F446230

General Info

Members Datasets Scaffolds Average Seq Length
448 269 442 325

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0050875|Ga0495606_0050875_29_1102
Length 357
Sequence MADGTTLMAMTPRQFEARYEPVWAELEQGLNAFDAGKAGRRKPRRLKAGEFQTGTAPVAGAARVAQLYRQCCEHLALARERAYPVHLVARLEALTARAHQRIYRRHDFGLSALRDLVLWQAPAAVRALRWHLLVTVLVFVLPVLVVGIATWIDPHFALTVVDAKQVREFDHMYGQQAGEHLGRTSGDDWQMFGFYIMNNVGVSFRCFAAGLVLGIGSLFLVGYNXXXXGAVAGLLVTRGDSERFFSFVVTHSAFELTAIVLSGAAGLKLGHAVLAPGRLTRTQALMRAARETSPVVFCFVVMLFIAAAIEAFWSSAGWIAPGVKYAVGGGCWALVFAYLGLQGKGHDPHAQASGARP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
259 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
268 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 0
Rhizoplane 2.01
Rhizosphere 77.9
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1342649 2162886012 Unclassified 1488
2 JGI25156J39149_1000459 3300002705 Bacteria 24817
3 JGI25156J39149_1015169 3300002705 Bacteria 1553
4 JGI25154J39366_1002018 3300002738 Bacteria 5867
5 JGI25157J39369_1000021 3300002741 Bacteria 163907
6 JGI25406J46586_10000132 3300003203 Bacteria 32525
7 JGI25153J46596_10005556 3300003215 Bacteria 6590
8 JGI25153J46596_10008722 3300003215 Bacteria 4804
9 rootH1_10006787 3300003316 Bacteria 4568
10 rootH1_10045935 3300003316 Bacteria 2930
11 rootH2_10027008 3300003320 Bacteria 6630
12 rootH2_10039275 3300003320 Bacteria 5343
13 rootL2_10002895 3300003322 Bacteria 9207
14 rootH1_10025509 3300003323 Bacteria 6696
15 rootH1_10045185 3300003316 Bacteria 3066
16 rootH1_10045185 3300003323 Bacteria 2482
17 rootH1_10072118 3300003323 Bacteria 3937
18 rootH1_10181722 3300003323 Bacteria 2650
19 Ga0055539_1000588 3300003752 Bacteria 10143
20 Ga0055539_1000994 3300003752 Bacteria 6180
21 Ga0055533_1000033 3300003756 Bacteria 265716
22 Ga0055525_1001213 3300003759 Bacteria 5686
23 Ga0055526_1020064 3300003771 Bacteria 2400
24 Ga0065165_1013523 3300005262 Bacteria 3238
25 Ga0065707_10005231 3300005295 Bacteria 3372
26 Ga0065707_10107161 3300005295 Bacteria 2566
27 Ga0070658_10050523 3300005327 Bacteria 3370
28 Ga0070676_10079817 3300005328 Bacteria 1982
29 Ga0070690_100029503 3300005330 Bacteria 3403
30 Ga0070670_100023495 3300005331 Bacteria 5306
31 Ga0070670_100230891 3300005331 Bacteria 1610
32 Ga0068869_100136954 3300005334 Bacteria 1887
33 Ga0070666_10063122 3300005335 Unclassified 2511
34 Ga0070666_10114451 3300005335 Bacteria 1867
35 Ga0070680_100008305 3300005336 Bacteria 7944
36 Ga0070682_100013916 3300005337 Bacteria 4640
37 Ga0070660_100078004 3300005339 Bacteria 2597
38 Ga0070689_100001812 3300005340 Bacteria 13734
39 Ga0070689_100388626 3300005340 Bacteria 1177
40 Ga0070661_100203330 3300005344 Bacteria 1514
41 Ga0070692_10089590 3300005345 Unclassified 1670
42 Ga0070692_10106215 3300005345 Unclassified 1546
43 Ga0070668_100041165 3300005347 Bacteria 3540
44 Ga0070668_100429382 3300005347 Unclassified 1132
45 Ga0070669_100003380 3300005353 Bacteria 11478
46 Ga0070669_100009114 3300005353 Bacteria 7072
47 Ga0070669_100030346 3300005353 Bacteria 3901
48 Ga0070669_100039261 3300005353 Bacteria 3439
49 Ga0070675_100001947 3300005354 Bacteria 15292
50 Ga0070675_100045335 3300005354 Bacteria 3598
51 Ga0070674_100022200 3300005356 Bacteria 4090
52 Ga0070674_100180514 3300005356 Bacteria 1616
53 Ga0070673_100078677 3300005364 Bacteria 2668
54 Ga0070673_100176377 3300005364 Bacteria 1827
55 Ga0070688_100022761 3300005365 Bacteria 3678
56 Ga0070667_100004528 3300005367 Bacteria 11706
57 Ga0070703_10004647 3300005406 Bacteria 3843
58 Ga0070709_10016747 3300005434 Bacteria 4191
59 Ga0070710_10133360 3300005437 Bacteria 1516
60 Ga0070701_10085381 3300005438 Unclassified 1718
61 Ga0070705_100016375 3300005440 Bacteria 3852
62 Ga0070705_100125573 3300005440 Bacteria 1665
63 Ga0070700_100002005 3300005441 Bacteria 10342
64 Ga0070700_100013632 3300005441 Bacteria 4569
65 Ga0070694_100002546 3300005444 Bacteria 10764
66 Ga0070694_100002855 3300005444 Bacteria 10258
67 Ga0070708_100234292 3300005445 Bacteria 1723
68 Ga0070663_100281451 3300005455 Unclassified 1325
69 Ga0070662_100018289 3300005457 Bacteria 4739
70 Ga0070681_10000619 3300005458 Bacteria 29107
71 Ga0070681_10034568 3300005458 Bacteria 5075
72 Ga0070681_10092205 3300005458 Unclassified 2978
73 Ga0070681_10116266 3300005458 Bacteria 2612
74 Ga0068867_100009240 3300005459 Bacteria 6956
75 Ga0068867_100384794 3300005459 Bacteria 1179
76 Ga0070707_100043290 3300005468 Bacteria 4310
77 Ga0070707_100157598 3300005468 Bacteria 2212
78 Ga0070698_100073122 3300005471 Bacteria 3435
79 Ga0070698_100083197 3300005471 Bacteria 3191
80 Ga0070699_100020656 3300005518 Bacteria 5682
81 Ga0070699_100023658 3300005518 Bacteria 5293
82 Ga0070679_100001338 3300005530 Bacteria 21747
83 Ga0070679_100026654 3300005530 Bacteria 5682
84 Ga0068853_100110823 3300005539 Bacteria 2438
85 Ga0070672_100057979 3300005543 Bacteria 3041
86 Ga0070695_100141163 3300005545 Bacteria 1670
87 Ga0070696_100045341 3300005546 Bacteria 3046
88 Ga0070665_100003139 3300005548 Bacteria 17790
89 Ga0070665_100014302 3300005548 Bacteria 7969
90 Ga0070665_100019922 3300005548 Bacteria 6737
91 Ga0070665_100158618 3300005548 Unclassified 2264
92 Ga0070704_100002098 3300005549 Bacteria 11090
93 Ga0070704_100009713 3300005549 Bacteria 5832
94 Ga0068855_100000956 3300005563 Bacteria 35944
95 Ga0068855_100019714 3300005563 Bacteria 8099
96 Ga0068855_100066525 3300005563 Bacteria 4202
97 Ga0068855_100072067 3300005563 Bacteria 4016
98 Ga0068855_100229640 3300005563 Bacteria 2079
99 Ga0068855_100252710 3300005563 Bacteria 1966
100 Ga0068857_100003699 3300005577 Bacteria 12830
101 Ga0068857_100005113 3300005577 Bacteria 11156
102 Ga0068857_100010788 3300005577 Bacteria 7952
103 Ga0068856_100000887 3300005614 Bacteria 32039
104 Ga0068856_100120157 3300005614 Unclassified 2629
105 Ga0068856_100234697 3300005614 Bacteria 1850
106 Ga0068859_100001394 3300005617 Bacteria 24541
107 Ga0068859_100003913 3300005617 Bacteria 15203
108 Ga0068859_100010283 3300005617 Bacteria 9418
109 Ga0068859_100015503 3300005617 Bacteria 7658
110 Ga0068859_100110704 3300005617 Bacteria 2808
111 Ga0068859_100261831 3300005617 Unclassified 1821
112 Ga0068864_100017265 3300005618 Bacteria 6018
113 Ga0068861_100001582 3300005719 Bacteria 14478
114 Ga0068861_100041449 3300005719 Bacteria 3448
115 Ga0068870_10002226 3300005840 Bacteria 8048
116 Ga0068870_10122533 3300005840 Bacteria 1500
117 Ga0068863_100000916 3300005841 Bacteria 29618
118 Ga0068863_100010713 3300005841 Bacteria 8906
119 Ga0068858_100032803 3300005842 Unclassified 4823
120 Ga0068860_100000461 3300005843 Bacteria 51002
121 Ga0068860_100088587 3300005843 Bacteria 2946
122 Ga0068860_100099763 3300005843 Bacteria 2770
123 Ga0068862_100070665 3300005844 Bacteria 3014
124 Ga0068862_100284541 3300005844 Unclassified 1516
125 Ga0081539_10000047 3300005985 Bacteria 275235
126 Ga0081539_10016384 3300005985 Bacteria 5298
127 Ga0070717_10105793 3300006028 Bacteria 2395
128 Ga0075364_10137329 3300006051 Unclassified 1643
129 Ga0075367_10013904 3300006178 Bacteria 4343
130 Ga0075366_10014454 3300006195 Bacteria 4509
131 Ga0075370_10038903 3300006353 Bacteria 2678
132 Ga0068871_100012030 3300006358 Bacteria 6369
133 Ga0075428_100008577 3300006844 Bacteria 11337
134 Ga0075428_100039068 3300006844 Bacteria 5223
135 Ga0075428_100294706 3300006844 Bacteria 1744
136 Ga0075428_100359529 3300006844 Bacteria 1562
137 Ga0075431_100231799 3300006847 Bacteria 1881
138 Ga0075431_100247310 3300006847 Bacteria 1813
139 Ga0075433_10003035 3300006852 Bacteria 12898
140 Ga0075433_10014097 3300006852 Bacteria 6518
141 Ga0075433_10118366 3300006852 Unclassified 2351
142 Ga0075434_100019051 3300006871 Bacteria 6634
143 Ga0075429_100008449 3300006880 Bacteria 8961
144 Ga0075429_100120549 3300006880 Unclassified 2293
145 Ga0068865_100006952 3300006881 Bacteria 6939
146 Ga0075436_100023646 3300006914 Bacteria 4221
147 Ga0097620_100001394 3300006931 Bacteria 24541
148 Ga0097620_100003912 3300006931 Bacteria 15203
149 Ga0097620_100010283 3300006931 Bacteria 9418
150 Ga0097620_100015503 3300006931 Bacteria 7658
151 Ga0097620_100110706 3300006931 Bacteria 2808
152 Ga0097620_100261827 3300006931 Unclassified 1821
153 Ga0075435_100177143 3300007076 Bacteria 1801
154 Ga0099794_10015649 3300007265 Unclassified 3353
155 Ga0099795_10000018 3300007788 Bacteria 61029
156 Ga0099795_10000252 3300007788 Bacteria 9530
157 Ga0105240_10000921 3300009093 Bacteria 52415
158 Ga0105240_10010749 3300009093 Bacteria 12839
159 Ga0105240_10047072 3300009093 Bacteria 5459
160 Ga0105240_10070489 3300009093 Bacteria 4324
161 Ga0105240_10205219 3300009093 Unclassified 2307
162 Ga0105240_10216676 3300009093 Unclassified 2233
163 Ga0111539_10002499 3300009094 Bacteria 24388
164 Ga0111539_10005321 3300009094 Bacteria 16657
165 Ga0111539_10012708 3300009094 Bacteria 10545
166 Ga0111539_10024487 3300009094 Bacteria 7403
167 Ga0111539_10037800 3300009094 Bacteria 5826
168 Ga0111539_10102974 3300009094 Bacteria 3350
169 Ga0111539_10175640 3300009094 Unclassified 2502
170 Ga0105245_10003041 3300009098 Bacteria 15027
171 Ga0105247_10001835 3300009101 Bacteria 14877
172 Ga0105247_10114750 3300009101 Bacteria 1738
173 Ga0114129_10183832 3300009147 Bacteria 2843
174 Ga0105243_10434151 3300009148 Unclassified 1228
175 Ga0105242_10034361 3300009176 Unclassified 4064
176 Ga0105248_10008981 3300009177 Bacteria 10987
177 Ga0105248_10063684 3300009177 Bacteria 4139
178 Ga0105248_10287873 3300009177 Bacteria 1850
179 Ga0105237_10016231 3300009545 Bacteria 7744
180 Ga0105237_10059755 3300009545 Bacteria 3814
181 Ga0105237_10135233 3300009545 Bacteria 2460
182 Ga0105238_10002000 3300009551 Bacteria 20551
183 Ga0105238_10066889 3300009551 Bacteria 3594
184 Ga0105238_10073964 3300009551 Unclassified 3401
185 Ga0105238_10081982 3300009551 Unclassified 3216
186 Ga0105238_10300599 3300009551 Bacteria 1588
187 Ga0105249_10000719 3300009553 Bacteria 30139
188 Ga0105249_10017219 3300009553 Bacteria 6416
189 Ga0105249_10043759 3300009553 Bacteria 4073
190 Ga0105249_10117847 3300009553 Bacteria 2519
191 Ga0099796_10000048 3300010159 Bacteria 22808
192 Ga0099796_10000338 3300010159 Bacteria 7589
193 Ga0105239_10091683 3300010375 Bacteria 3353
194 Ga0157370_10000715 3300013104 Bacteria 41556
195 Ga0157369_10004931 3300013105 Bacteria 15632
196 Ga0157369_10095033 3300013105 Bacteria 3181
197 Ga0157374_10287964 3300013296 Bacteria 1623
198 Ga0163162_10254633 3300013306 Unclassified 1887
199 Ga0157372_10085056 3300013307 Bacteria 3587
200 Ga0157372_10141315 3300013307 Bacteria 2774
201 Ga0157375_10001087 3300013308 Bacteria 23575
202 Ga0157375_10221767 3300013308 Bacteria 2049
203 Ga0163163_10094044 3300014325 Unclassified 3015
204 Ga0157380_10007074 3300014326 Bacteria 7946
205 Ga0157380_10017083 3300014326 Bacteria 5364
206 Ga0157380_10051650 3300014326 Unclassified 3252
207 Ga0157380_10116856 3300014326 Unclassified 2252
208 Ga0157380_10160830 3300014326 Bacteria 1952
209 Ga0157377_10013920 3300014745 Bacteria 4082
210 Ga0157379_10007207 3300014968 Bacteria 9618
211 Ga0157376_10024319 3300014969 Bacteria 4753
212 Ga0209674_100064 3300025226 Bacteria 265769
213 Ga0209563_100126 3300025230 Bacteria 113122
214 Ga0207427_100197 3300025231 Bacteria 57629
215 Ga0209258_100736 3300025242 Bacteria 21300
216 Ga0207425_1000196 3300025245 Bacteria 48364
217 Ga0209646_1000060 3300025246 Bacteria 256386
218 Ga0209026_1000049 3300025250 Bacteria 255273
219 Ga0209677_100411 3300025253 Bacteria 25661
220 Ga0209677_100792 3300025253 Bacteria 15906
221 Ga0209677_101222 3300025253 Bacteria 11674
222 Ga0209759_1000069 3300025256 Bacteria 182437
223 Ga0209759_1001428 3300025256 Bacteria 13546
224 Ga0209759_1010561 3300025256 Bacteria 2697
225 Ga0209129_1000035 3300025258 Bacteria 329303
226 Ga0209455_1020628 3300025272 Bacteria 1299
227 Ga0209673_1006309 3300025273 Bacteria 5757
228 Ga0209673_1011658 3300025273 Bacteria 3607
229 Ga0209564_1000024 3300025295 Bacteria 535041
230 Ga0209758_1000558 3300025297 Bacteria 58712
231 Ga0209758_1001090 3300025297 Bacteria 35155
232 Ga0209050_1000266 3300025298 Bacteria 111792
233 Ga0209051_1001699 3300025303 Bacteria 17625
234 Ga0207682_10011444 3300025893 Unclassified 3464
235 Ga0207682_10030806 3300025893 Bacteria 2150
236 Ga0207710_10002258 3300025900 Bacteria 9018
237 Ga0207710_10027010 3300025900 Unclassified 2483
238 Ga0207645_10041034 3300025907 Bacteria 2963
239 Ga0207645_10099070 3300025907 Bacteria 1879
240 Ga0207645_10221465 3300025907 Unclassified 1247
241 Ga0207643_10005789 3300025908 Bacteria 6605
242 Ga0207643_10137522 3300025908 Unclassified 1457
243 Ga0207705_10032698 3300025909 Bacteria 3718
244 Ga0207705_10105128 3300025909 Bacteria 2081
245 Ga0207707_10000038 3300025912 Bacteria 143359
246 Ga0207707_10000748 3300025912 Bacteria 31991
247 Ga0207707_10046174 3300025912 Bacteria 3793
248 Ga0207707_10093988 3300025912 Bacteria 2619
249 Ga0207695_10014733 3300025913 Bacteria 9245
250 Ga0207695_10060273 3300025913 Bacteria 3929
251 Ga0207695_10093895 3300025913 Bacteria 3009
252 Ga0207671_10054640 3300025914 Bacteria 2958
253 Ga0207671_10093872 3300025914 Unclassified 2264
254 Ga0207660_10002433 3300025917 Bacteria 12227
255 Ga0207657_10137881 3300025919 Bacteria 1995
256 Ga0207649_10149942 3300025920 Bacteria 1605
257 Ga0207652_10003247 3300025921 Bacteria 13488
258 Ga0207652_10023299 3300025921 Bacteria 5128
259 Ga0207646_10089713 3300025922 Bacteria 2752
260 Ga0207681_10007259 3300025923 Bacteria 6793
261 Ga0207681_10019349 3300025923 Bacteria 4301
262 Ga0207681_10023200 3300025923 Bacteria 3966
263 Ga0207681_10065644 3300025923 Bacteria 2510
264 Ga0207694_10011678 3300025924 Bacteria 6624
265 Ga0207659_10000880 3300025926 Bacteria 17823
266 Ga0207659_10109537 3300025926 Bacteria 2097
267 Ga0207659_10126330 3300025926 Bacteria 1967
268 Ga0207687_10024283 3300025927 Unclassified 4048
269 Ga0207690_10011921 3300025932 Bacteria 5198
270 Ga0207706_10010502 3300025933 Bacteria 8463
271 Ga0207686_10046275 3300025934 Bacteria 2682
272 Ga0207709_10084703 3300025935 Bacteria 2053
273 Ga0207670_10001881 3300025936 Bacteria 10967
274 Ga0207704_10018000 3300025938 Bacteria 3678
275 Ga0207691_10020351 3300025940 Bacteria 6272
276 Ga0207691_10021260 3300025940 Bacteria 6129
277 Ga0207691_10039139 3300025940 Bacteria 4387
278 Ga0207711_10093873 3300025941 Unclassified 2643
279 Ga0207711_10112354 3300025941 Bacteria 2424
280 Ga0207689_10024068 3300025942 Bacteria 5108
281 Ga0207689_10355405 3300025942 Unclassified 1218
282 Ga0207667_10001779 3300025949 Bacteria 27124
283 Ga0207667_10009653 3300025949 Bacteria 11352
284 Ga0207667_10025177 3300025949 Bacteria 6520
285 Ga0207667_10033157 3300025949 Bacteria 5556
286 Ga0207667_10229822 3300025949 Bacteria 1900
287 Ga0207651_10015681 3300025960 Unclassified 4413
288 Ga0207712_10292580 3300025961 Bacteria 1333
289 Ga0207668_10225026 3300025972 Unclassified 1509
290 Ga0207640_10002657 3300025981 Bacteria 9569
291 Ga0207658_10008521 3300025986 Bacteria 6976
292 Ga0207703_10008128 3300026035 Bacteria 8292
293 Ga0207639_10088621 3300026041 Bacteria 2470
294 Ga0207708_10002329 3300026075 Bacteria 13948
295 Ga0207708_10066665 3300026075 Bacteria 2752
296 Ga0207708_10103959 3300026075 Bacteria 2200
297 Ga0207702_10002045 3300026078 Bacteria 19536
298 Ga0207641_10000311 3300026088 Bacteria 60657
299 Ga0207641_10005733 3300026088 Bacteria 10549
300 Ga0207648_10002268 3300026089 Bacteria 20815
301 Ga0207648_10025275 3300026089 Bacteria 5292
302 Ga0207648_10039740 3300026089 Bacteria 4136
303 Ga0207648_10063907 3300026089 Bacteria 3208
304 Ga0207648_10427844 3300026089 Bacteria 1203
305 Ga0207676_10030832 3300026095 Bacteria 4028
306 Ga0207674_10004373 3300026116 Bacteria 17040
307 Ga0207674_10011982 3300026116 Bacteria 9718
308 Ga0207675_100003206 3300026118 Bacteria 16048
309 Ga0207675_100010890 3300026118 Bacteria 8518
310 Ga0207675_100015521 3300026118 Bacteria 7104
311 Ga0207675_100096214 3300026118 Unclassified 2787
312 Ga0207675_100192012 3300026118 Bacteria 1959
313 Ga0207683_10084727 3300026121 Bacteria 2818
314 Ga0209179_1000007 3300027512 Bacteria 93732
315 Ga0209966_1021836 3300027695 Unclassified 1248
316 Ga0207428_10001170 3300027907 Bacteria 28244
317 Ga0207428_10006671 3300027907 Bacteria 10599
318 Ga0207428_10009690 3300027907 Bacteria 8631
319 Ga0207428_10026483 3300027907 Bacteria 4840
320 Ga0268266_10003279 3300028379 Bacteria 16282
321 Ga0268266_10041981 3300028379 Unclassified 3905
322 Ga0268266_10105359 3300028379 Bacteria 2491
323 Ga0268265_10000211 3300028380 Bacteria 68076
324 Ga0268265_10037578 3300028380 Bacteria 3555
325 Ga0268264_10000156 3300028381 Bacteria 155304
326 Ga0268264_10007763 3300028381 Bacteria 8934
327 Ga0268264_10033784 3300028381 Bacteria 4205
328 Ga0268264_10053673 3300028381 Bacteria 3363
329 Ga0265336_10000123 3300028666 Bacteria 57956
330 Ga0307515_10006740 3300028794 Bacteria 22865
331 Ga0265324_10000849 3300029957 Bacteria 19632
332 Ga0307511_10000577 3300030521 Bacteria 39246
333 Ga0307512_10016074 3300030522 Bacteria 6916
334 Ga0307513_10284987 3300031456 Bacteria 1427
335 Ga0307509_10184425 3300031507 Bacteria 1947
336 Ga0307516_10037859 3300031730 Bacteria 4818
337 Ga0307516_10168825 3300031730 Bacteria 1930
338 Ga0307405_10127731 3300031731 Bacteria 1751
339 Ga0307413_10051656 3300031824 Bacteria 2478
340 Ga0307407_10054182 3300031903 Bacteria 2312
341 Ga0307412_10024181 3300031911 Unclassified 3748
342 Ga0307411_10045474 3300032005 Unclassified 2824
343 Ga0307411_10138525 3300032005 Bacteria 1791
344 Ga0307411_10142827 3300032005 Bacteria 1767
345 Ga0307411_10203975 3300032005 Bacteria 1521
346 Ga0307510_10000011 3300033180 Bacteria 355464
347 Ga0307510_10056602 3300033180 Bacteria 4080
348 Ga0373934_0052994 3300035086 Unclassified 1609
349 Ga0373936_0023807 3300035113 Unclassified 2388
350 Ga0373931_0003056 3300035691 Bacteria 7481
351 Ga0373931_0140115 3300035691 Bacteria 1400
352 Ga0395898_0065381 3300037466 Bacteria 3526
353 Ga0395905_0071099 3300037471 Bacteria 3262
354 Ga0395905_0162921 3300037471 Bacteria 2096
355 Ga0395901_0034521 3300038443 Bacteria 5223
356 Ga0466969_0016885 3300044656 Bacteria 3816
357 Ga0466965_0002600 3300044683 Bacteria 7723
358 Ga0466966_0019979 3300044684 Bacteria 4406
359 Ga0466961_0018921 3300044693 Bacteria 4431
360 Ga0466964_0001494 3300044706 Bacteria 8019
361 Ga0466971_0022726 3300044719 Bacteria 2794
362 Ga0466970_0061857 3300044765 Bacteria 2006
363 Ga0466957_0003346 3300044842 Bacteria 8788
364 Ga0466957_0056280 3300044842 Unclassified 2405
365 Ga0466957_0131297 3300044842 Bacteria 1605
366 Ga0466959_0032992 3300045049 Bacteria 3831
367 Ga0451576_0024633 3300045051 Bacteria 6498
368 Ga0466967_0329896 3300045976 Bacteria 1473
369 Ga0495583_0000046 3300046506 Bacteria 218059
370 Ga0495606_0050875 3300046507 Bacteria 2706
371 Ga0495610_0050346 3300046512 Bacteria 2034
372 Ga0495632_0005894 3300046519 Bacteria 7998
373 Ga0495632_0053098 3300046519 Bacteria 1991
374 Ga0495632_0117303 3300046519 Bacteria 1246
375 Ga0495621_0000849 3300046539 Bacteria 7787
376 Ga0495621_0053906 3300046539 Unclassified 1445
377 Ga0495625_0003005 3300046660 Bacteria 17395
378 Ga0495625_0115354 3300046660 Bacteria 1833
379 Ga0495649_0000638 3300046694 Bacteria 28526
380 Ga0495589_0049019 3300046794 Bacteria 2090
381 Ga0495686_0004315 3300047472 Bacteria 11761
382 Ga0496102_0009432 3300048905 Bacteria 8383
383 Ga0496102_0068571 3300048905 Unclassified 3255
384 Ga0496104_0316248 3300048907 Bacteria 1474
385 Ga0496108_0254755 3300048911 Bacteria 1527
386 Ga0496109_0040768 3300048912 Bacteria 4206
387 Ga0496110_0005495 3300048913 Bacteria 9942
388 Ga0496112_0088952 3300048915 Unclassified 3056
389 Ga0496114_0265467 3300048917 Bacteria 1512
390 Ga0496115_0341955 3300048918 Unclassified 1221
391 Ga0496116_0022470 3300048919 Bacteria 4725
392 Ga0496117_0000067 3300048920 Bacteria 249348
393 Ga0496118_0000021 3300048921 Bacteria 444988
394 Ga0496119_0008780 3300048922 Bacteria 8805
395 Ga0496119_0016279 3300048922 Bacteria 5668
396 Ga0496120_0000042 3300048923 Bacteria 197055
397 Ga0496121_0000613 3300048924 Bacteria 66392
398 Ga0496121_0022338 3300048924 Bacteria 6145
399 Ga0496125_0000533 3300048928 Bacteria 65519
400 Ga0496125_0010262 3300048928 Bacteria 9485
401 Ga0496126_0125173 3300048929 Bacteria 2225
402 Ga0501048_0316173 3300049582 Unclassified 1112
403 Ga0501072_0297454 3300049588 Unclassified 1283
404 Ga0501075_0110753 3300049591 Unclassified 2087
405 Ga0501045_0166109 3300049824 Unclassified 1644
406 nmdc:mga00v17_1626_c1 3300050491 Bacteria 11752
407 nmdc:mga0k408_2439_c2 3300050493 Bacteria 6617
408 nmdc:mga0k408_30313_c2 3300050493 Bacteria 2256
409 nmdc:mga06z11_22007_c1 3300050494 Bacteria 2971
410 nmdc:mga07m45_18023_c1 3300050496 Bacteria 3803
411 nmdc:mga07m45_2073_c1 3300050496 Bacteria 9307
412 nmdc:mga05p37_729471_c1 3300050507 Unclassified 1096
413 nmdc:mga09592_230147_c1 3300050508 Unclassified 1606
414 nmdc:mga0qj67_42020_c1 3300050509 Unclassified 3598
415 nmdc:mga06r32_67394_c1 3300050510 Unclassified 3455
416 nmdc:mga08y16_12596_c1 3300050511 Bacteria 8896
417 nmdc:mga08y16_334150_c1 3300050511 Bacteria 1558
418 nmdc:mga08y16_3599_c1 3300050511 Bacteria 16089
419 nmdc:mga08y16_45244_c1 3300050511 Bacteria 4612
420 nmdc:mga08y16_8099_c1 3300050511 Bacteria 10990
421 nmdc:mga0n895_55558_c1 3300050512 Bacteria 3897
422 nmdc:mga0n895_63233_c1 3300050512 Unclassified 3659
423 nmdc:mga0rr50_8625_c1 3300050513 Bacteria 6353
424 nmdc:mga08x19_34073_c1 3300050514 Bacteria 3217
425 nmdc:mga0a205_136710_c1 3300050515 Unclassified 2351
426 nmdc:mga0a205_5674_c1 3300050515 Bacteria 11245
427 nmdc:mga0a205_9437_c1 3300050515 Bacteria 8919
428 Ga0500635_0000005 3300053080 Bacteria 187821
429 Ga0500578_0000057 3300053086 Bacteria 120178
430 Ga0500651_0082231 3300053093 Bacteria 1993
431 Ga0500569_024436 3300053109 Bacteria 1635
432 Ga0500623_052003 3300053127 Bacteria 2056
433 Ga0500652_005795 3300053131 Bacteria 3925
434 Ga0500559_0040930 3300053136 Unclassified 2019
435 Ga0500577_0004509 3300053142 Bacteria 3687
436 Ga0500616_0114883 3300053153 Bacteria 1295
437 Ga0500619_000179 3300053154 Bacteria 15172
438 Ga0500622_0000390 3300053156 Bacteria 42468
439 Ga0500637_0021091 3300053178 Unclassified 3536
440 Ga0500570_034175 3300053724 Bacteria 2719
441 Ga0500587_008717 3300053739 Bacteria 1302
442 Ga0590075_004988 3300059424 Unclassified 3138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025256 Ga0209759_1010561 Ga0209759_10105613 289
2 3300025907 Ga0207645_10041034 Ga0207645_100410343 289
3 3300025923 Ga0207681_10065644 Ga0207681_100656442 290
4 3300005563 Ga0068855_100019714 Ga0068855_1000197146 291
5 3300010375 Ga0105239_10091683 Ga0105239_100916831 291
6 3300025949 Ga0207667_10001779 Ga0207667_100017797 291
7 3300053127 Ga0500623_052003 Ga0500623_052003_1021_2034 292
8 3300005330 Ga0070690_100029503 Ga0070690_1000295033 293
9 3300005340 Ga0070689_100388626 Ga0070689_1003886261 295
10 3300005353 Ga0070669_100039261 Ga0070669_1000392613 295
11 3300005617 Ga0068859_100110704 Ga0068859_1001107044 295
12 3300005844 Ga0068862_100070665 Ga0068862_1000706653 295
13 3300006931 Ga0097620_100110706 Ga0097620_1001107064 295
14 3300009093 Ga0105240_10047072 Ga0105240_100470724 295
15 3300014326 Ga0157380_10017083 Ga0157380_100170836 295
16 3300025231 Ga0207427_100197 Ga0207427_10019717 295
17 3300025893 Ga0207682_10030806 Ga0207682_100308063 295
18 3300025940 Ga0207691_10021260 Ga0207691_100212604 295
19 3300026075 Ga0207708_10066665 Ga0207708_100666653 295
20 3300050512 nmdc:mga0n895_55558_c1 nmdc:mga0n895_55558_c1_1380_2381 298
21 3300050513 nmdc:mga0rr50_8625_c1 nmdc:mga0rr50_8625_c1_4069_5070 298
22 3300013308 Ga0157375_10221767 Ga0157375_102217673 300
23 3300053109 Ga0500569_024436 Ga0500569_024436_419_1393 300
24 3300053154 Ga0500619_000179 Ga0500619_000179_7680_8732 300
25 3300005334 Ga0068869_100136954 Ga0068869_1001369542 301
26 3300005459 Ga0068867_100384794 Ga0068867_1003847942 301
27 3300005548 Ga0070665_100003139 Ga0070665_10000313910 301
28 3300005843 Ga0068860_100088587 Ga0068860_1000885874 301
29 3300009176 Ga0105242_10034361 Ga0105242_100343613 301
30 3300009177 Ga0105248_10063684 Ga0105248_100636843 301
31 3300025934 Ga0207686_10046275 Ga0207686_100462753 301
32 3300026089 Ga0207648_10427844 Ga0207648_104278442 301
33 3300028379 Ga0268266_10105359 Ga0268266_101053593 301
34 3300028381 Ga0268264_10033784 Ga0268264_100337841 301
35 3300006914 Ga0075436_100023646 Ga0075436_1000236464 302
36 3300028794 Ga0307515_10006740 Ga0307515_100067408 302
37 3300049588 Ga0501072_0297454 Ga0501072_0297454_265_1242 302
38 3300049591 Ga0501075_0110753 Ga0501075_0110753_1089_2066 302
39 3300050514 nmdc:mga08x19_34073_c1 nmdc:mga08x19_34073_c1_1489_2481 302
40 3300032005 Ga0307411_10045474 Ga0307411_100454742 303
41 3300002705 JGI25156J39149_1000459 JGI25156J39149_100045916 304
42 3300002738 JGI25154J39366_1002018 JGI25154J39366_10020186 304
43 3300002741 JGI25157J39369_1000021 JGI25157J39369_1000021138 304
44 3300003752 Ga0055539_1000588 Ga0055539_10005888 304
45 3300003756 Ga0055533_1000033 Ga0055533_100003317 304
46 3300003759 Ga0055525_1001213 Ga0055525_10012137 304
47 3300005563 Ga0068855_100072067 Ga0068855_1000720675 304
48 3300005577 Ga0068857_100005113 Ga0068857_1000051136 304
49 3300005614 Ga0068856_100000887 Ga0068856_10000088717 304
50 3300006844 Ga0075428_100039068 Ga0075428_1000390686 304
51 3300006880 Ga0075429_100008449 Ga0075429_1000084496 304
52 3300009094 Ga0111539_10012708 Ga0111539_100127088 304
53 3300025226 Ga0209674_100064 Ga0209674_100064232 304
54 3300025230 Ga0209563_100126 Ga0209563_10012691 304
55 3300025242 Ga0209258_100736 Ga0209258_10073618 304
56 3300025246 Ga0209646_1000060 Ga0209646_100006018 304
57 3300025250 Ga0209026_1000049 Ga0209026_100004916 304
58 3300025253 Ga0209677_100411 Ga0209677_10041117 304
59 3300025253 Ga0209677_101222 Ga0209677_1012227 304
60 3300025256 Ga0209759_1000069 Ga0209759_100006916 304
61 3300025914 Ga0207671_10054640 Ga0207671_100546404 304
62 3300025949 Ga0207667_10033157 Ga0207667_100331575 304
63 3300025981 Ga0207640_10002657 Ga0207640_100026575 304
64 3300026078 Ga0207702_10002045 Ga0207702_100020458 304
65 3300026116 Ga0207674_10011982 Ga0207674_100119825 304
66 3300027907 Ga0207428_10009690 Ga0207428_100096906 304
67 3300035086 Ga0373934_0052994 Ga0373934_0052994_484_1515 304
68 3300050508 nmdc:mga09592_230147_c1 nmdc:mga09592_230147_c1_89_1069 304
69 3300050509 nmdc:mga0qj67_42020_c1 nmdc:mga0qj67_42020_c1_172_1152 304
70 3300050511 nmdc:mga08y16_8099_c1 nmdc:mga08y16_8099_c1_9281_10261 304
71 3300003752 Ga0055539_1000994 Ga0055539_10009946 305
72 3300005539 Ga0068853_100110823 Ga0068853_1001108232 305
73 3300009545 Ga0105237_10059755 Ga0105237_100597555 305
74 3300009551 Ga0105238_10066889 Ga0105238_100668893 305
75 3300025272 Ga0209455_1020628 Ga0209455_10206282 305
76 3300026041 Ga0207639_10088621 Ga0207639_100886213 305
77 3300005441 Ga0070700_100013632 Ga0070700_1000136324 306
78 3300009094 Ga0111539_10175640 Ga0111539_101756402 306
79 3300027695 Ga0209966_1021836 Ga0209966_10218362 306
80 3300053153 Ga0500616_0114883 Ga0500616_0114883_113_1132 307
81 3300005331 Ga0070670_100023495 Ga0070670_1000234956 308
82 3300013105 Ga0157369_10095033 Ga0157369_100950333 308
83 3300013307 Ga0157372_10141315 Ga0157372_101413153 308
84 3300031456 Ga0307513_10284987 Ga0307513_102849872 308
85 3300032005 Ga0307411_10138525 Ga0307411_101385252 308
86 3300005548 Ga0070665_100014302 Ga0070665_1000143023 309
87 3300009101 Ga0105247_10001835 Ga0105247_100018359 309
88 3300025900 Ga0207710_10002258 Ga0207710_100022587 309
89 3300025941 Ga0207711_10112354 Ga0207711_101123543 309
90 3300028381 Ga0268264_10007763 Ga0268264_100077639 309
91 3300003323 rootH1_10072118 rootH1_100721184 310
92 3300030521 Ga0307511_10000577 Ga0307511_1000057731 310
93 3300031730 Ga0307516_10168825 Ga0307516_101688252 311
94 3300046519 Ga0495632_0005894 Ga0495632_0005894_3619_4689 311
95 3300053086 Ga0500578_0000057 Ga0500578_0000057_43887_44966 311
96 3300053093 Ga0500651_0082231 Ga0500651_0082231_484_1554 311
97 3300053131 Ga0500652_005795 Ga0500652_005795_2558_3628 311
98 3300053142 Ga0500577_0004509 Ga0500577_0004509_239_1309 311
99 3300053156 Ga0500622_0000390 Ga0500622_0000390_38971_40041 311
100 3300053178 Ga0500637_0021091 Ga0500637_0021091_1567_2565 311
101 3300053724 Ga0500570_034175 Ga0500570_034175_215_1285 311
102 3300005335 Ga0070666_10063122 Ga0070666_100631222 312
103 3300005367 Ga0070667_100004528 Ga0070667_10000452810 312
104 3300005617 Ga0068859_100001394 Ga0068859_10000139418 312
105 3300005841 Ga0068863_100010713 Ga0068863_1000107134 312
106 3300005842 Ga0068858_100032803 Ga0068858_1000328033 312
107 3300005844 Ga0068862_100284541 Ga0068862_1002845412 312
108 3300006931 Ga0097620_100001394 Ga0097620_10000139418 312
109 3300009177 Ga0105248_10008981 Ga0105248_1000898110 312
110 3300014325 Ga0163163_10094044 Ga0163163_100940443 312
111 3300014968 Ga0157379_10007207 Ga0157379_100072078 312
112 3300025893 Ga0207682_10011444 Ga0207682_100114442 312
113 3300025926 Ga0207659_10109537 Ga0207659_101095372 312
114 3300025935 Ga0207709_10084703 Ga0207709_100847032 312
115 3300025940 Ga0207691_10020351 Ga0207691_100203514 312
116 3300025942 Ga0207689_10024068 Ga0207689_100240684 312
117 3300025960 Ga0207651_10015681 Ga0207651_100156813 312
118 3300025986 Ga0207658_10008521 Ga0207658_100085213 312
119 3300026035 Ga0207703_10008128 Ga0207703_100081287 312
120 3300026075 Ga0207708_10002329 Ga0207708_100023297 312
121 3300026088 Ga0207641_10005733 Ga0207641_100057338 312
122 3300026089 Ga0207648_10002268 Ga0207648_100022686 312
123 3300026118 Ga0207675_100010890 Ga0207675_1000108906 312
124 3300026121 Ga0207683_10084727 Ga0207683_100847271 312
125 3300048905 Ga0496102_0068571 Ga0496102_0068571_1467_2441 312
126 3300048911 Ga0496108_0254755 Ga0496108_0254755_206_1180 312
127 3300048915 Ga0496112_0088952 Ga0496112_0088952_1904_2878 312
128 3300048924 Ga0496121_0000613 Ga0496121_0000613_23947_24921 312
129 3300014326 Ga0157380_10007074 Ga0157380_100070749 313
130 3300025303 Ga0209051_1001699 Ga0209051_10016994 313
131 3300005262 Ga0065165_1013523 Ga0065165_10135232 314
132 3300005444 Ga0070694_100002546 Ga0070694_1000025463 314
133 3300005468 Ga0070707_100043290 Ga0070707_1000432902 314
134 3300005471 Ga0070698_100073122 Ga0070698_1000731223 314
135 3300005518 Ga0070699_100020656 Ga0070699_1000206563 314
136 3300005546 Ga0070696_100045341 Ga0070696_1000453413 314
137 3300005549 Ga0070704_100009713 Ga0070704_1000097132 314
138 3300006195 Ga0075366_10014454 Ga0075366_100144544 314
139 3300006353 Ga0075370_10038903 Ga0075370_100389032 314
140 3300007076 Ga0075435_100177143 Ga0075435_1001771432 314
141 3300007265 Ga0099794_10015649 Ga0099794_100156494 314
142 3300007788 Ga0099795_10000252 Ga0099795_100002523 314
143 3300010159 Ga0099796_10000338 Ga0099796_100003386 314
144 3300025273 Ga0209673_1006309 Ga0209673_10063093 314
145 3300025298 Ga0209050_1000266 Ga0209050_10002664 314
146 3300025922 Ga0207646_10089713 Ga0207646_100897134 314
147 3300049582 Ga0501048_0316173 Ga0501048_0316173_39_1037 314
148 3300050496 nmdc:mga07m45_18023_c1 nmdc:mga07m45_18023_c1_1415_2470 314
149 3300035691 Ga0373931_0003056 Ga0373931_0003056_6154_7185 315
150 3300005985 Ga0081539_10016384 Ga0081539_100163843 316
151 3300006844 Ga0075428_100359529 Ga0075428_1003595292 316
152 3300006881 Ga0068865_100006952 Ga0068865_1000069525 316
153 3300009098 Ga0105245_10003041 Ga0105245_1000304113 316
154 3300013296 Ga0157374_10287964 Ga0157374_102879642 316
155 3300025927 Ga0207687_10024283 Ga0207687_100242834 316
156 3300025938 Ga0207704_10018000 Ga0207704_100180004 316
157 3300006852 Ga0075433_10003035 Ga0075433_100030352 317
158 3300030522 Ga0307512_10016074 Ga0307512_100160747 317
159 3300050515 nmdc:mga0a205_5674_c1 nmdc:mga0a205_5674_c1_5017_6003 317
160 3300050493 nmdc:mga0k408_2439_c2 nmdc:mga0k408_2439_c2_3352_4338 318
161 3300026089 Ga0207648_10063907 Ga0207648_100639074 320
162 iso_pu_bacteria 2588253510 2588290392 320
163 3300003323 rootH1_10045185 rootH1_100451852 321
164 3300031507 Ga0307509_10184425 Ga0307509_101844253 322
165 3300035113 Ga0373936_0023807 Ga0373936_0023807_204_1172 322
166 3300044656 Ga0466969_0016885 Ga0466969_0016885_758_1783 322
167 3300044683 Ga0466965_0002600 Ga0466965_0002600_1739_2764 322
168 3300044684 Ga0466966_0019979 Ga0466966_0019979_2071_3096 322
169 3300044693 Ga0466961_0018921 Ga0466961_0018921_2188_3213 322
170 3300044706 Ga0466964_0001494 Ga0466964_0001494_1304_2329 322
171 3300044719 Ga0466971_0022726 Ga0466971_0022726_894_1919 322
172 3300044765 Ga0466970_0061857 Ga0466970_0061857_876_1901 322
173 3300044842 Ga0466957_0003346 Ga0466957_0003346_1351_2376 322
174 3300044842 Ga0466957_0131297 Ga0466957_0131297_218_1243 322
175 3300045049 Ga0466959_0032992 Ga0466959_0032992_2172_3197 322
176 3300045976 Ga0466967_0329896 Ga0466967_0329896_269_1297 322
177 3300037471 Ga0395905_0162921 Ga0395905_0162921_545_1573 323
178 3300048907 Ga0496104_0316248 Ga0496104_0316248_113_1138 323
179 iso_pu_bacteria 2585428057 2587726065 323
180 iso_pu_bacteria 2585428058 2587735795 323
181 iso_pu_bacteria 2585428062 2587756493 323
182 iso_pu_bacteria 2643221592 2643967701 323
183 iso_pu_bacteria 2643221625 2644140523 323
184 iso_pu_bacteria 2643221648 2644273490 323
185 3300003316 rootH1_10006787 rootH1_100067875 324
186 3300003320 rootH2_10027008 rootH2_100270086 324
187 3300003323 rootH1_10025509 rootH1_100255095 324
188 3300005327 Ga0070658_10050523 Ga0070658_100505232 324
189 3300005335 Ga0070666_10114451 Ga0070666_101144512 324
190 3300005339 Ga0070660_100078004 Ga0070660_1000780042 324
191 3300005364 Ga0070673_100078677 Ga0070673_1000786772 324
192 3300005455 Ga0070663_100281451 Ga0070663_1002814512 324
193 3300005458 Ga0070681_10116266 Ga0070681_101162663 324
194 3300005548 Ga0070665_100019922 Ga0070665_1000199227 324
195 3300005548 Ga0070665_100158618 Ga0070665_1001586182 324
196 3300005563 Ga0068855_100252710 Ga0068855_1002527102 324
197 3300005617 Ga0068859_100015503 Ga0068859_1000155032 324
198 3300005841 Ga0068863_100000916 Ga0068863_10000091610 324
199 3300005843 Ga0068860_100000461 Ga0068860_10000046147 324
200 3300006931 Ga0097620_100015503 Ga0097620_1000155037 324
201 3300009177 Ga0105248_10287873 Ga0105248_102878732 324
202 3300009551 Ga0105238_10073964 Ga0105238_100739643 324
203 3300025900 Ga0207710_10027010 Ga0207710_100270103 324
204 3300025909 Ga0207705_10105128 Ga0207705_101051282 324
205 3300025912 Ga0207707_10093988 Ga0207707_100939883 324
206 3300025913 Ga0207695_10093895 Ga0207695_100938952 324
207 3300025919 Ga0207657_10137881 Ga0207657_101378812 324
208 3300025932 Ga0207690_10011921 Ga0207690_100119214 324
209 3300025949 Ga0207667_10229822 Ga0207667_102298222 324
210 3300026088 Ga0207641_10000311 Ga0207641_1000031153 324
211 3300026118 Ga0207675_100096214 Ga0207675_1000962142 324
212 3300028379 Ga0268266_10041981 Ga0268266_100419812 324
213 3300028381 Ga0268264_10000156 Ga0268264_10000156110 324
214 3300028666 Ga0265336_10000123 Ga0265336_1000012336 324
215 3300029957 Ga0265324_10000849 Ga0265324_1000084916 324
216 3300031731 Ga0307405_10127731 Ga0307405_101277312 324
217 3300031911 Ga0307412_10024181 Ga0307412_100241813 324
218 3300032005 Ga0307411_10142827 Ga0307411_101428272 324
219 3300033180 Ga0307510_10056602 Ga0307510_100566023 324
220 3300037466 Ga0395898_0065381 Ga0395898_0065381_826_1857 324
221 3300038443 Ga0395901_0034521 Ga0395901_0034521_797_1828 324
222 3300044842 Ga0466957_0056280 Ga0466957_0056280_302_1336 324
223 3300046660 Ga0495625_0115354 Ga0495625_0115354_428_1402 324
224 3300047472 Ga0495686_0004315 Ga0495686_0004315_6083_7111 324
225 3300048905 Ga0496102_0009432 Ga0496102_0009432_4616_5608 324
226 3300048917 Ga0496114_0265467 Ga0496114_0265467_443_1435 324
227 3300048919 Ga0496116_0022470 Ga0496116_0022470_2358_3350 324
228 3300048920 Ga0496117_0000067 Ga0496117_0000067_67922_68914 324
229 3300048921 Ga0496118_0000021 Ga0496118_0000021_262839_263831 324
230 3300048922 Ga0496119_0016279 Ga0496119_0016279_2380_3372 324
231 3300048924 Ga0496121_0022338 Ga0496121_0022338_2883_3875 324
232 3300048928 Ga0496125_0010262 Ga0496125_0010262_5310_6302 324
233 3300048929 Ga0496126_0125173 Ga0496126_0125173_1030_2022 324
234 3300053136 Ga0500559_0040930 Ga0500559_0040930_20_994 324
235 3300002705 JGI25156J39149_1015169 JGI25156J39149_10151692 325
236 3300003316 rootH1_10045935 rootH1_100459354 325
237 3300003320 rootH2_10039275 rootH2_100392754 325
238 3300003322 rootL2_10002895 rootL2_100028959 325
239 3300003323 rootH1_10181722 rootH1_101817223 325
240 3300005295 Ga0065707_10005231 Ga0065707_100052314 325
241 3300005336 Ga0070680_100008305 Ga0070680_1000083054 325
242 3300005337 Ga0070682_100013916 Ga0070682_1000139162 325
243 3300005345 Ga0070692_10106215 Ga0070692_101062151 325
244 3300005356 Ga0070674_100180514 Ga0070674_1001805141 325
245 3300005434 Ga0070709_10016747 Ga0070709_100167472 325
246 3300005437 Ga0070710_10133360 Ga0070710_101333602 325
247 3300005458 Ga0070681_10000619 Ga0070681_1000061920 325
248 3300005458 Ga0070681_10034568 Ga0070681_100345682 325
249 3300005468 Ga0070707_100157598 Ga0070707_1001575982 325
250 3300005530 Ga0070679_100001338 Ga0070679_10000133819 325
251 3300005530 Ga0070679_100026654 Ga0070679_1000266544 325
252 3300005563 Ga0068855_100000956 Ga0068855_1000009569 325
253 3300005563 Ga0068855_100066525 Ga0068855_1000665252 325
254 3300005563 Ga0068855_100229640 Ga0068855_1002296402 325
255 3300005614 Ga0068856_100120157 Ga0068856_1001201573 325
256 3300005614 Ga0068856_100234697 Ga0068856_1002346972 325
257 3300005617 Ga0068859_100010283 Ga0068859_1000102832 325
258 3300005719 Ga0068861_100041449 Ga0068861_1000414494 325
259 3300005840 Ga0068870_10122533 Ga0068870_101225332 325
260 3300006028 Ga0070717_10105793 Ga0070717_101057932 325
261 3300006051 Ga0075364_10137329 Ga0075364_101373292 325
262 3300006847 Ga0075431_100231799 Ga0075431_1002317991 325
263 3300006852 Ga0075433_10118366 Ga0075433_101183663 325
264 3300006931 Ga0097620_100010283 Ga0097620_1000102838 325
265 3300007788 Ga0099795_10000018 Ga0099795_1000001833 325
266 3300009093 Ga0105240_10010749 Ga0105240_100107498 325
267 3300009093 Ga0105240_10070489 Ga0105240_100704893 325
268 3300009093 Ga0105240_10216676 Ga0105240_102166763 325
269 3300009094 Ga0111539_10002499 Ga0111539_100024999 325
270 3300009094 Ga0111539_10024487 Ga0111539_100244872 325
271 3300009094 Ga0111539_10102974 Ga0111539_101029742 325
272 3300009101 Ga0105247_10114750 Ga0105247_101147502 325
273 3300009148 Ga0105243_10434151 Ga0105243_104341512 325
274 3300009551 Ga0105238_10081982 Ga0105238_100819823 325
275 3300009551 Ga0105238_10300599 Ga0105238_103005992 325
276 3300009553 Ga0105249_10017219 Ga0105249_100172193 325
277 3300009553 Ga0105249_10043759 Ga0105249_100437593 325
278 3300009553 Ga0105249_10117847 Ga0105249_101178473 325
279 3300010159 Ga0099796_10000048 Ga0099796_1000004816 325
280 3300013306 Ga0163162_10254633 Ga0163162_102546332 325
281 3300013308 Ga0157375_10001087 Ga0157375_100010877 325
282 3300025253 Ga0209677_100792 Ga0209677_1007925 325
283 3300025256 Ga0209759_1001428 Ga0209759_10014288 325
284 3300025908 Ga0207643_10137522 Ga0207643_101375222 325
285 3300025909 Ga0207705_10032698 Ga0207705_100326983 325
286 3300025912 Ga0207707_10000038 Ga0207707_1000003860 325
287 3300025912 Ga0207707_10000748 Ga0207707_1000074833 325
288 3300025912 Ga0207707_10046174 Ga0207707_100461742 325
289 3300025913 Ga0207695_10014733 Ga0207695_100147338 325
290 3300025913 Ga0207695_10060273 Ga0207695_100602733 325
291 3300025914 Ga0207671_10093872 Ga0207671_100938722 325
292 3300025917 Ga0207660_10002433 Ga0207660_100024337 325
293 3300025920 Ga0207649_10149942 Ga0207649_101499422 325
294 3300025921 Ga0207652_10003247 Ga0207652_100032479 325
295 3300025921 Ga0207652_10023299 Ga0207652_100232995 325
296 3300025924 Ga0207694_10011678 Ga0207694_100116786 325
297 3300025941 Ga0207711_10093873 Ga0207711_100938733 325
298 3300025942 Ga0207689_10355405 Ga0207689_103554051 325
299 3300025949 Ga0207667_10009653 Ga0207667_100096534 325
300 3300025949 Ga0207667_10025177 Ga0207667_100251774 325
301 3300026075 Ga0207708_10103959 Ga0207708_101039593 325
302 3300026089 Ga0207648_10039740 Ga0207648_100397404 325
303 3300026118 Ga0207675_100015521 Ga0207675_1000155215 325
304 3300027512 Ga0209179_1000007 Ga0209179_100000778 325
305 3300027907 Ga0207428_10026483 Ga0207428_100264834 325
306 3300028379 Ga0268266_10003279 Ga0268266_1000327912 325
307 3300028380 Ga0268265_10037578 Ga0268265_100375785 325
308 3300032005 Ga0307411_10203975 Ga0307411_102039752 325
309 3300033180 Ga0307510_10000011 Ga0307510_1000001131 325
310 3300035691 Ga0373931_0140115 Ga0373931_0140115_48_1031 325
311 3300046506 Ga0495583_0000046 Ga0495583_0000046_198232_199284 325
312 3300046507 Ga0495606_0050875 Ga0495606_0050875_29_1102 325
313 3300046519 Ga0495632_0053098 Ga0495632_0053098_702_1697 325
314 3300046539 Ga0495621_0000849 Ga0495621_0000849_1450_2430 325
315 3300046694 Ga0495649_0000638 Ga0495649_0000638_18637_19710 325
316 3300046794 Ga0495589_0049019 Ga0495589_0049019_774_1826 325
317 3300048918 Ga0496115_0341955 Ga0496115_0341955_200_1177 325
318 3300048922 Ga0496119_0008780 Ga0496119_0008780_3633_4628 325
319 3300048923 Ga0496120_0000042 Ga0496120_0000042_105561_106556 325
320 3300048928 Ga0496125_0000533 Ga0496125_0000533_59591_60586 325
321 3300049824 Ga0501045_0166109 Ga0501045_0166109_91_1071 325
322 3300050491 nmdc:mga00v17_1626_c1 nmdc:mga00v17_1626_c1_9181_10167 325
323 3300050494 nmdc:mga06z11_22007_c1 nmdc:mga06z11_22007_c1_1687_2673 325
324 3300050496 nmdc:mga07m45_2073_c1 nmdc:mga07m45_2073_c1_4711_5697 325
325 3300050510 nmdc:mga06r32_67394_c1 nmdc:mga06r32_67394_c1_928_1911 325
326 3300050511 nmdc:mga08y16_334150_c1 nmdc:mga08y16_334150_c1_134_1111 325
327 3300050511 nmdc:mga08y16_45244_c1 nmdc:mga08y16_45244_c1_3290_4282 325
328 3300050515 nmdc:mga0a205_136710_c1 nmdc:mga0a205_136710_c1_1306_2298 325
329 3300053080 Ga0500635_0000005 Ga0500635_0000005_42903_43952 325
330 3300003215 JGI25153J46596_10005556 JGI25153J46596_100055563 326
331 3300003215 JGI25153J46596_10008722 JGI25153J46596_100087223 326
332 3300003771 Ga0055526_1020064 Ga0055526_10200642 326
333 3300005328 Ga0070676_10079817 Ga0070676_100798172 326
334 3300005340 Ga0070689_100001812 Ga0070689_10000181211 326
335 3300005344 Ga0070661_100203330 Ga0070661_1002033301 326
336 3300005345 Ga0070692_10089590 Ga0070692_100895902 326
337 3300005347 Ga0070668_100429382 Ga0070668_1004293821 326
338 3300005353 Ga0070669_100003380 Ga0070669_1000033809 326
339 3300005354 Ga0070675_100045335 Ga0070675_1000453355 326
340 3300005365 Ga0070688_100022761 Ga0070688_1000227613 326
341 3300005406 Ga0070703_10004647 Ga0070703_100046475 326
342 3300005438 Ga0070701_10085381 Ga0070701_100853812 326
343 3300005440 Ga0070705_100016375 Ga0070705_1000163756 326
344 3300005440 Ga0070705_100125573 Ga0070705_1001255732 326
345 3300005441 Ga0070700_100002005 Ga0070700_1000020057 326
346 3300005444 Ga0070694_100002855 Ga0070694_1000028555 326
347 3300005445 Ga0070708_100234292 Ga0070708_1002342922 326
348 3300005457 Ga0070662_100018289 Ga0070662_1000182894 326
349 3300005458 Ga0070681_10092205 Ga0070681_100922052 326
350 3300005459 Ga0068867_100009240 Ga0068867_1000092405 326
351 3300005471 Ga0070698_100083197 Ga0070698_1000831974 326
352 3300005543 Ga0070672_100057979 Ga0070672_1000579793 326
353 3300005545 Ga0070695_100141163 Ga0070695_1001411632 326
354 3300005549 Ga0070704_100002098 Ga0070704_1000020986 326
355 3300005577 Ga0068857_100003699 Ga0068857_10000369911 326
356 3300005617 Ga0068859_100003913 Ga0068859_10000391312 326
357 3300005617 Ga0068859_100261831 Ga0068859_1002618312 326
358 3300005618 Ga0068864_100017265 Ga0068864_1000172655 326
359 3300005719 Ga0068861_100001582 Ga0068861_1000015827 326
360 3300005840 Ga0068870_10002226 Ga0068870_100022265 326
361 3300005843 Ga0068860_100099763 Ga0068860_1000997632 326
362 3300006178 Ga0075367_10013904 Ga0075367_100139041 326
363 3300006358 Ga0068871_100012030 Ga0068871_1000120303 326
364 3300006844 Ga0075428_100008577 Ga0075428_1000085779 326
365 3300006847 Ga0075431_100247310 Ga0075431_1002473102 326
366 3300006880 Ga0075429_100120549 Ga0075429_1001205492 326
367 3300006931 Ga0097620_100003912 Ga0097620_1000039126 326
368 3300006931 Ga0097620_100261827 Ga0097620_1002618272 326
369 3300009093 Ga0105240_10000921 Ga0105240_1000092123 326
370 3300009093 Ga0105240_10205219 Ga0105240_102052193 326
371 3300009147 Ga0114129_10183832 Ga0114129_101838322 326
372 3300009545 Ga0105237_10016231 Ga0105237_100162314 326
373 3300009545 Ga0105237_10135233 Ga0105237_101352333 326
374 3300009551 Ga0105238_10002000 Ga0105238_1000200015 326
375 3300013104 Ga0157370_10000715 Ga0157370_1000071536 326
376 3300013105 Ga0157369_10004931 Ga0157369_1000493117 326
377 3300013307 Ga0157372_10085056 Ga0157372_100850564 326
378 3300014969 Ga0157376_10024319 Ga0157376_100243195 326
379 3300025245 Ga0207425_1000196 Ga0207425_10001964 326
380 3300025258 Ga0209129_1000035 Ga0209129_10000355 326
381 3300025273 Ga0209673_1011658 Ga0209673_10116583 326
382 3300025295 Ga0209564_1000024 Ga0209564_1000024199 326
383 3300025297 Ga0209758_1000558 Ga0209758_100055829 326
384 3300025297 Ga0209758_1001090 Ga0209758_10010903 326
385 3300025907 Ga0207645_10099070 Ga0207645_100990702 326
386 3300025907 Ga0207645_10221465 Ga0207645_102214652 326
387 3300025908 Ga0207643_10005789 Ga0207643_100057892 326
388 3300025923 Ga0207681_10007259 Ga0207681_100072592 326
389 3300025926 Ga0207659_10126330 Ga0207659_101263302 326
390 3300025933 Ga0207706_10010502 Ga0207706_100105027 326
391 3300025936 Ga0207670_10001881 Ga0207670_100018819 326
392 3300025940 Ga0207691_10039139 Ga0207691_100391395 326
393 3300025961 Ga0207712_10292580 Ga0207712_102925802 326
394 3300026089 Ga0207648_10025275 Ga0207648_100252756 326
395 3300026095 Ga0207676_10030832 Ga0207676_100308324 326
396 3300026116 Ga0207674_10004373 Ga0207674_100043737 326
397 3300026118 Ga0207675_100003206 Ga0207675_1000032067 326
398 3300026118 Ga0207675_100192012 Ga0207675_1001920122 326
399 3300027907 Ga0207428_10001170 Ga0207428_1000117027 326
400 3300028380 Ga0268265_10000211 Ga0268265_1000021151 326
401 3300028381 Ga0268264_10053673 Ga0268264_100536734 326
402 3300037471 Ga0395905_0071099 Ga0395905_0071099_186_1214 326
403 3300045051 Ga0451576_0024633 Ga0451576_0024633_1345_2328 326
404 3300046539 Ga0495621_0053906 Ga0495621_0053906_171_1154 326
405 3300048913 Ga0496110_0005495 Ga0496110_0005495_1670_2695 326
406 3300050507 nmdc:mga05p37_729471_c1 nmdc:mga05p37_729471_c1_44_1030 326
407 3300050511 nmdc:mga08y16_12596_c1 nmdc:mga08y16_12596_c1_4065_5048 326
408 3300003203 JGI25406J46586_10000132 JGI25406J46586_1000013218 327
409 3300005347 Ga0070668_100041165 Ga0070668_1000411652 327
410 3300005353 Ga0070669_100030346 Ga0070669_1000303463 327
411 3300005354 Ga0070675_100001947 Ga0070675_10000194712 327
412 3300005356 Ga0070674_100022200 Ga0070674_1000222002 327
413 3300005364 Ga0070673_100176377 Ga0070673_1001763771 327
414 3300005518 Ga0070699_100023658 Ga0070699_1000236582 327
415 3300005985 Ga0081539_10000047 Ga0081539_10000047180 327
416 3300009094 Ga0111539_10037800 Ga0111539_100378005 327
417 3300014326 Ga0157380_10051650 Ga0157380_100516503 327
418 3300014326 Ga0157380_10116856 Ga0157380_101168562 327
419 3300014326 Ga0157380_10160830 Ga0157380_101608302 327
420 3300025923 Ga0207681_10023200 Ga0207681_100232004 327
421 3300025926 Ga0207659_10000880 Ga0207659_1000088014 327
422 3300025972 Ga0207668_10225026 Ga0207668_102250262 327
423 3300031730 Ga0307516_10037859 Ga0307516_100378595 327
424 3300031824 Ga0307413_10051656 Ga0307413_100516562 327
425 3300031903 Ga0307407_10054182 Ga0307407_100541823 327
426 3300046512 Ga0495610_0050346 Ga0495610_0050346_844_1872 327
427 3300046519 Ga0495632_0117303 Ga0495632_0117303_197_1225 327
428 3300046660 Ga0495625_0003005 Ga0495625_0003005_6599_7627 327
429 3300048912 Ga0496109_0040768 Ga0496109_0040768_2155_3171 327
430 3300050493 nmdc:mga0k408_30313_c2 nmdc:mga0k408_30313_c2_1181_2209 327
431 3300053739 Ga0500587_008717 Ga0500587_008717_94_1122 327
432 3300059424 Ga0590075_004988 Ga0590075_004988_1045_2028 327
433 2162886012 MBSR1b_contig_1342649 MBSR1b_0056.00002080 328
434 3300005295 Ga0065707_10107161 Ga0065707_101071612 328
435 3300005331 Ga0070670_100230891 Ga0070670_1002308912 328
436 3300005353 Ga0070669_100009114 Ga0070669_1000091143 328
437 3300005577 Ga0068857_100010788 Ga0068857_1000107883 328
438 3300006844 Ga0075428_100294706 Ga0075428_1002947061 328
439 3300006852 Ga0075433_10014097 Ga0075433_100140976 328
440 3300006871 Ga0075434_100019051 Ga0075434_1000190512 328
441 3300009094 Ga0111539_10005321 Ga0111539_1000532111 328
442 3300009553 Ga0105249_10000719 Ga0105249_1000071912 328
443 3300014745 Ga0157377_10013920 Ga0157377_100139201 328
444 3300025923 Ga0207681_10019349 Ga0207681_100193492 328
445 3300027907 Ga0207428_10006671 Ga0207428_100066715 328
446 3300050511 nmdc:mga08y16_3599_c1 nmdc:mga08y16_3599_c1_6815_7801 328
447 3300050512 nmdc:mga0n895_63233_c1 nmdc:mga0n895_63233_c1_367_1353 328
448 3300050515 nmdc:mga0a205_9437_c1 nmdc:mga0a205_9437_c1_3157_4143 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01944

SpoIIM

Stage II sporulation protein M

132

315

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ob7-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, dilazep bound 0.3971 109 288
2l10-assembly1.cif.gz_A solution structure of the r6 domain of talin 0.3875 161 287
2kvp-assembly1.cif.gz_A solution structure of the r10 domain of talin 0.3656 146 286
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.3632 127 287
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.3604 127 288
ID Description Score Start End Superfamily
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7875 2 107 1.20.120.330
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7282 2 107 1.20.120.330
af_G3V9K0_113_211_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.475 15 85 1.20.1410.10
af_Q9ER72_196_294_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4697 15 85 1.20.1410.10
af_P49589_113_211_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4691 15 85 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A8B3GJ60-F1-model_v4 Integral membrane protein 0.9755 173 325 GO:0016020
AF-A0A846BWR5-F1-model_v4 Stage II sporulation protein M 0.9638 194 319 GO:0016020
AF-A0A3N5Q100-F1-model_v4 Stage II sporulation protein M 0.9604 204 328 GO:0016020
AF-A0A251XAC5-F1-model_v4 Stage II sporulation protein M 0.9584 90 325 GO:0016020
AF-A0A6I5RIN1-F1-model_v4 Stage II sporulation protein M 0.9559 179 328 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.56 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map