F446117

General Info

Members Datasets Scaffolds Average Seq Length
448 291 422 196

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100212552|Ga0070679_1002125522
Length 218
Sequence MPMHRIVTKAFPISDDTHMSLAKFDPVKIGIVSISDRASTGVYEDKGLPALKDWLVRALHNPIAFEARLIPDEKERISATLIELCDAGCSLVLTTGGTGPAPRDVTPEATLAIADREMPGFGEQMRQISLRFVPTAILSRQCAVVRGKSLVINLPGQPKSIQETLEGLKGAGGEQTVAGIFAAVPYCIDLIGGPYMETRDDVCKAFRPKSAIRPARPA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
4 2643221652 Acidovorax sp. Root402 Isolate Unclassified
5 2643221658 Variovorax sp. Root411 Isolate Unclassified
6 2643221672 Variovorax sp. Root434 Isolate Unclassified
7 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
8 2721755523 Delftia sp. HK171 Isolate Unclassified
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 2738543012 Acidovorax sp. CF301 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
13 2816332133 Acidovorax radicis 2721A Isolate Unclassified
14 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
17 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
18 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
19 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
20 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
21 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
22 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
23 2928070936 Variovorax gossypii 1167 Isolate Unclassified
24 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
25 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
26 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
27 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
200 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
201 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
202 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
285 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
286 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
287 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.45
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.54
Nodule 0.67
Rhizoplane 4.02
Rhizosphere 61.61
Stem 0
Stem Tuber 0
Unclassified 11.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000086 3300002704 Bacteria 52913
2 JGI25156J39149_1000111 3300002705 Bacteria 59224
3 JGI25154J39366_1000134 3300002738 Bacteria 58169
4 JGI25157J39369_1000152 3300002741 Bacteria 58260
5 JGI25150J39212_1018650 3300002774 Bacteria 1100
6 JGI25159J45721_1003594 3300002987 Bacteria 5420
7 JGI25159J45721_1005344 3300002987 Bacteria 4048
8 JGI25151J46595_10005412 3300003187 Bacteria 6595
9 JGI25151J46595_10026249 3300003187 Bacteria 2355
10 JGI25151J46595_10032274 3300003187 Bacteria 2032
11 JGI25160J50197_1000126 3300003354 Bacteria 69342
12 JGI25161J50226_1000087 3300003374 Bacteria 75177
13 Ga0055526_1010054 3300003771 Bacteria 4455
14 Ga0055526_1012937 3300003771 Bacteria 3580
15 Ga0055526_1022539 3300003771 Bacteria 2137
16 Ga0055537_1000084 3300003773 Bacteria 68680
17 Ga0055537_1017052 3300003773 Bacteria 1208
18 Ga0055524_1000082 3300003775 Bacteria 119749
19 Ga0055536_1010665 3300003781 Bacteria 3615
20 Ga0055536_1041273 3300003781 Bacteria 1090
21 Ga0055534_1001011 3300003784 Bacteria 12345
22 Ga0055534_1004646 3300003784 Bacteria 3902
23 Ga0055528_1002551 3300003790 Bacteria 9655
24 Ga0055530_10000690 3300003791 Bacteria 28576
25 Ga0055530_10019558 3300003791 Bacteria 2047
26 Ga0055540_1000005 3300003792 Bacteria 378126
27 Ga0055540_1006712 3300003792 Bacteria 4510
28 Ga0055531_10002730 3300003794 Bacteria 11607
29 Ga0055531_10004572 3300003794 Bacteria 8352
30 Ga0055531_10010742 3300003794 Bacteria 4510
31 Ga0055543_1000271 3300004625 Bacteria 38637
32 Ga0065165_1023349 3300005262 Bacteria 2099
33 Ga0065165_1029052 3300005262 Bacteria 1776
34 Ga0065165_1045591 3300005262 Bacteria 1276
35 Ga0065714_10224384 3300005288 Bacteria 832
36 Ga0065714_10322842 3300005288 Bacteria 666
37 Ga0065704_10262833 3300005289 Bacteria 961
38 Ga0070658_10181150 3300005327 Bacteria 1773
39 Ga0070658_10204759 3300005327 Bacteria 1666
40 Ga0070670_100102721 3300005331 Bacteria 2462
41 Ga0068869_100162399 3300005334 Bacteria 1740
42 Ga0070680_100084082 3300005336 Bacteria 2628
43 Ga0070660_100009091 3300005339 Bacteria 6975
44 Ga0070714_100272958 3300005435 Bacteria 1568
45 Ga0070713_100168528 3300005436 Bacteria 1960
46 Ga0070711_100465326 3300005439 Bacteria 1037
47 Ga0070678_100039356 3300005456 Bacteria 3335
48 Ga0070678_100208195 3300005456 Bacteria 1619
49 Ga0070662_100084369 3300005457 Bacteria 2372
50 Ga0070681_10448612 3300005458 Bacteria 1202
51 Ga0070679_100015954 3300005530 Bacteria 7232
52 Ga0070679_100212552 3300005530 Bacteria 1898
53 Ga0068853_100098942 3300005539 Bacteria 2576
54 Ga0068853_100296322 3300005539 Bacteria 1494
55 Ga0070665_100009860 3300005548 Bacteria 9655
56 Ga0068855_100045597 3300005563 Bacteria 5185
57 Ga0068855_100215316 3300005563 Bacteria 2156
58 Ga0068855_100874684 3300005563 Bacteria 951
59 Ga0070664_100022818 3300005564 Bacteria 5162
60 Ga0068856_100080170 3300005614 Bacteria 3238
61 Ga0068856_100635719 3300005614 Bacteria 1088
62 Ga0068852_100878610 3300005616 Bacteria 913
63 Ga0068864_100075968 3300005618 Bacteria 2934
64 Ga0068863_101150803 3300005841 Bacteria 781
65 Ga0068858_100909078 3300005842 Bacteria 861
66 Ga0075365_10171810 3300006038 Bacteria 1513
67 Ga0075363_100031180 3300006048 Bacteria 2763
68 Ga0075364_10047406 3300006051 Bacteria 2799
69 Ga0075364_10261733 3300006051 Bacteria 1176
70 Ga0075364_10560311 3300006051 Bacteria 781
71 Ga0075432_10068978 3300006058 Bacteria 1268
72 Ga0075362_10022837 3300006177 Bacteria 2640
73 Ga0075362_10115730 3300006177 Bacteria 1266
74 Ga0075367_10077227 3300006178 Bacteria 2010
75 Ga0075366_10020941 3300006195 Bacteria 3799
76 Ga0075366_10282701 3300006195 Bacteria 1014
77 Ga0075366_10584445 3300006195 Bacteria 692
78 Ga0075370_10005100 3300006353 Bacteria 6473
79 Ga0075370_10128110 3300006353 Bacteria 1480
80 Ga0079104_1000003 3300006946 Bacteria 468966
81 Ga0105244_10003689 3300009036 Bacteria 10819
82 Ga0105250_10002487 3300009092 Bacteria 9246
83 Ga0105240_10019889 3300009093 Bacteria 8966
84 Ga0105240_10459733 3300009093 Bacteria 1423
85 Ga0105245_10024044 3300009098 Bacteria 5348
86 Ga0114129_10755264 3300009147 Bacteria 1245
87 Ga0105243_10000273 3300009148 Bacteria 57562
88 Ga0105242_11612785 3300009176 Bacteria 683
89 Ga0105248_10477084 3300009177 Bacteria 1406
90 Ga0105237_11458813 3300009545 Bacteria 691
91 Ga0105238_10008889 3300009551 Bacteria 10053
92 Ga0105238_10118799 3300009551 Bacteria 2624
93 Ga0105238_10390613 3300009551 Bacteria 1384
94 Ga0157373_10425770 3300013100 Bacteria 953
95 Ga0157374_10000916 3300013296 Bacteria 25665
96 Ga0157378_10104299 3300013297 Bacteria 2592
97 Ga0157378_10445549 3300013297 Bacteria 1284
98 Ga0157375_10099921 3300013308 Bacteria 2981
99 Ga0182008_10002002 3300014497 Bacteria 13081
100 Ga0182008_10002994 3300014497 Bacteria 10402
101 Ga0182008_10054137 3300014497 Bacteria 1986
102 Ga0182008_10146166 3300014497 Bacteria 1184
103 Ga0157376_10001524 3300014969 Bacteria 15288
104 Ga0157376_10189461 3300014969 Bacteria 1885
105 Ga0182006_1014639 3300015261 Bacteria 3377
106 Ga0182006_1059338 3300015261 Bacteria 1449
107 Ga0182007_10001355 3300015262 Bacteria 13203
108 Ga0182007_10019912 3300015262 Bacteria 2404
109 Ga0163161_10007373 3300017792 Bacteria 7595
110 Ga0209435_100014 3300025206 Bacteria 322129
111 Ga0207425_1005099 3300025245 Bacteria 3804
112 Ga0209646_1000001 3300025246 Bacteria 3092932
113 Ga0209026_1000137 3300025250 Bacteria 116282
114 Ga0209759_1000013 3300025256 Bacteria 399300
115 Ga0209129_1004380 3300025258 Bacteria 5551
116 Ga0209565_1000036 3300025263 Bacteria 293334
117 Ga0209565_1000710 3300025263 Bacteria 20347
118 Ga0209673_1000043 3300025273 Bacteria 291503
119 Ga0209673_1018658 3300025273 Bacteria 2514
120 Ga0209130_1000042 3300025284 Bacteria 257581
121 Ga0209130_1000151 3300025284 Bacteria 107021
122 Ga0209130_1001369 3300025284 Bacteria 16437
123 Ga0209675_1000528 3300025291 Bacteria 28020
124 Ga0209675_1001464 3300025291 Bacteria 13578
125 Ga0209675_1004702 3300025291 Bacteria 5984
126 Ga0209676_1000007 3300025292 Bacteria 1029371
127 Ga0209676_1000206 3300025292 Bacteria 132202
128 Ga0209676_1005716 3300025292 Bacteria 6391
129 Ga0209676_1005916 3300025292 Bacteria 6198
130 Ga0209025_1010814 3300025294 Bacteria 6123
131 Ga0209025_1024294 3300025294 Bacteria 3132
132 Ga0209025_1045944 3300025294 Bacteria 1803
133 Ga0209564_1000922 3300025295 Bacteria 38243
134 Ga0209564_1008919 3300025295 Bacteria 4864
135 Ga0209564_1010985 3300025295 Bacteria 4107
136 Ga0209758_1014761 3300025297 Bacteria 4120
137 Ga0209050_1000003 3300025298 Bacteria 1609245
138 Ga0209050_1004288 3300025298 Bacteria 9757
139 Ga0209050_1010636 3300025298 Bacteria 4499
140 Ga0209050_1011124 3300025298 Bacteria 4317
141 Ga0209256_1000001 3300025299 Bacteria 2166974
142 Ga0207426_1000097 3300025302 Bacteria 265930
143 Ga0207426_1003357 3300025302 Bacteria 8790
144 Ga0209051_1000003 3300025303 Bacteria 1609245
145 Ga0209051_1000346 3300025303 Bacteria 69226
146 Ga0209051_1000443 3300025303 Bacteria 56293
147 Ga0209051_1026449 3300025303 Bacteria 2338
148 Ga0209257_1000020 3300025304 Bacteria 773356
149 Ga0209257_1000312 3300025304 Bacteria 102739
150 Ga0209257_1000396 3300025304 Bacteria 86000
151 Ga0209257_1022213 3300025304 Bacteria 2271
152 Ga0207696_1017339 3300025711 Bacteria 2387
153 Ga0207655_1019688 3300025728 Bacteria 3512
154 Ga0207645_10329742 3300025907 Bacteria 1019
155 Ga0207684_10661426 3300025910 Bacteria 890
156 Ga0207654_10092828 3300025911 Bacteria 1844
157 Ga0207695_10038483 3300025913 Bacteria 5148
158 Ga0207695_11012977 3300025913 Bacteria 710
159 Ga0207657_10023225 3300025919 Bacteria 5780
160 Ga0207652_10116912 3300025921 Bacteria 2369
161 Ga0207652_10206641 3300025921 Bacteria 1768
162 Ga0207646_10572420 3300025922 Bacteria 1015
163 Ga0207694_10009831 3300025924 Bacteria 7223
164 Ga0207694_10177782 3300025924 Bacteria 1725
165 Ga0207650_10121291 3300025925 Bacteria 2036
166 Ga0207650_10177206 3300025925 Bacteria 1697
167 Ga0207687_10021086 3300025927 Bacteria 4325
168 Ga0207700_10909756 3300025928 Bacteria 787
169 Ga0207706_10055188 3300025933 Bacteria 3504
170 Ga0207686_10078564 3300025934 Bacteria 2146
171 Ga0207709_10000032 3300025935 Bacteria 324478
172 Ga0207709_10049398 3300025935 Bacteria 2568
173 Ga0207691_10778854 3300025940 Bacteria 804
174 Ga0207711_10134717 3300025941 Bacteria 2218
175 Ga0207689_10062436 3300025942 Bacteria 3064
176 Ga0207689_10208212 3300025942 Bacteria 1615
177 Ga0207679_10033708 3300025945 Bacteria 3606
178 Ga0207667_10054943 3300025949 Bacteria 4188
179 Ga0207667_10192514 3300025949 Bacteria 2092
180 Ga0207667_10195532 3300025949 Bacteria 2075
181 Ga0207651_11101178 3300025960 Bacteria 712
182 Ga0207712_10385213 3300025961 Bacteria 1174
183 Ga0207640_10104799 3300025981 Bacteria 1991
184 Ga0207658_11195543 3300025986 Bacteria 695
185 Ga0207677_10165574 3300026023 Bacteria 1723
186 Ga0207639_10059139 3300026041 Bacteria 2951
187 Ga0207676_10797725 3300026095 Unclassified 921
188 Ga0207683_10149377 3300026121 Bacteria 2108
189 Ga0207683_10236212 3300026121 Bacteria 1667
190 Ga0207698_10944767 3300026142 Bacteria 871
191 Ga0209281_1000002 3300027111 Bacteria 1924012
192 Ga0209371_1000544 3300027312 Bacteria 35405
193 Ga0209970_1014326 3300027614 Bacteria 1317
194 Ga0209974_10039818 3300027876 Bacteria 1563
195 Ga0268266_10049910 3300028379 Bacteria 3589
196 Ga0268266_10833570 3300028379 Bacteria 891
197 Ga0265334_10063263 3300028573 Bacteria 1391
198 Ga0265336_10000016 3300028666 Bacteria 238832
199 Ga0307515_10001134 3300028794 Bacteria 61061
200 Ga0307515_10271168 3300028794 Bacteria 1418
201 Ga0265338_10001296 3300028800 Bacteria 41001
202 Ga0265338_10222793 3300028800 Bacteria 1408
203 Ga0265324_10001980 3300029957 Bacteria 10956
204 Ga0268256_1000462 3300030500 Bacteria 35405
205 Ga0316177_1193354 3300030731 Bacteria 5443
206 Ga0316176_1004864 3300030732 Bacteria 13485
207 Ga0316183_1009917 3300030742 Bacteria 46001
208 Ga0316183_1153290 3300030742 Bacteria 1136
209 Ga0316181_1030989 3300030744 Bacteria 23427
210 Ga0265762_1080054 3300030760 Bacteria 698
211 Ga0265760_10009529 3300031090 Bacteria 2773
212 Ga0265332_10000014 3300031238 Bacteria 249035
213 Ga0265331_10010425 3300031250 Bacteria 5145
214 Ga0265331_10076727 3300031250 Bacteria 1557
215 Ga0265327_10005175 3300031251 Bacteria 11049
216 Ga0265327_10041032 3300031251 Bacteria 2498
217 Ga0307513_10000004 3300031456 Bacteria 558931
218 Ga0307513_10001431 3300031456 Bacteria 34296
219 Ga0307513_10020664 3300031456 Bacteria 7800
220 Ga0307513_10072082 3300031456 Bacteria 3602
221 Ga0307513_10372688 3300031456 Bacteria 1169
222 Ga0307513_10428333 3300031456 Bacteria 1052
223 Ga0307408_100094940 3300031548 Bacteria 2259
224 Ga0307408_100167786 3300031548 Bacteria 1750
225 Ga0307408_100207709 3300031548 Bacteria 1589
226 Ga0307408_100744277 3300031548 Bacteria 885
227 Ga0307514_10000384 3300031649 Bacteria 101117
228 Ga0316575_10053982 3300031665 Bacteria 1600
229 Ga0265314_10001258 3300031711 Bacteria 28871
230 Ga0307516_10023286 3300031730 Bacteria 6353
231 Ga0307516_10215318 3300031730 Bacteria 1633
232 Ga0307405_10103552 3300031731 Bacteria 1914
233 Ga0307405_10369455 3300031731 Bacteria 1113
234 Ga0307413_10723261 3300031824 Bacteria 829
235 Ga0307410_10371817 3300031852 Bacteria 1148
236 Ga0307406_10026913 3300031901 Bacteria 3459
237 Ga0307406_10433337 3300031901 Bacteria 1050
238 Ga0307406_11164807 3300031901 Bacteria 668
239 Ga0307412_10576161 3300031911 Bacteria 949
240 Ga0307412_10709958 3300031911 Bacteria 864
241 Ga0307416_100702453 3300032002 Bacteria 1100
242 Ga0307416_101202872 3300032002 Bacteria 863
243 Ga0307411_10107716 3300032005 Bacteria 1986
244 Ga0307415_100566975 3300032126 Bacteria 1005
245 Ga0307415_100764324 3300032126 Bacteria 879
246 Ga0307510_10345633 3300033180 Bacteria 939
247 Ga0373955_0418997 3300035172 Bacteria 814
248 Ga0395899_0001657 3300037312 Bacteria 18557
249 Ga0395899_0025344 3300037312 Bacteria 4476
250 Ga0395899_0580910 3300037312 Bacteria 716
251 Ga0395900_0015002 3300037418 Bacteria 7897
252 Ga0395900_0037275 3300037418 Bacteria 5014
253 Ga0395900_0217346 3300037418 Bacteria 1928
254 Ga0395900_0247002 3300037418 Bacteria 1787
255 Ga0395898_0007796 3300037466 Bacteria 11365
256 Ga0395898_0008357 3300037466 Bacteria 10943
257 Ga0395898_0085610 3300037466 Bacteria 3038
258 Ga0395898_0085929 3300037466 Bacteria 3032
259 Ga0395898_0301844 3300037466 Bacteria 1527
260 Ga0395898_0951481 3300037466 Bacteria 796
261 Ga0395905_0000125 3300037471 Bacteria 126341
262 Ga0395905_0003742 3300037471 Bacteria 16124
263 Ga0395905_0007868 3300037471 Bacteria 10558
264 Ga0395905_0024071 3300037471 Bacteria 5747
265 Ga0395905_0127642 3300037471 Bacteria 2391
266 Ga0395905_0136278 3300037471 Bacteria 2309
267 Ga0395905_0150768 3300037471 Bacteria 2187
268 Ga0395905_0189361 3300037471 Bacteria 1930
269 Ga0395905_0368451 3300037471 Bacteria 1330
270 Ga0395901_0040012 3300038443 Bacteria 4853
271 Ga0395901_0089490 3300038443 Bacteria 3221
272 Ga0395901_0115570 3300038443 Bacteria 2818
273 Ga0395901_0127647 3300038443 Bacteria 2673
274 Ga0395901_0228940 3300038443 Bacteria 1941
275 Ga0395901_0258388 3300038443 Bacteria 1813
276 Ga0395901_0311442 3300038443 Bacteria 1630
277 Ga0395901_0496525 3300038443 Bacteria 1243
278 Ga0395901_0532139 3300038443 Bacteria 1193
279 Ga0395901_1170024 3300038443 Bacteria 736
280 Ga0436365_1000916 3300039437 Bacteria 1374
281 Ga0439436_0035825 3300041404 Bacteria 1433
282 Ga0439461_0051407 3300041410 Bacteria 915
283 Ga0451789_1338577 3300041443 Bacteria 865
284 Ga0451793_0347881 3300041452 Bacteria 1184
285 Ga0451793_1410179 3300041452 Bacteria 957
286 Ga0451798_0054451 3300041458 Bacteria 1008
287 Ga0451853_1247273 3300041512 Bacteria 1216
288 Ga0451853_1779266 3300041512 Bacteria 2227
289 Ga0451853_3965141 3300041512 Bacteria 922
290 Ga0439441_000951 3300042001 Bacteria 3531
291 Ga0439443_020341 3300042003 Bacteria 1042
292 Ga0439449_0000986 3300042007 Bacteria 11193
293 Ga0439462_0001526 3300042015 Bacteria 5182
294 Ga0439462_0014800 3300042015 Bacteria 2006
295 Ga0450911_000326 3300042115 Bacteria 17081
296 Ga0450912_010910 3300042116 Bacteria 784
297 Ga0450890_005259 3300042127 Bacteria 1667
298 Ga0450890_016597 3300042127 Bacteria 976
299 Ga0450894_005945 3300042131 Bacteria 1580
300 Ga0439446_0029755 3300042156 Bacteria 1576
301 Ga0439434_0010940 3300042435 Bacteria 2681
302 Ga0439435_0000213 3300042436 Bacteria 8167
303 Ga0439435_0087768 3300042436 Bacteria 941
304 Ga0439444_0002090 3300042437 Bacteria 2687
305 Ga0439464_0000391 3300042439 Bacteria 8579
306 Ga0439460_0000061 3300042461 Bacteria 15979
307 Ga0450893_0089253 3300042532 Bacteria 617
308 Ga0451577_0058023 3300042876 Bacteria 3450
309 Ga0451577_0073505 3300042876 Bacteria 3050
310 Ga0451577_1003124 3300042876 Bacteria 750
311 Ga0466969_0004246 3300044656 Bacteria 7619
312 Ga0466969_0093665 3300044656 Bacteria 1421
313 Ga0466972_0186785 3300044658 Bacteria 971
314 Ga0453683_0009501 3300044673 Bacteria 6491
315 Ga0466965_0013111 3300044683 Bacteria 3907
316 Ga0466966_0011669 3300044684 Bacteria 5824
317 Ga0466961_0487973 3300044693 Bacteria 744
318 Ga0466964_0243266 3300044706 Bacteria 884
319 Ga0453684_0028393 3300044712 Bacteria 7984
320 Ga0453684_0064629 3300044712 Bacteria 4673
321 Ga0453684_0272273 3300044712 Bacteria 1934
322 Ga0466959_0101488 3300045049 Bacteria 2059
323 Ga0451576_0009065 3300045051 Bacteria 11585
324 Ga0451576_0030594 3300045051 Bacteria 5753
325 Ga0451576_0313354 3300045051 Bacteria 1642
326 Ga0451576_0541479 3300045051 Bacteria 1223
327 Ga0466967_0521845 3300045976 Bacteria 1167
328 Ga0495603_0001415 3300046455 Bacteria 13954
329 Ga0495629_0003492 3300046459 Bacteria 11889
330 Ga0495653_0032278 3300046463 Bacteria 4159
331 Ga0495605_0020391 3300046474 Bacteria 3523
332 Ga0495628_0390072 3300046516 Bacteria 1019
333 Ga0495630_0100714 3300046517 Bacteria 2185
334 Ga0495642_0029055 3300046528 Bacteria 2205
335 Ga0495587_0036246 3300046536 Bacteria 2967
336 Ga0495587_0281218 3300046536 Bacteria 932
337 Ga0495598_0155276 3300046537 Bacteria 802
338 Ga0495597_0001084 3300046542 Bacteria 20670
339 Ga0495622_0020539 3300046557 Bacteria 3075
340 Ga0495656_0218545 3300046615 Bacteria 952
341 Ga0495668_0224610 3300046616 Bacteria 1028
342 Ga0495634_0029776 3300046642 Bacteria 3778
343 Ga0495625_0006078 3300046660 Bacteria 10833
344 Ga0495659_0073679 3300046664 Bacteria 1284
345 Ga0495669_0018620 3300046684 Bacteria 2988
346 Ga0495613_0175657 3300046689 Bacteria 1518
347 Ga0495670_0026269 3300046691 Bacteria 2882
348 Ga0495604_0001907 3300047317 Bacteria 16899
349 Ga0495593_0035966 3300047673 Bacteria 2686
350 Ga0495602_0136544 3300048088 Bacteria 1947
351 Ga0495614_0063215 3300048089 Bacteria 1591
352 Ga0495615_0088463 3300048090 Bacteria 860
353 Ga0496100_0020157 3300048903 Bacteria 3993
354 Ga0496101_0013720 3300048904 Bacteria 5434
355 Ga0496101_0115406 3300048904 Bacteria 2025
356 Ga0496102_0372777 3300048905 Bacteria 1343
357 Ga0496104_0041198 3300048907 Bacteria 4330
358 Ga0496105_0036862 3300048908 Bacteria 4029
359 Ga0496109_0023963 3300048912 Bacteria 5421
360 Ga0496109_0118271 3300048912 Bacteria 2467
361 Ga0496110_0112542 3300048913 Bacteria 2447
362 Ga0496110_0519672 3300048913 Bacteria 1083
363 Ga0496110_0525259 3300048913 Bacteria 1076
364 Ga0496110_0815055 3300048913 Bacteria 838
365 Ga0496113_0345147 3300048916 Bacteria 1194
366 Ga0496114_0070053 3300048917 Bacteria 2945
367 Ga0496116_0026631 3300048919 Bacteria 4224
368 Ga0496118_0138599 3300048921 Bacteria 1547
369 Ga0496121_0005472 3300048924 Bacteria 16262
370 Ga0496122_0019461 3300048925 Bacteria 6199
371 Ga0496122_0094846 3300048925 Bacteria 2018
372 Ga0496123_0036955 3300048926 Bacteria 3455
373 Ga0496124_0083464 3300048927 Bacteria 2621
374 Ga0496125_0000650 3300048928 Bacteria 58031
375 Ga0496125_0013400 3300048928 Bacteria 8063
376 Ga0496125_0020793 3300048928 Bacteria 6149
377 Ga0496125_0089300 3300048928 Bacteria 2318
378 Ga0496126_0022127 3300048929 Bacteria 6193
379 Ga0496126_0148611 3300048929 Bacteria 2010
380 Ga0501033_0083024 3300049570 Bacteria 2349
381 Ga0501034_0006383 3300049571 Bacteria 12702
382 Ga0501034_0014562 3300049571 Bacteria 8098
383 Ga0501034_0127488 3300049571 Bacteria 2530
384 Ga0501034_0164426 3300049571 Bacteria 2188
385 Ga0501034_0517775 3300049571 Bacteria 1105
386 Ga0501034_0917048 3300049571 Bacteria 763
387 Ga0501036_0410929 3300049572 Bacteria 1129
388 Ga0501037_0054057 3300049573 Bacteria 2937
389 Ga0501038_0230030 3300049574 Bacteria 1476
390 Ga0501038_0364186 3300049574 Bacteria 1124
391 Ga0501043_0128783 3300049579 Bacteria 1984
392 Ga0501046_0060251 3300049580 Bacteria 2970
393 Ga0501047_0413606 3300049581 Bacteria 1180
394 Ga0501080_0011561 3300049742 Bacteria 8084
395 Ga0501266_001085 3300049763 Bacteria 3509
396 Ga0501035_0263861 3300049822 Bacteria 1459
397 Ga0501044_0025093 3300049823 Bacteria 6322
398 Ga0501044_0103272 3300049823 Bacteria 2865
399 nmdc:mga03683_29845_c1 3300050489 Bacteria 1147
400 nmdc:mga03n38_18621_c1 3300050490 Bacteria 2744
401 nmdc:mga00v17_152266_c1 3300050491 Bacteria 1486
402 nmdc:mga00v17_209927_c1 3300050491 Bacteria 1260
403 nmdc:mga0yw44_180840_c1 3300050492 Bacteria 1388
404 nmdc:mga0k408_189263_c1 3300050493 Bacteria 1228
405 nmdc:mga0k408_65437_c1 3300050493 Bacteria 2116
406 nmdc:mga07m45_258245_c1 3300050496 Bacteria 1013
407 nmdc:mga07m45_276790_c1 3300050496 Bacteria 976
408 nmdc:mga07m45_3810_c1 3300050496 Bacteria 7297
409 nmdc:mga07m45_50739_c1 3300050496 Bacteria 2339
410 nmdc:mga08x19_591010_c1 3300050514 Bacteria 786
411 Ga0500610_0082720 3300053079 Bacteria 1672
412 Ga0495619_0122975 3300053085 Bacteria 1780
413 Ga0500593_004256 3300053117 Bacteria 5526
414 Ga0500608_018936 3300053122 Bacteria 3149
415 Ga0500618_003400 3300053125 Bacteria 5481
416 Ga0500628_002028 3300053129 Bacteria 3406
417 Ga0500604_0029300 3300053151 Bacteria 1604
418 Ga0500645_000095 3300053730 Bacteria 69280
419 Ga0500645_003284 3300053730 Bacteria 6656
420 Ga0500645_013547 3300053730 Bacteria 2615
421 Ga0590075_103250 3300059424 Bacteria 743
422 Ga0466962_0091373 3300061719 Bacteria 1459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0541479 Ga0451576_0541479_79_600 172
2 iso_pu_bacteria 2684623219 2687236457 172
3 iso_pu_bacteria 2842903701 2842907671 172
4 3300005458 Ga0070681_10448612 Ga0070681_104486122 173
5 3300026095 Ga0207676_10797725 Ga0207676_107977252 173
6 3300028379 Ga0268266_10833570 Ga0268266_108335702 173
7 3300048913 Ga0496110_0519672 Ga0496110_0519672_450_989 173
8 3300003771 Ga0055526_1022539 Ga0055526_10225392 174
9 3300005436 Ga0070713_100168528 Ga0070713_1001685282 174
10 3300009147 Ga0114129_10755264 Ga0114129_107552642 174
11 3300025928 Ga0207700_10909756 Ga0207700_109097561 174
12 3300028800 Ga0265338_10222793 Ga0265338_102227932 174
13 3300030731 Ga0316177_1193354 Ga0316177_11933543 174
14 3300030732 Ga0316176_1004864 Ga0316176_10048645 174
15 3300030742 Ga0316183_1009917 Ga0316183_100991727 174
16 3300030744 Ga0316181_1030989 Ga0316181_103098914 174
17 3300030760 Ga0265762_1080054 Ga0265762_10800541 174
18 3300031090 Ga0265760_10009529 Ga0265760_100095292 174
19 3300031251 Ga0265327_10005175 Ga0265327_100051757 174
20 3300041512 Ga0451853_3965141 Ga0451853_3965141_181_708 174
21 3300048929 Ga0496126_0148611 Ga0496126_0148611_983_1513 174
22 3300049571 Ga0501034_0006383 Ga0501034_0006383_4733_5269 174
23 3300049571 Ga0501034_0014562 Ga0501034_0014562_2389_2925 174
24 3300049571 Ga0501034_0517775 Ga0501034_0517775_134_673 174
25 3300049571 Ga0501034_0917048 Ga0501034_0917048_176_715 174
26 3300025910 Ga0207684_10661426 Ga0207684_106614262 175
27 3300031665 Ga0316575_10053982 Ga0316575_100539822 175
28 3300042876 Ga0451577_1003124 Ga0451577_1003124_125_658 175
29 3300044712 Ga0453684_0028393 Ga0453684_0028393_2492_3028 175
30 3300045051 Ga0451576_0030594 Ga0451576_0030594_3324_3860 175
31 3300049823 Ga0501044_0025093 Ga0501044_0025093_667_1209 175
32 3300048917 Ga0496114_0070053 Ga0496114_0070053_1350_1895 176
33 3300009551 Ga0105238_10008889 Ga0105238_1000888912 179
34 3300025924 Ga0207694_10009831 Ga0207694_100098311 179
35 3300025934 Ga0207686_10078564 Ga0207686_100785642 179
36 3300027312 Ga0209371_1000544 Ga0209371_100054413 179
37 3300030500 Ga0268256_1000462 Ga0268256_100046224 179
38 3300042001 Ga0439441_000951 Ga0439441_000951_819_1370 179
39 3300042003 Ga0439443_020341 Ga0439443_020341_185_736 179
40 3300042116 Ga0450912_010910 Ga0450912_010910_220_771 179
41 3300042436 Ga0439435_0000213 Ga0439435_0000213_7274_7825 179
42 3300042437 Ga0439444_0002090 Ga0439444_0002090_713_1264 179
43 3300042461 Ga0439460_0000061 Ga0439460_0000061_10962_11513 179
44 3300005435 Ga0070714_100272958 Ga0070714_1002729582 180
45 3300013308 Ga0157375_10099921 Ga0157375_100999214 180
46 3300042532 Ga0450893_0089253 Ga0450893_0089253_30_587 180
47 3300044712 Ga0453684_0272273 Ga0453684_0272273_1023_1574 180
48 3300009545 Ga0105237_11458813 Ga0105237_114588132 183
49 3300013296 Ga0157374_10000916 Ga0157374_1000091621 183
50 3300013297 Ga0157378_10445549 Ga0157378_104455493 183
51 3300041452 Ga0451793_1410179 Ga0451793_1410179_227_799 183
52 3300044712 Ga0453684_0064629 Ga0453684_0064629_2647_3213 184
53 3300037471 Ga0395905_0189361 Ga0395905_0189361_727_1332 187
54 iso_pu_bacteria 2846033681 2846034472 187
55 iso_pu_bacteria 2846037992 2846039933 187
56 3300046528 Ga0495642_0029055 Ga0495642_0029055_1477_2094 190
57 3300050493 nmdc:mga0k408_65437_c1 nmdc:mga0k408_65437_c1_27_605 190
58 iso_pu_bacteria 2513020051 2513229336 190
59 iso_pu_bacteria 2526164512 2526211877 190
60 iso_pu_bacteria 2891633521 2891636183 190
61 3300006038 Ga0075365_10171810 Ga0075365_101718103 191
62 3300028794 Ga0307515_10001134 Ga0307515_1000113422 191
63 3300031456 Ga0307513_10020664 Ga0307513_100206648 191
64 3300031649 Ga0307514_10000384 Ga0307514_1000038433 191
65 3300033180 Ga0307510_10345633 Ga0307510_103456332 191
66 iso_pu_bacteria 2643221672 2644400262 191
67 iso_pu_bacteria 2738543013 2739252333 191
68 3300003794 Ga0055531_10004572 Ga0055531_100045728 192
69 3300005439 Ga0070711_100465326 Ga0070711_1004653262 192
70 3300025273 Ga0209673_1018658 Ga0209673_10186581 192
71 3300025303 Ga0209051_1000346 Ga0209051_100034614 192
72 3300025304 Ga0209257_1000396 Ga0209257_100039655 192
73 3300028794 Ga0307515_10271168 Ga0307515_102711682 192
74 3300038443 Ga0395901_0496525 Ga0395901_0496525_49_672 192
75 3300041443 Ga0451789_1338577 Ga0451789_1338577_233_826 192
76 3300044673 Ga0453683_0009501 Ga0453683_0009501_3198_3779 192
77 3300045051 Ga0451576_0009065 Ga0451576_0009065_3693_4274 192
78 3300046684 Ga0495669_0018620 Ga0495669_0018620_1375_1986 192
79 3300049570 Ga0501033_0083024 Ga0501033_0083024_137_718 192
80 3300049574 Ga0501038_0364186 Ga0501038_0364186_426_1007 192
81 3300049822 Ga0501035_0263861 Ga0501035_0263861_419_1000 192
82 iso_pu_bacteria 2643221658 2644325010 192
83 iso_pu_bacteria 2881101125 2881105247 192
84 iso_pu_bacteria 2929160207 2929164438 192
85 iso_pu_bacteria 2939631187 2939632929 192
86 3300003784 Ga0055534_1001011 Ga0055534_10010113 193
87 3300005288 Ga0065714_10322842 Ga0065714_103228421 193
88 3300005457 Ga0070662_100084369 Ga0070662_1000843692 193
89 3300005564 Ga0070664_100022818 Ga0070664_1000228182 193
90 3300005616 Ga0068852_100878610 Ga0068852_1008786102 193
91 3300006177 Ga0075362_10022837 Ga0075362_100228372 193
92 3300006195 Ga0075366_10282701 Ga0075366_102827012 193
93 3300006353 Ga0075370_10005100 Ga0075370_100051002 193
94 3300006353 Ga0075370_10128110 Ga0075370_101281102 193
95 3300009036 Ga0105244_10003689 Ga0105244_100036892 193
96 3300009551 Ga0105238_10390613 Ga0105238_103906132 193
97 3300013100 Ga0157373_10425770 Ga0157373_104257702 193
98 3300014497 Ga0182008_10054137 Ga0182008_100541372 193
99 3300014497 Ga0182008_10146166 Ga0182008_101461662 193
100 3300014969 Ga0157376_10189461 Ga0157376_101894612 193
101 3300015261 Ga0182006_1014639 Ga0182006_10146392 193
102 3300015261 Ga0182006_1059338 Ga0182006_10593382 193
103 3300015262 Ga0182007_10019912 Ga0182007_100199122 193
104 3300025284 Ga0209130_1001369 Ga0209130_10013699 193
105 3300025291 Ga0209675_1001464 Ga0209675_100146412 193
106 3300025292 Ga0209676_1005916 Ga0209676_10059164 193
107 3300025303 Ga0209051_1026449 Ga0209051_10264493 193
108 3300025304 Ga0209257_1022213 Ga0209257_10222132 193
109 3300025728 Ga0207655_1019688 Ga0207655_10196881 193
110 3300025933 Ga0207706_10055188 Ga0207706_100551884 193
111 3300025935 Ga0207709_10049398 Ga0207709_100493983 193
112 3300025945 Ga0207679_10033708 Ga0207679_100337082 193
113 3300025981 Ga0207640_10104799 Ga0207640_101047992 193
114 3300026142 Ga0207698_10944767 Ga0207698_109447672 193
115 3300031456 Ga0307513_10072082 Ga0307513_100720825 193
116 3300031548 Ga0307408_100744277 Ga0307408_1007442772 193
117 3300035172 Ga0373955_0418997 Ga0373955_0418997_157_750 193
118 3300037466 Ga0395898_0301844 Ga0395898_0301844_217_801 193
119 3300037471 Ga0395905_0007868 Ga0395905_0007868_6282_6866 193
120 3300038443 Ga0395901_0311442 Ga0395901_0311442_173_757 193
121 3300041404 Ga0439436_0035825 Ga0439436_0035825_267_857 193
122 3300042876 Ga0451577_0073505 Ga0451577_0073505_68_655 193
123 3300045976 Ga0466967_0521845 Ga0466967_0521845_324_908 193
124 3300046459 Ga0495629_0003492 Ga0495629_0003492_5823_6443 193
125 3300046463 Ga0495653_0032278 Ga0495653_0032278_2290_2910 193
126 3300046517 Ga0495630_0100714 Ga0495630_0100714_707_1327 193
127 3300046536 Ga0495587_0036246 Ga0495587_0036246_662_1282 193
128 3300046557 Ga0495622_0020539 Ga0495622_0020539_1129_1749 193
129 3300046642 Ga0495634_0029776 Ga0495634_0029776_2622_3242 193
130 3300046660 Ga0495625_0006078 Ga0495625_0006078_9480_10100 193
131 3300046689 Ga0495613_0175657 Ga0495613_0175657_545_1165 193
132 3300047317 Ga0495604_0001907 Ga0495604_0001907_2843_3463 193
133 3300047673 Ga0495593_0035966 Ga0495593_0035966_986_1606 193
134 3300048088 Ga0495602_0136544 Ga0495602_0136544_455_1075 193
135 3300048089 Ga0495614_0063215 Ga0495614_0063215_248_868 193
136 3300048919 Ga0496116_0026631 Ga0496116_0026631_2966_3550 193
137 3300048921 Ga0496118_0138599 Ga0496118_0138599_288_872 193
138 3300048928 Ga0496125_0089300 Ga0496125_0089300_192_776 193
139 3300050493 nmdc:mga0k408_189263_c1 nmdc:mga0k408_189263_c1_105_689 193
140 3300050496 nmdc:mga07m45_3810_c1 nmdc:mga07m45_3810_c1_5148_5732 193
141 3300050496 nmdc:mga07m45_50739_c1 nmdc:mga07m45_50739_c1_299_883 193
142 3300053085 Ga0495619_0122975 Ga0495619_0122975_270_863 193
143 iso_pu_bacteria 2511231002 2511246128 193
144 iso_pu_bacteria 2721755763 2723876956 193
145 iso_pu_bacteria 2928070936 2928074659 193
146 iso_pu_bacteria 2932422444 2932424540 193
147 3300003791 Ga0055530_10019558 Ga0055530_100195582 194
148 3300003792 Ga0055540_1006712 Ga0055540_10067123 194
149 3300003794 Ga0055531_10010742 Ga0055531_100107422 194
150 3300005288 Ga0065714_10224384 Ga0065714_102243841 194
151 3300005327 Ga0070658_10181150 Ga0070658_101811503 194
152 3300005334 Ga0068869_100162399 Ga0068869_1001623992 194
153 3300005456 Ga0070678_100208195 Ga0070678_1002081951 194
154 3300005563 Ga0068855_100215316 Ga0068855_1002153162 194
155 3300005563 Ga0068855_100874684 Ga0068855_1008746842 194
156 3300005614 Ga0068856_100080170 Ga0068856_1000801703 194
157 3300005842 Ga0068858_100909078 Ga0068858_1009090782 194
158 3300009098 Ga0105245_10024044 Ga0105245_100240443 194
159 3300009176 Ga0105242_11612785 Ga0105242_116127851 194
160 3300013297 Ga0157378_10104299 Ga0157378_101042992 194
161 3300014497 Ga0182008_10002994 Ga0182008_1000299411 194
162 3300014969 Ga0157376_10001524 Ga0157376_100015242 194
163 3300015262 Ga0182007_10001355 Ga0182007_100013553 194
164 3300025292 Ga0209676_1000206 Ga0209676_1000206111 194
165 3300025298 Ga0209050_1004288 Ga0209050_100428810 194
166 3300025303 Ga0209051_1000443 Ga0209051_100044344 194
167 3300025304 Ga0209257_1000312 Ga0209257_100031225 194
168 3300025927 Ga0207687_10021086 Ga0207687_100210864 194
169 3300025940 Ga0207691_10778854 Ga0207691_107788542 194
170 3300025942 Ga0207689_10062436 Ga0207689_100624363 194
171 3300025949 Ga0207667_10192514 Ga0207667_101925141 194
172 3300025949 Ga0207667_10195532 Ga0207667_101955322 194
173 3300025960 Ga0207651_11101178 Ga0207651_111011781 194
174 3300025961 Ga0207712_10385213 Ga0207712_103852132 194
175 3300025986 Ga0207658_11195543 Ga0207658_111955431 194
176 3300026023 Ga0207677_10165574 Ga0207677_101655742 194
177 3300031911 Ga0307412_10576161 Ga0307412_105761612 194
178 3300031911 Ga0307412_10709958 Ga0307412_107099581 194
179 3300037312 Ga0395899_0025344 Ga0395899_0025344_767_1381 194
180 3300037418 Ga0395900_0037275 Ga0395900_0037275_2759_3358 194
181 3300037418 Ga0395900_0217346 Ga0395900_0217346_1292_1882 194
182 3300037418 Ga0395900_0247002 Ga0395900_0247002_893_1507 194
183 3300037466 Ga0395898_0008357 Ga0395898_0008357_7830_8444 194
184 3300037466 Ga0395898_0085610 Ga0395898_0085610_1375_1974 194
185 3300037466 Ga0395898_0951481 Ga0395898_0951481_21_611 194
186 3300037471 Ga0395905_0127642 Ga0395905_0127642_97_687 194
187 3300037471 Ga0395905_0136278 Ga0395905_0136278_689_1288 194
188 3300037471 Ga0395905_0150768 Ga0395905_0150768_1441_2031 194
189 3300037471 Ga0395905_0368451 Ga0395905_0368451_243_842 194
190 3300038443 Ga0395901_0040012 Ga0395901_0040012_2654_3268 194
191 3300038443 Ga0395901_0089490 Ga0395901_0089490_2425_3024 194
192 3300038443 Ga0395901_0115570 Ga0395901_0115570_1796_2410 194
193 3300038443 Ga0395901_0532139 Ga0395901_0532139_105_698 194
194 3300038443 Ga0395901_1170024 Ga0395901_1170024_118_708 194
195 3300041410 Ga0439461_0051407 Ga0439461_0051407_255_845 194
196 3300041512 Ga0451853_1247273 Ga0451853_1247273_221_826 194
197 3300042007 Ga0439449_0000986 Ga0439449_0000986_10099_10692 194
198 3300042015 Ga0439462_0001526 Ga0439462_0001526_383_976 194
199 3300042115 Ga0450911_000326 Ga0450911_000326_1017_1607 194
200 3300042127 Ga0450890_005259 Ga0450890_005259_678_1268 194
201 3300042131 Ga0450894_005945 Ga0450894_005945_102_692 194
202 3300042156 Ga0439446_0029755 Ga0439446_0029755_69_659 194
203 3300042435 Ga0439434_0010940 Ga0439434_0010940_1898_2488 194
204 3300042436 Ga0439435_0087768 Ga0439435_0087768_111_704 194
205 3300042439 Ga0439464_0000391 Ga0439464_0000391_792_1382 194
206 3300044658 Ga0466972_0186785 Ga0466972_0186785_139_747 194
207 3300044683 Ga0466965_0013111 Ga0466965_0013111_2647_3255 194
208 3300044706 Ga0466964_0243266 Ga0466964_0243266_225_833 194
209 3300046516 Ga0495628_0390072 Ga0495628_0390072_352_939 194
210 3300048090 Ga0495615_0088463 Ga0495615_0088463_239_826 194
211 3300048903 Ga0496100_0020157 Ga0496100_0020157_3228_3815 194
212 3300048904 Ga0496101_0115406 Ga0496101_0115406_1197_1784 194
213 3300048905 Ga0496102_0372777 Ga0496102_0372777_447_1034 194
214 3300048907 Ga0496104_0041198 Ga0496104_0041198_3310_3897 194
215 3300048908 Ga0496105_0036862 Ga0496105_0036862_353_940 194
216 3300048912 Ga0496109_0118271 Ga0496109_0118271_1143_1730 194
217 3300048913 Ga0496110_0525259 Ga0496110_0525259_449_1036 194
218 3300048916 Ga0496113_0345147 Ga0496113_0345147_262_849 194
219 3300048928 Ga0496125_0013400 Ga0496125_0013400_6126_6728 194
220 3300048928 Ga0496125_0020793 Ga0496125_0020793_2769_3359 194
221 3300050496 nmdc:mga07m45_276790_c1 nmdc:mga07m45_276790_c1_379_966 194
222 3300059424 Ga0590075_103250 Ga0590075_103250_117_710 194
223 iso_pu_bacteria 2643221652 2644292474 194
224 iso_pu_bacteria 2721755523 2722884997 194
225 iso_pu_bacteria 2738543012 2739245933 194
226 iso_pu_bacteria 2816332133 2816471648 194
227 iso_pu_bacteria 2839138175 2839139528 194
228 3300005327 Ga0070658_10204759 Ga0070658_102047593 195
229 3300005331 Ga0070670_100102721 Ga0070670_1001027212 195
230 3300005336 Ga0070680_100084082 Ga0070680_1000840822 195
231 3300005339 Ga0070660_100009091 Ga0070660_1000090916 195
232 3300005456 Ga0070678_100039356 Ga0070678_1000393564 195
233 3300005530 Ga0070679_100015954 Ga0070679_1000159543 195
234 3300005530 Ga0070679_100212552 Ga0070679_1002125522 195
235 3300005539 Ga0068853_100296322 Ga0068853_1002963221 195
236 3300005548 Ga0070665_100009860 Ga0070665_1000098608 195
237 3300005563 Ga0068855_100045597 Ga0068855_1000455973 195
238 3300005614 Ga0068856_100635719 Ga0068856_1006357192 195
239 3300005618 Ga0068864_100075968 Ga0068864_1000759684 195
240 3300005841 Ga0068863_101150803 Ga0068863_1011508031 195
241 3300006048 Ga0075363_100031180 Ga0075363_1000311803 195
242 3300006051 Ga0075364_10261733 Ga0075364_102617332 195
243 3300006051 Ga0075364_10560311 Ga0075364_105603111 195
244 3300006058 Ga0075432_10068978 Ga0075432_100689781 195
245 3300006177 Ga0075362_10115730 Ga0075362_101157302 195
246 3300006195 Ga0075366_10020941 Ga0075366_100209412 195
247 3300006195 Ga0075366_10584445 Ga0075366_105844451 195
248 3300009093 Ga0105240_10019889 Ga0105240_1001988912 195
249 3300009093 Ga0105240_10459733 Ga0105240_104597332 195
250 3300009148 Ga0105243_10000273 Ga0105243_1000027336 195
251 3300009177 Ga0105248_10477084 Ga0105248_104770842 195
252 3300009551 Ga0105238_10118799 Ga0105238_101187993 195
253 3300017792 Ga0163161_10007373 Ga0163161_100073733 195
254 3300025907 Ga0207645_10329742 Ga0207645_103297421 195
255 3300025911 Ga0207654_10092828 Ga0207654_100928282 195
256 3300025913 Ga0207695_10038483 Ga0207695_100384837 195
257 3300025913 Ga0207695_11012977 Ga0207695_110129772 195
258 3300025919 Ga0207657_10023225 Ga0207657_100232257 195
259 3300025921 Ga0207652_10116912 Ga0207652_101169123 195
260 3300025921 Ga0207652_10206641 Ga0207652_102066412 195
261 3300025924 Ga0207694_10177782 Ga0207694_101777823 195
262 3300025925 Ga0207650_10121291 Ga0207650_101212913 195
263 3300025925 Ga0207650_10177206 Ga0207650_101772062 195
264 3300025941 Ga0207711_10134717 Ga0207711_101347173 195
265 3300025942 Ga0207689_10208212 Ga0207689_102082122 195
266 3300025949 Ga0207667_10054943 Ga0207667_100549435 195
267 3300026121 Ga0207683_10149377 Ga0207683_101493772 195
268 3300026121 Ga0207683_10236212 Ga0207683_102362122 195
269 3300028379 Ga0268266_10049910 Ga0268266_100499104 195
270 3300028573 Ga0265334_10063263 Ga0265334_100632632 195
271 3300028666 Ga0265336_10000016 Ga0265336_10000016187 195
272 3300029957 Ga0265324_10001980 Ga0265324_100019803 195
273 3300031250 Ga0265331_10010425 Ga0265331_100104256 195
274 3300031250 Ga0265331_10076727 Ga0265331_100767273 195
275 3300031251 Ga0265327_10041032 Ga0265327_100410323 195
276 3300031456 Ga0307513_10000004 Ga0307513_10000004358 195
277 3300031456 Ga0307513_10372688 Ga0307513_103726882 195
278 3300031548 Ga0307408_100167786 Ga0307408_1001677862 195
279 3300031548 Ga0307408_100207709 Ga0307408_1002077091 195
280 3300031711 Ga0265314_10001258 Ga0265314_100012584 195
281 3300031731 Ga0307405_10369455 Ga0307405_103694551 195
282 3300031852 Ga0307410_10371817 Ga0307410_103718172 195
283 3300031901 Ga0307406_11164807 Ga0307406_111648071 195
284 3300032002 Ga0307416_100702453 Ga0307416_1007024532 195
285 3300032002 Ga0307416_101202872 Ga0307416_1012028722 195
286 3300032005 Ga0307411_10107716 Ga0307411_101077162 195
287 3300032126 Ga0307415_100566975 Ga0307415_1005669752 195
288 3300032126 Ga0307415_100764324 Ga0307415_1007643242 195
289 3300037312 Ga0395899_0001657 Ga0395899_0001657_8941_9540 195
290 3300037312 Ga0395899_0580910 Ga0395899_0580910_80_682 195
291 3300037418 Ga0395900_0015002 Ga0395900_0015002_1020_1619 195
292 3300037466 Ga0395898_0007796 Ga0395898_0007796_7219_7818 195
293 3300037466 Ga0395898_0085929 Ga0395898_0085929_2361_2960 195
294 3300037471 Ga0395905_0000125 Ga0395905_0000125_87874_88470 195
295 3300037471 Ga0395905_0003742 Ga0395905_0003742_8941_9540 195
296 3300037471 Ga0395905_0024071 Ga0395905_0024071_1387_1986 195
297 3300038443 Ga0395901_0127647 Ga0395901_0127647_1849_2448 195
298 3300038443 Ga0395901_0228940 Ga0395901_0228940_513_1115 195
299 3300038443 Ga0395901_0258388 Ga0395901_0258388_403_1059 195
300 3300039437 Ga0436365_1000916 Ga0436365_1000916_13_615 195
301 3300042876 Ga0451577_0058023 Ga0451577_0058023_1656_2255 195
302 3300044656 Ga0466969_0004246 Ga0466969_0004246_2067_2675 195
303 3300044684 Ga0466966_0011669 Ga0466966_0011669_3021_3629 195
304 3300044693 Ga0466961_0487973 Ga0466961_0487973_111_719 195
305 3300045049 Ga0466959_0101488 Ga0466959_0101488_257_865 195
306 3300045051 Ga0451576_0313354 Ga0451576_0313354_155_754 195
307 3300046537 Ga0495598_0155276 Ga0495598_0155276_50_649 195
308 3300046615 Ga0495656_0218545 Ga0495656_0218545_307_906 195
309 3300046616 Ga0495668_0224610 Ga0495668_0224610_13_636 195
310 3300046691 Ga0495670_0026269 Ga0495670_0026269_655_1245 195
311 3300048913 Ga0496110_0815055 Ga0496110_0815055_104_703 195
312 3300049571 Ga0501034_0164426 Ga0501034_0164426_701_1294 195
313 3300049572 Ga0501036_0410929 Ga0501036_0410929_298_891 195
314 3300049574 Ga0501038_0230030 Ga0501038_0230030_639_1232 195
315 3300049579 Ga0501043_0128783 Ga0501043_0128783_850_1443 195
316 3300049580 Ga0501046_0060251 Ga0501046_0060251_800_1393 195
317 3300049581 Ga0501047_0413606 Ga0501047_0413606_157_750 195
318 3300049742 Ga0501080_0011561 Ga0501080_0011561_6880_7473 195
319 3300049823 Ga0501044_0103272 Ga0501044_0103272_1676_2269 195
320 3300050490 nmdc:mga03n38_18621_c1 nmdc:mga03n38_18621_c1_1114_1719 195
321 3300050491 nmdc:mga00v17_152266_c1 nmdc:mga00v17_152266_c1_527_1123 195
322 3300050514 nmdc:mga08x19_591010_c1 nmdc:mga08x19_591010_c1_89_679 195
323 3300053079 Ga0500610_0082720 Ga0500610_0082720_313_906 195
324 3300053122 Ga0500608_018936 Ga0500608_018936_2166_2756 195
325 iso_pu_bacteria 2919704043 2919707595 195
326 3300006178 Ga0075367_10077227 Ga0075367_100772272 196
327 3300006946 Ga0079104_1000003 Ga0079104_1000003353 196
328 3300009092 Ga0105250_10002487 Ga0105250_100024877 196
329 3300025711 Ga0207696_1017339 Ga0207696_10173393 196
330 3300025935 Ga0207709_10000032 Ga0207709_10000032213 196
331 3300027111 Ga0209281_1000002 Ga0209281_10000021566 196
332 3300031731 Ga0307405_10103552 Ga0307405_101035522 196
333 3300031901 Ga0307406_10433337 Ga0307406_104333371 196
334 3300042127 Ga0450890_016597 Ga0450890_016597_257_859 196
335 3300046536 Ga0495587_0281218 Ga0495587_0281218_137_769 196
336 3300046664 Ga0495659_0073679 Ga0495659_0073679_347_1009 196
337 3300048924 Ga0496121_0005472 Ga0496121_0005472_3484_4083 196
338 3300050492 nmdc:mga0yw44_180840_c1 nmdc:mga0yw44_180840_c1_19_621 196
339 3300050496 nmdc:mga07m45_258245_c1 nmdc:mga07m45_258245_c1_117_719 196
340 iso_pu_bacteria 2904479285 2904480325 196
341 3300002704 JGI25155J39150_1000086 JGI25155J39150_100008617 197
342 3300002705 JGI25156J39149_1000111 JGI25156J39149_100011136 197
343 3300002738 JGI25154J39366_1000134 JGI25154J39366_100013436 197
344 3300002741 JGI25157J39369_1000152 JGI25157J39369_100015216 197
345 3300002774 JGI25150J39212_1018650 JGI25150J39212_10186502 197
346 3300002987 JGI25159J45721_1003594 JGI25159J45721_10035942 197
347 3300002987 JGI25159J45721_1005344 JGI25159J45721_10053445 197
348 3300003187 JGI25151J46595_10005412 JGI25151J46595_100054121 197
349 3300003187 JGI25151J46595_10026249 JGI25151J46595_100262492 197
350 3300003187 JGI25151J46595_10032274 JGI25151J46595_100322744 197
351 3300003354 JGI25160J50197_1000126 JGI25160J50197_100012616 197
352 3300003374 JGI25161J50226_1000087 JGI25161J50226_100008758 197
353 3300003771 Ga0055526_1010054 Ga0055526_10100543 197
354 3300003771 Ga0055526_1012937 Ga0055526_10129374 197
355 3300003773 Ga0055537_1000084 Ga0055537_10000846 197
356 3300003773 Ga0055537_1017052 Ga0055537_10170522 197
357 3300003775 Ga0055524_1000082 Ga0055524_100008235 197
358 3300003781 Ga0055536_1010665 Ga0055536_10106653 197
359 3300003781 Ga0055536_1041273 Ga0055536_10412732 197
360 3300003784 Ga0055534_1004646 Ga0055534_10046465 197
361 3300003790 Ga0055528_1002551 Ga0055528_10025519 197
362 3300003791 Ga0055530_10000690 Ga0055530_100006905 197
363 3300003792 Ga0055540_1000005 Ga0055540_1000005347 197
364 3300003794 Ga0055531_10002730 Ga0055531_100027307 197
365 3300004625 Ga0055543_1000271 Ga0055543_10002712 197
366 3300005262 Ga0065165_1023349 Ga0065165_10233492 197
367 3300005262 Ga0065165_1029052 Ga0065165_10290523 197
368 3300005262 Ga0065165_1045591 Ga0065165_10455912 197
369 3300005289 Ga0065704_10262833 Ga0065704_102628332 197
370 3300005539 Ga0068853_100098942 Ga0068853_1000989423 197
371 3300006051 Ga0075364_10047406 Ga0075364_100474063 197
372 3300014497 Ga0182008_10002002 Ga0182008_1000200216 197
373 3300025206 Ga0209435_100014 Ga0209435_100014273 197
374 3300025245 Ga0207425_1005099 Ga0207425_10050992 197
375 3300025246 Ga0209646_1000001 Ga0209646_1000001273 197
376 3300025250 Ga0209026_1000137 Ga0209026_100013717 197
377 3300025256 Ga0209759_1000013 Ga0209759_1000013273 197
378 3300025258 Ga0209129_1004380 Ga0209129_10043805 197
379 3300025263 Ga0209565_1000036 Ga0209565_100003637 197
380 3300025263 Ga0209565_1000710 Ga0209565_10007106 197
381 3300025273 Ga0209673_1000043 Ga0209673_100004355 197
382 3300025284 Ga0209130_1000042 Ga0209130_1000042224 197
383 3300025284 Ga0209130_1000151 Ga0209130_100015124 197
384 3300025291 Ga0209675_1000528 Ga0209675_100052822 197
385 3300025291 Ga0209675_1004702 Ga0209675_10047026 197
386 3300025292 Ga0209676_1000007 Ga0209676_1000007351 197
387 3300025292 Ga0209676_1005716 Ga0209676_10057165 197
388 3300025294 Ga0209025_1010814 Ga0209025_10108144 197
389 3300025294 Ga0209025_1024294 Ga0209025_10242943 197
390 3300025294 Ga0209025_1045944 Ga0209025_10459442 197
391 3300025295 Ga0209564_1000922 Ga0209564_10009223 197
392 3300025295 Ga0209564_1008919 Ga0209564_10089193 197
393 3300025295 Ga0209564_1010985 Ga0209564_10109855 197
394 3300025297 Ga0209758_1014761 Ga0209758_10147616 197
395 3300025298 Ga0209050_1000003 Ga0209050_10000031157 197
396 3300025298 Ga0209050_1010636 Ga0209050_10106363 197
397 3300025298 Ga0209050_1011124 Ga0209050_10111243 197
398 3300025299 Ga0209256_1000001 Ga0209256_10000011164 197
399 3300025302 Ga0207426_1000097 Ga0207426_1000097230 197
400 3300025302 Ga0207426_1003357 Ga0207426_100335710 197
401 3300025303 Ga0209051_1000003 Ga0209051_10000031157 197
402 3300025304 Ga0209257_1000020 Ga0209257_1000020351 197
403 3300025922 Ga0207646_10572420 Ga0207646_105724202 197
404 3300026041 Ga0207639_10059139 Ga0207639_100591393 197
405 3300027614 Ga0209970_1014326 Ga0209970_10143262 197
406 3300027876 Ga0209974_10039818 Ga0209974_100398182 197
407 3300028800 Ga0265338_10001296 Ga0265338_1000129625 197
408 3300030742 Ga0316183_1153290 Ga0316183_11532902 197
409 3300031238 Ga0265332_10000014 Ga0265332_10000014162 197
410 3300031456 Ga0307513_10001431 Ga0307513_1000143120 197
411 3300031456 Ga0307513_10428333 Ga0307513_104283332 197
412 3300031548 Ga0307408_100094940 Ga0307408_1000949402 197
413 3300031730 Ga0307516_10023286 Ga0307516_100232861 197
414 3300031730 Ga0307516_10215318 Ga0307516_102153181 197
415 3300031824 Ga0307413_10723261 Ga0307413_107232612 197
416 3300031901 Ga0307406_10026913 Ga0307406_100269134 197
417 3300041452 Ga0451793_0347881 Ga0451793_0347881_356_961 197
418 3300041458 Ga0451798_0054451 Ga0451798_0054451_320_913 197
419 3300041512 Ga0451853_1779266 Ga0451853_1779266_152_745 197
420 3300042015 Ga0439462_0014800 Ga0439462_0014800_492_1121 197
421 3300044656 Ga0466969_0093665 Ga0466969_0093665_45_656 197
422 3300046455 Ga0495603_0001415 Ga0495603_0001415_10929_11600 197
423 3300046474 Ga0495605_0020391 Ga0495605_0020391_168_863 197
424 3300046542 Ga0495597_0001084 Ga0495597_0001084_1691_2299 197
425 3300048904 Ga0496101_0013720 Ga0496101_0013720_4013_4615 197
426 3300048912 Ga0496109_0023963 Ga0496109_0023963_1634_2248 197
427 3300048913 Ga0496110_0112542 Ga0496110_0112542_1132_1755 197
428 3300048925 Ga0496122_0019461 Ga0496122_0019461_1311_1931 197
429 3300048925 Ga0496122_0094846 Ga0496122_0094846_1091_1705 197
430 3300048926 Ga0496123_0036955 Ga0496123_0036955_2539_3153 197
431 3300048927 Ga0496124_0083464 Ga0496124_0083464_32_652 197
432 3300048928 Ga0496125_0000650 Ga0496125_0000650_15259_15879 197
433 3300048929 Ga0496126_0022127 Ga0496126_0022127_1325_1945 197
434 3300049571 Ga0501034_0127488 Ga0501034_0127488_1853_2458 197
435 3300049573 Ga0501037_0054057 Ga0501037_0054057_416_1021 197
436 3300049763 Ga0501266_001085 Ga0501266_001085_2440_3048 197
437 3300050489 nmdc:mga03683_29845_c1 nmdc:mga03683_29845_c1_494_1087 197
438 3300050491 nmdc:mga00v17_209927_c1 nmdc:mga00v17_209927_c1_172_765 197
439 3300053117 Ga0500593_004256 Ga0500593_004256_1862_2458 197
440 3300053125 Ga0500618_003400 Ga0500618_003400_1763_2467 197
441 3300053129 Ga0500628_002028 Ga0500628_002028_1963_2568 197
442 3300053151 Ga0500604_0029300 Ga0500604_0029300_181_777 197
443 3300053730 Ga0500645_000095 Ga0500645_000095_3896_4492 197
444 3300053730 Ga0500645_003284 Ga0500645_003284_2695_3300 197
445 3300053730 Ga0500645_013547 Ga0500645_013547_1240_1854 197
446 3300061719 Ga0466962_0091373 Ga0466962_0091373_657_1268 197
447 iso_pu_bacteria 2808606384 2808969982 197
448 iso_pu_bacteria 2894023352 2894024748 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

30

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1di7-assembly1.cif.gz_A 1.60 angstrom crystal structure of the molybdenum cofactor biosynthesis protein moga from escherichia coli 0.9824 7 194
1di6-assembly1.cif.gz_A 1.45 a crystal structure of the molybdenumm cofactor biosynthesis protein moga from escherichia coli 0.9817 7 194
3mcj-assembly2.cif.gz_D crystal structure of molybdenum cofactor biosynthesis (aq_061) other form from aquifex aeolicus vf5 0.9722 8 190
1di7-assembly1.cif.gz_A 1.60 angstrom crystal structure of the molybdenum cofactor biosynthesis protein moga from escherichia coli 0.972 7 194
1di6-assembly1.cif.gz_A 1.45 a crystal structure of the molybdenumm cofactor biosynthesis protein moga from escherichia coli 0.9711 7 194
ID Description Score Start End Superfamily
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9817 7 194 3.40.980.10
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9711 7 194 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9516 5 173 3.40.980.10
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9468 3 190 3.40.980.10
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9442 8 144 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0S9NQF0-F1-model_v4 MoaB/Mog domain-containing protein 0.9972 4 195 GO:0006777
AF-A0A369ARQ8-F1-model_v4 Molybdopterin adenylyltransferase 0.9961 2 194 GO:0006777
GO:0016779
AF-A0A3N9QCW8-F1-model_v4 deleted 0.9956 3 190
AF-A0A0S9M5U1-F1-model_v4 MoaB/Mog domain-containing protein 0.9953 4 197 GO:0006777
AF-A0A7V7XA31-F1-model_v4 deleted 0.9953 28 197

Feature Viewer

pLDDT pTM Quality
93.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map