042_0053958 | Ga0501042_0053958_10_1230 | 394 |
| 159 | 3300049580 | Ga0501046_0231084 | Ga0501046_0231084_108_1328 | 394 |
| 160 | 3300049582 | Ga0501048_0034755 | Ga0501048_0034755_346_1566 | 394 |
| 161 | 3300049583 | Ga0501067_0003594 | Ga0501067_0003594_17_1237 | 394 |
| 162 | 3300049585 | Ga0501069_0082531 | Ga0501069_0082531_563_1783 | 394 |
| 163 | 3300049587 | Ga0501071_0088899 | Ga0501071_0088899_19_1239 | 394 |
| 164 | 3300049588 | Ga0501072_0032635 | Ga0501072_0032635_2844_4064 | 394 |
| 165 | 3300049590 | Ga0501074_0022222 | Ga0501074_0022222_34_1254 | 394 |
| 166 | 3300049591 | Ga0501075_0086468 | Ga0501075_0086468_365_1585 | 394 |
| 167 | 3300049592 | Ga0501076_0108362 | Ga0501076_0108362_925_2145 | 394 |
| 168 | 3300049742 | Ga0501080_0362557 | Ga0501080_0362557_11_1231 | 394 |
| 169 | 3300049743 | Ga0501081_0064741 | Ga0501081_0064741_357_1577 | 394 |
| 170 | 3300049744 | Ga0501083_0041143 | Ga0501083_0041143_1712_2932 | 394 |
| 171 | 3300049824 | Ga0501045_0235962 | Ga0501045_0235962_109_1329 | 394 |
| 172 | 3300054114 | Ga0501084_0305575 | Ga0501084_0305575_100_1320 | 394 |
| 173 | 3300060353 | Ga0501082_0003876 | Ga0501082_0003876_576_1796 | 394 |
| 174 | 3300061734 | Ga0530510_0024692 | Ga0530510_0024692_2291_3511 | 394 |
| 175 | iso_pu_bacteria | 2519103095 | 2519458970 | 394 |
| 176 | iso_pu_bacteria | 2519103095 | 2519459592 | 394 |
| 177 | iso_pu_bacteria | 2738541280 | 2738743039 | 394 |
| 178 | iso_pu_bacteria | 2816332253 | 2817260485 | 394 |
| 179 | iso_pu_bacteria | 2816332253 | 2817262532 | 394 |
| 180 | iso_pu_bacteria | 2816332256 | 2817277974 | 394 |
| 181 | iso_pu_bacteria | 2816332256 | 2817279371 | 394 |
| 182 | iso_pu_bacteria | 2816332256 | 2817280779 | 394 |
| 183 | iso_pu_bacteria | 2816332286 | 2817456011 | 394 |
| 184 | iso_pu_bacteria | 2857537821 | 2857542778 | 394 |
| 185 | iso_pu_bacteria | 2870068957 | 2870069171 | 394 |
| 186 | iso_pu_bacteria | 2870068957 | 2870071816 | 394 |
| 187 | iso_pu_bacteria | 2870068957 | 2870077169 | 394 |
| 188 | iso_pu_bacteria | 2885266251 | 2885269179 | 394 |
| 189 | iso_pu_bacteria | 2885266251 | 2885270868 | 394 |
| 190 | iso_pu_bacteria | 644736347 | 644748697 | 394 |
| 191 | iso_pu_bacteria | 644736347 | 644749549 | 394 |
| 192 | iso_pu_bacteria | 644736347 | 644749695 | 394 |
| 193 | iso_pu_bacteria | 644736347 | 644749782 | 394 |
| 194 | iso_pu_bacteria | 644736347 | 644749792 | 394 |
| 195 | iso_pu_bacteria | 644736347 | 644749799 | 394 |
| 196 | iso_pu_bacteria | 644736347 | 644749994 | 394 |
| 197 | iso_pu_bacteria | 8020807995 | 8020809176 | 394 |
| 198 | iso_pu_bacteria | 8040167225 | 8040169074 | 394 |
| 199 | iso_pu_bacteria | 8040173305 | 8040173319 | 394 |
| 200 | 3300028800 | Ga0265338_10179401 | Ga0265338_101794012 | 395 |
| 201 | 3300031249 | Ga0265339_10096187 | Ga0265339_100961871 | 395 |
| 202 | 3300031712 | Ga0265342_10107136 | Ga0265342_101071362 | 395 |
| 203 | 3300039447 | Ga0436361_0034387 | Ga0436361_0034387_516_1730 | 395 |
| 204 | 3300005467 | Ga0070706_100240727 | Ga0070706_1002407271 | 396 |
| 205 | 3300005468 | Ga0070707_100347142 | Ga0070707_1003471422 | 396 |
| 206 | iso_pu_bacteria | 2895525241 | 2895526871 | 396 |
| 207 | 3300005467 | Ga0070706_100239598 | Ga0070706_1002395981 | 398 |
| 208 | 3300005471 | Ga0070698_100071501 | Ga0070698_1000715015 | 398 |
| 209 | 3300005518 | Ga0070699_100215963 | Ga0070699_1002159632 | 398 |
| 210 | 3300005530 | Ga0070679_100167261 | Ga0070679_1001672611 | 398 |
| 211 | 3300025910 | Ga0207684_10273375 | Ga0207684_102733751 | 398 |
| 212 | 3300028800 | Ga0265338_10094648 | Ga0265338_100946481 | 398 |
| 213 | 3300036401 | Ga0373937_0295947 | Ga0373937_0295947_165_1397 | 398 |
| 214 | 3300046663 | Ga0495635_0098623 | Ga0495635_0098623_444_1676 | 398 |
| 215 | 3300047322 | Ga0495680_0038924 | Ga0495680_0038924_1268_2500 | 398 |
| 216 | 3300049585 | Ga0501069_0106259 | Ga0501069_0106259_163_1410 | 398 |
| 217 | 3300049588 | Ga0501072_0182620 | Ga0501072_0182620_48_1295 | 398 |
| 218 | 3300049744 | Ga0501083_0066127 | Ga0501083_0066127_643_1890 | 398 |
| 219 | 3300053085 | Ga0495619_0076155 | Ga0495619_0076155_547_1779 | 398 |
| 220 | 3300060353 | Ga0501082_0255287 | Ga0501082_0255287_197_1444 | 398 |
| 221 | 3300005435 | Ga0070714_100237701 | Ga0070714_1002377011 | 399 |
| 222 | 3300005563 | Ga0068855_100226418 | Ga0068855_1002264182 | 399 |
| 223 | 3300009093 | Ga0105240_10301660 | Ga0105240_103016601 | 399 |
| 224 | 3300009551 | Ga0105238_10252815 | Ga0105238_102528151 | 399 |
| 225 | 3300025913 | Ga0207695_10215168 | Ga0207695_102151681 | 399 |
| 226 | 3300025924 | Ga0207694_10280272 | Ga0207694_102802721 | 399 |
| 227 | 3300025949 | Ga0207667_10205217 | Ga0207667_102052171 | 399 |
| 228 | 3300026142 | Ga0207698_10370781 | Ga0207698_103707811 | 399 |
| 229 | 3300037312 | Ga0395899_0208154 | Ga0395899_0208154_102_1340 | 399 |
| 230 | 3300037418 | Ga0395900_0113539 | Ga0395900_0113539_1387_2625 | 399 |
| 231 | 3300037466 | Ga0395898_0222760 | Ga0395898_0222760_445_1683 | 399 |
| 232 | 3300037471 | Ga0395905_0014429 | Ga0395905_0014429_6198_7436 | 399 |
| 233 | 3300038443 | Ga0395901_0327099 | Ga0395901_0327099_235_1473 | 399 |
| 234 | 3300001904 | JGI24736J21556_1003077 | JGI24736J21556_10030772 | 400 |
| 235 | 3300001915 | JGI24741J21665_1003993 | JGI24741J21665_10039933 | 400 |
| 236 | 3300001977 | JGI24746J21847_1007798 | JGI24746J21847_10077981 | 400 |
| 237 | 3300001979 | JGI24740J21852_10005697 | JGI24740J21852_100056972 | 400 |
| 238 | 3300001989 | JGI24739J22299_10030441 | JGI24739J22299_100304412 | 400 |
| 239 | 3300002074 | JGI24748J21848_1006516 | JGI24748J21848_10065161 | 400 |
| 240 | 3300002126 | JGI24035J26624_1004702 | JGI24035J26624_10047021 | 400 |
| 241 | 3300002244 | JGI24742J22300_10014209 | JGI24742J22300_100142091 | 400 |
| 242 | 3300003784 | Ga0055534_1011259 | Ga0055534_10112592 | 400 |
| 243 | 3300003784 | Ga0055534_1013189 | Ga0055534_10131892 | 400 |
| 244 | 3300003784 | Ga0055534_1015036 | Ga0055534_10150361 | 400 |
| 245 | 3300005289 | Ga0065704_10002840 | Ga0065704_100028407 | 400 |
| 246 | 3300005327 | Ga0070658_10207023 | Ga0070658_102070232 | 400 |
| 247 | 3300005327 | Ga0070658_10300036 | Ga0070658_103000361 | 400 |
| 248 | 3300005333 | Ga0070677_10070710 | Ga0070677_100707101 | 400 |
| 249 | 3300005334 | Ga0068869_100013257 | Ga0068869_1000132572 | 400 |
| 250 | 3300005336 | Ga0070680_100278896 | Ga0070680_1002788961 | 400 |
| 251 | 3300005338 | Ga0068868_100277062 | Ga0068868_1002770622 | 400 |
| 252 | 3300005339 | Ga0070660_100257774 | Ga0070660_1002577741 | 400 |
| 253 | 3300005340 | Ga0070689_100223056 | Ga0070689_1002230561 | 400 |
| 254 | 3300005347 | Ga0070668_100174620 | Ga0070668_1001746201 | 400 |
| 255 | 3300005354 | Ga0070675_100296080 | Ga0070675_1002960801 | 400 |
| 256 | 3300005356 | Ga0070674_100038817 | Ga0070674_1000388174 | 400 |
| 257 | 3300005356 | Ga0070674_100121535 | Ga0070674_1001215352 | 400 |
| 258 | 3300005434 | Ga0070709_10019706 | Ga0070709_100197062 | 400 |
| 259 | 3300005441 | Ga0070700_100026825 | Ga0070700_1000268253 | 400 |
| 260 | 3300005444 | Ga0070694_100016863 | Ga0070694_1000168632 | 400 |
| 261 | 3300005444 | Ga0070694_100074816 | Ga0070694_1000748162 | 400 |
| 262 | 3300005456 | Ga0070678_100231909 | Ga0070678_1002319092 | 400 |
| 263 | 3300005456 | Ga0070678_100233205 | Ga0070678_1002332051 | 400 |
| 264 | 3300005459 | Ga0068867_100019504 | Ga0068867_1000195042 | 400 |
| 265 | 3300005535 | Ga0070684_100113122 | Ga0070684_1001131222 | 400 |
| 266 | 3300005539 | Ga0068853_100080982 | Ga0068853_1000809822 | 400 |
| 267 | 3300005545 | Ga0070695_100084880 | Ga0070695_1000848802 | 400 |
| 268 | 3300005545 | Ga0070695_100096378 | Ga0070695_1000963782 | 400 |
| 269 | 3300005563 | Ga0068855_100139374 | Ga0068855_1001393741 | 400 |
| 270 | 3300005578 | Ga0068854_100049908 | Ga0068854_1000499083 | 400 |
| 271 | 3300005617 | Ga0068859_100392836 | Ga0068859_1003928362 | 400 |
| 272 | 3300005719 | Ga0068861_100258628 | Ga0068861_1002586281 | 400 |
| 273 | 3300005840 | Ga0068870_10133728 | Ga0068870_101337281 | 400 |
| 274 | 3300005842 | Ga0068858_100223896 | Ga0068858_1002238961 | 400 |
| 275 | 3300005937 | Ga0081455_10018449 | Ga0081455_100184494 | 400 |
| 276 | 3300005985 | Ga0081539_10088043 | Ga0081539_100880432 | 400 |
| 277 | 3300006237 | Ga0097621_100302424 | Ga0097621_1003024241 | 400 |
| 278 | 3300006881 | Ga0068865_100048193 | Ga0068865_1000481934 | 400 |
| 279 | 3300006931 | Ga0097620_100392864 | Ga0097620_1003928642 | 400 |
| 280 | 3300009094 | Ga0111539_10458091 | Ga0111539_104580912 | 400 |
| 281 | 3300009176 | Ga0105242_10327055 | Ga0105242_103270551 | 400 |
| 282 | 3300009545 | Ga0105237_10191931 | Ga0105237_101919312 | 400 |
| 283 | 3300009551 | Ga0105238_10224744 | Ga0105238_102247442 | 400 |
| 284 | 3300013059 | Ga0154012_145278 | Ga0154012_1452781 | 400 |
| 285 | 3300013307 | Ga0157372_10249261 | Ga0157372_102492613 | 400 |
| 286 | 3300013307 | Ga0157372_10416765 | Ga0157372_104167651 | 400 |
| 287 | 3300014325 | Ga0163163_10270075 | Ga0163163_102700752 | 400 |
| 288 | 3300014326 | Ga0157380_10281676 | Ga0157380_102816761 | 400 |
| 289 | 3300020069 | Ga0197907_10910350 | Ga0197907_109103502 | 400 |
| 290 | 3300020077 | Ga0206351_10326828 | Ga0206351_103268283 | 400 |
| 291 | 3300020078 | Ga0206352_10393391 | Ga0206352_103933912 | 400 |
| 292 | 3300020080 | Ga0206350_10214115 | Ga0206350_102141151 | 400 |
| 293 | 3300021384 | Ga0213876_10070055 | Ga0213876_100700552 | 400 |
| 294 | 3300022467 | Ga0224712_10001108 | Ga0224712_100011081 | 400 |
| 295 | 3300025254 | Ga0209148_1012158 | Ga0209148_10121581 | 400 |
| 296 | 3300025263 | Ga0209565_1018131 | Ga0209565_10181312 | 400 |
| 297 | 3300025272 | Ga0209455_1016183 | Ga0209455_10161832 | 400 |
| 298 | 3300025273 | Ga0209673_1030295 | Ga0209673_10302951 | 400 |
| 299 | 3300025290 | Ga0207673_1003312 | Ga0207673_10033121 | 400 |
| 300 | 3300025291 | Ga0209675_1010149 | Ga0209675_10101491 | 400 |
| 301 | 3300025321 | Ga0207656_10024119 | Ga0207656_100241192 | 400 |
| 302 | 3300025893 | Ga0207682_10022863 | Ga0207682_100228631 | 400 |
| 303 | 3300025901 | Ga0207688_10041638 | Ga0207688_100416382 | 400 |
| 304 | 3300025903 | Ga0207680_10059697 | Ga0207680_100596971 | 400 |
| 305 | 3300025907 | Ga0207645_10078105 | Ga0207645_100781051 | 400 |
| 306 | 3300025909 | Ga0207705_10167400 | Ga0207705_101674002 | 400 |
| 307 | 3300025910 | Ga0207684_10106845 | Ga0207684_101068451 | 400 |
| 308 | 3300025911 | Ga0207654_10186142 | Ga0207654_101861421 | 400 |
| 309 | 3300025914 | Ga0207671_10114918 | Ga0207671_101149182 | 400 |
| 310 | 3300025923 | Ga0207681_10059315 | Ga0207681_100593154 | 400 |
| 311 | 3300025924 | Ga0207694_10128099 | Ga0207694_101280993 | 400 |
| 312 | 3300025924 | Ga0207694_10202776 | Ga0207694_102027762 | 400 |
| 313 | 3300025925 | Ga0207650_10076282 | Ga0207650_100762823 | 400 |
| 314 | 3300025925 | Ga0207650_10286949 | Ga0207650_102869491 | 400 |
| 315 | 3300025926 | Ga0207659_10265017 | Ga0207659_102650171 | 400 |
| 316 | 3300025929 | Ga0207664_10103489 | Ga0207664_101034892 | 400 |
| 317 | 3300025933 | Ga0207706_10041546 | Ga0207706_100415463 | 400 |
| 318 | 3300025933 | Ga0207706_10120232 | Ga0207706_101202322 | 400 |
| 319 | 3300025933 | Ga0207706_10150085 | Ga0207706_101500852 | 400 |
| 320 | 3300025934 | Ga0207686_10215305 | Ga0207686_102153052 | 400 |
| 321 | 3300025934 | Ga0207686_10229374 | Ga0207686_102293741 | 400 |
| 322 | 3300025935 | Ga0207709_10247288 | Ga0207709_102472881 | 400 |
| 323 | 3300025936 | Ga0207670_10204961 | Ga0207670_102049611 | 400 |
| 324 | 3300025937 | Ga0207669_10094954 | Ga0207669_100949541 | 400 |
| 325 | 3300025938 | Ga0207704_10174915 | Ga0207704_101749152 | 400 |
| 326 | 3300025938 | Ga0207704_10244502 | Ga0207704_102445021 | 400 |
| 327 | 3300025942 | Ga0207689_10082740 | Ga0207689_100827402 | 400 |
| 328 | 3300025944 | Ga0207661_10286850 | Ga0207661_102868502 | 400 |
| 329 | 3300025945 | Ga0207679_10027414 | Ga0207679_100274144 | 400 |
| 330 | 3300025949 | Ga0207667_10264113 | Ga0207667_102641132 | 400 |
| 331 | 3300025949 | Ga0207667_10294265 | Ga0207667_102942652 | 400 |
| 332 | 3300025960 | Ga0207651_10051443 | Ga0207651_100514431 | 400 |
| 333 | 3300025972 | Ga0207668_10265629 | Ga0207668_102656291 | 400 |
| 334 | 3300025981 | Ga0207640_10126809 | Ga0207640_101268092 | 400 |
| 335 | 3300025986 | Ga0207658_10314106 | Ga0207658_103141061 | 400 |
| 336 | 3300026023 | Ga0207677_10280568 | Ga0207677_102805681 | 400 |
| 337 | 3300026035 | Ga0207703_10143847 | Ga0207703_101438471 | 400 |
| 338 | 3300026075 | Ga0207708_10031041 | Ga0207708_100310412 | 400 |
| 339 | 3300026078 | Ga0207702_10078604 | Ga0207702_100786043 | 400 |
| 340 | 3300026089 | Ga0207648_10105483 | Ga0207648_101054831 | 400 |
| 341 | 3300026095 | Ga0207676_10045651 | Ga0207676_100456511 | 400 |
| 342 | 3300026116 | Ga0207674_10252861 | Ga0207674_102528612 | 400 |
| 343 | 3300026118 | Ga0207675_100139170 | Ga0207675_1001391702 | 400 |
| 344 | 3300026118 | Ga0207675_100339544 | Ga0207675_1003395442 | 400 |
| 345 | 3300026121 | Ga0207683_10202125 | Ga0207683_102021251 | 400 |
| 346 | 3300026142 | Ga0207698_10000358 | Ga0207698_1000035827 | 400 |
| 347 | 3300027682 | Ga0209971_1026211 | Ga0209971_10262111 | 400 |
| 348 | 3300027876 | Ga0209974_10026570 | Ga0209974_100265702 | 400 |
| 349 | 3300028379 | Ga0268266_10190880 | Ga0268266_101908801 | 400 |
| 350 | 3300028379 | Ga0268266_10307868 | Ga0268266_103078682 | 400 |
| 351 | 3300031242 | Ga0265329_10046864 | Ga0265329_100468641 | 400 |
| 352 | 3300031344 | Ga0265316_10203550 | Ga0265316_102035501 | 400 |
| 353 | 3300031548 | Ga0307408_100102408 | Ga0307408_1001024082 | 400 |
| 354 | 3300031649 | Ga0307514_10174201 | Ga0307514_101742011 | 400 |
| 355 | 3300031711 | Ga0265314_10131843 | Ga0265314_101318431 | 400 |
| 356 | 3300031731 | Ga0307405_10044088 | Ga0307405_100440883 | 400 |
| 357 | 3300031731 | Ga0307405_10219245 | Ga0307405_102192451 | 400 |
| 358 | 3300031852 | Ga0307410_10154212 | Ga0307410_101542121 | 400 |
| 359 | 3300032002 | Ga0307416_100205750 | Ga0307416_1002057502 | 400 |
| 360 | 3300032004 | Ga0307414_10003263 | Ga0307414_100032638 | 400 |
| 361 | 3300032005 | Ga0307411_10000112 | Ga0307411_1000011218 | 400 |
| 362 | 3300036401 | Ga0373937_0210463 | Ga0373937_0210463_596_1798 | 400 |
| 363 | 3300037312 | Ga0395899_0212304 | Ga0395899_0212304_22_1224 | 400 |
| 364 | 3300037418 | Ga0395900_0287347 | Ga0395900_0287347_24_1226 | 400 |
| 365 | 3300037466 | Ga0395898_0252072 | Ga0395898_0252072_325_1527 | 400 |
| 366 | 3300038443 | Ga0395901_0364879 | Ga0395901_0364879_155_1357 | 400 |
| 367 | 3300039437 | Ga0436365_0027044 | Ga0436365_0027044_244_1446 | 400 |
| 368 | 3300042007 | Ga0439449_0037367 | Ga0439449_0037367_346_1548 | 400 |
| 369 | 3300042010 | Ga0439452_018624 | Ga0439452_018624_248_1450 | 400 |
| 370 | 3300042142 | Ga0450905_004617 | Ga0450905_004617_474_1676 | 400 |
| 371 | 3300042876 | Ga0451577_0075335 | Ga0451577_0075335_114_1337 | 400 |
| 372 | 3300044658 | Ga0466972_0050111 | Ga0466972_0050111_252_1454 | 400 |
| 373 | 3300044683 | Ga0466965_0049646 | Ga0466965_0049646_325_1527 | 400 |
| 374 | 3300044683 | Ga0466965_0098877 | Ga0466965_0098877_215_1441 | 400 |
| 375 | 3300044712 | Ga0453684_0099939 | Ga0453684_0099939_763_2022 | 400 |
| 376 | 3300044765 | Ga0466970_0018013 | Ga0466970_0018013_128_1354 | 400 |
| 377 | 3300044765 | Ga0466970_0082052 | Ga0466970_0082052_135_1337 | 400 |
| 378 | 3300044842 | Ga0466957_0016688 | Ga0466957_0016688_1596_2798 | 400 |
| 379 | 3300045049 | Ga0466959_0004884 | Ga0466959_0004884_1807_3009 | 400 |
| 380 | 3300045976 | Ga0466967_0208971 | Ga0466967_0208971_241_1464 | 400 |
| 381 | 3300046455 | Ga0495603_0160390 | Ga0495603_0160390_39_1259 | 400 |
| 382 | 3300046462 | Ga0495651_0181074 | Ga0495651_0181074_217_1419 | 400 |
| 383 | 3300046472 | Ga0495580_0156565 | Ga0495580_0156565_258_1478 | 400 |
| 384 | 3300046515 | Ga0495620_0035828 | Ga0495620_0035828_249_1535 | 400 |
| 385 | 3300046525 | Ga0495663_0030032 | Ga0495663_0030032_143_1429 | 400 |
| 386 | 3300046536 | Ga0495587_0136906 | Ga0495587_0136906_24_1226 | 400 |
| 387 | 3300046539 | Ga0495621_0043499 | Ga0495621_0043499_85_1371 | 400 |
| 388 | 3300046543 | Ga0495645_0172525 | Ga0495645_0172525_236_1438 | 400 |
| 389 | 3300046675 | Ga0495657_0149560 | Ga0495657_0149560_40_1242 | 400 |
| 390 | 3300046678 | Ga0495599_0138076 | Ga0495599_0138076_103_1305 | 400 |
| 391 | 3300046684 | Ga0495669_0045760 | Ga0495669_0045760_588_1874 | 400 |
| 392 | 3300046809 | Ga0495600_0070645 | Ga0495600_0070645_603_1805 | 400 |
| 393 | 3300047322 | Ga0495680_0223136 | Ga0495680_0223136_109_1311 | 400 |
| 394 | 3300048905 | Ga0496102_0143468 | Ga0496102_0143468_1002_2210 | 400 |
| 395 | 3300048922 | Ga0496119_0122643 | Ga0496119_0122643_163_1365 | 400 |
| 396 | 3300048929 | Ga0496126_0153789 | Ga0496126_0153789_571_1773 | 400 |
| 397 | 3300049568 | Ga0501031_0081473 | Ga0501031_0081473_465_1667 | 400 |
| 398 | 3300049568 | Ga0501031_0166932 | Ga0501031_0166932_123_1325 | 400 |
| 399 | 3300049569 | Ga0501032_0162851 | Ga0501032_0162851_103_1305 | 400 |
| 400 | 3300049570 | Ga0501033_0065039 | Ga0501033_0065039_195_1397 | 400 |
| 401 | 3300049570 | Ga0501033_0074161 | Ga0501033_0074161_694_1896 | 400 |
| 402 | 3300049570 | Ga0501033_0172185 | Ga0501033_0172185_210_1412 | 400 |
| 403 | 3300049571 | Ga0501034_0107658 | Ga0501034_0107658_1009_2211 | 400 |
| 404 | 3300049572 | Ga0501036_0074432 | Ga0501036_0074432_97_1299 | 400 |
| 405 | 3300049572 | Ga0501036_0245082 | Ga0501036_0245082_88_1290 | 400 |
| 406 | 3300049573 | Ga0501037_0078962 | Ga0501037_0078962_46_1248 | 400 |
| 407 | 3300049573 | Ga0501037_0124295 | Ga0501037_0124295_525_1727 | 400 |
| 408 | 3300049573 | Ga0501037_0202925 | Ga0501037_0202925_44_1246 | 400 |
| 409 | 3300049574 | Ga0501038_0148101 | Ga0501038_0148101_396_1742 | 400 |
| 410 | 3300049574 | Ga0501038_0249852 | Ga0501038_0249852_77_1300 | 400 |
| 411 | 3300049574 | Ga0501038_0265311 | Ga0501038_0265311_124_1326 | 400 |
| 412 | 3300049575 | Ga0501039_0221233 | Ga0501039_0221233_168_1370 | 400 |
| 413 | 3300049575 | Ga0501039_0221836 | Ga0501039_0221836_184_1407 | 400 |
| 414 | 3300049576 | Ga0501040_0208044 | Ga0501040_0208044_147_1370 | 400 |
| 415 | 3300049579 | Ga0501043_0253650 | Ga0501043_0253650_132_1334 | 400 |
| 416 | 3300049580 | Ga0501046_0029041 | Ga0501046_0029041_3162_4364 | 400 |
| 417 | 3300049580 | Ga0501046_0198495 | Ga0501046_0198495_85_1308 | 400 |
| 418 | 3300049580 | Ga0501046_0233385 | Ga0501046_0233385_87_1289 | 400 |
| 419 | 3300049581 | Ga0501047_0035644 | Ga0501047_0035644_3157_4380 | 400 |
| 420 | 3300049581 | Ga0501047_0242941 | Ga0501047_0242941_108_1310 | 400 |
| 421 | 3300049582 | Ga0501048_0182527 | Ga0501048_0182527_160_1362 | 400 |
| 422 | 3300049583 | Ga0501067_0035203 | Ga0501067_0035203_1132_2412 | 400 |
| 423 | 3300049583 | Ga0501067_0067251 | Ga0501067_0067251_143_1345 | 400 |
| 424 | 3300049584 | Ga0501068_0118504 | Ga0501068_0118504_388_1590 | 400 |
| 425 | 3300049584 | Ga0501068_0187748 | Ga0501068_0187748_14_1216 | 400 |
| 426 | 3300049585 | Ga0501069_0165486 | Ga0501069_0165486_29_1231 | 400 |
| 427 | 3300049586 | Ga0501070_0016011 | Ga0501070_0016011_4078_5280 | 400 |
| 428 | 3300049586 | Ga0501070_0188565 | Ga0501070_0188565_245_1447 | 400 |
| 429 | 3300049588 | Ga0501072_0223251 | Ga0501072_0223251_110_1333 | 400 |
| 430 | 3300049590 | Ga0501074_0172703 | Ga0501074_0172703_211_1413 | 400 |
| 431 | 3300049590 | Ga0501074_0199128 | Ga0501074_0199128_192_1394 | 400 |
| 432 | 3300049590 | Ga0501074_0234688 | Ga0501074_0234688_79_1281 | 400 |
| 433 | 3300049592 | Ga0501076_0082124 | Ga0501076_0082124_1178_2401 | 400 |
| 434 | 3300049592 | Ga0501076_0182402 | Ga0501076_0182402_293_1666 | 400 |
| 435 | 3300049592 | Ga0501076_0265247 | Ga0501076_0265247_178_1380 | 400 |
| 436 | 3300049593 | Ga0501077_0060600 | Ga0501077_0060600_274_1476 | 400 |
| 437 | 3300049741 | Ga0501079_0195488 | Ga0501079_0195488_195_1418 | 400 |
| 438 | 3300049741 | Ga0501079_0287965 | Ga0501079_0287965_19_1221 | 400 |
| 439 | 3300049742 | Ga0501080_0188206 | Ga0501080_0188206_481_1683 | 400 |
| 440 | 3300049743 | Ga0501081_0000061 | Ga0501081_0000061_16712_17935 | 400 |
| 441 | 3300049744 | Ga0501083_0152383 | Ga0501083_0152383_287_1489 | 400 |
| 442 | 3300049822 | Ga0501035_0139726 | Ga0501035_0139726_483_1685 | 400 |
| 443 | 3300049822 | Ga0501035_0220494 | Ga0501035_0220494_114_1436 | 400 |
| 444 | 3300049823 | Ga0501044_0056645 | Ga0501044_0056645_1654_2856 | 400 |
| 445 | 3300049823 | Ga0501044_0149298 | Ga0501044_0149298_139_1341 | 400 |
| 446 | 3300053085 | Ga0495619_0203277 | Ga0495619_0203277_53_1255 | 400 |
| 447 | 3300054114 | Ga0501084_0255743 | Ga0501084_0255743_204_1406 | 400 |
| 448 | 3300061734 | Ga0530510_0191770 | Ga0530510_0191770_169_1392 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ivr-assembly1.cif.gz_B | crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 | 0.7384 | 197 | 228 |
| 4fw1-assembly1.cif.gz_B | crystal structure of two-domain rsv integrase covalently linked with dna | 0.6668 | 149 | 230 |
| 5y6i-assembly1.cif.gz_B | crystal structure of pseudomonas aeruginosa hmgr | 0.6457 | 101 | 147 |
| 8cty-assembly3.cif.gz_H-4 | 12-mer dna structure of exbim bound to rnase-h | 0.6361 | 148 | 216 |
| 1c0m-assembly1.cif.gz_A | crystal structure of rsv two-domain integrase | 0.6358 | 143 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LV62_47_129_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8365 | 183 | 237 | 3.30.420.10 |
| af_Q47718_102_174_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8188 | 149 | 183 | 3.30.420.10 |
| af_I1MFY3_263_357_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8039 | 152 | 237 | 3.30.420.10 |
| af_A0A1D6JGA3_259_353_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7713 | 152 | 237 | 3.30.420.10 |
| af_Q969U6_63_192_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7502 | 154 | 184 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A843TBM9-F1-model_v4 | Transposase IS204/IS1001/IS1096/IS1165 DDE domain-containing protein | 0.9768 | 154 | 231 |
|
| AF-N6WY91-F1-model_v4 | Transposase for insertion sequence element IS1001 | 0.9734 | 189 | 398 |
|
| AF-A0A829EMN6-F1-model_v4 | deleted | 0.9724 | 117 | 400 |
|
| AF-A0A2E2HTC5-F1-model_v4 | deleted | 0.9716 | 175 | 400 |
|
| AF-A0A2S4THX3-F1-model_v4 | deleted | 0.9707 | 170 | 400 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar