F446107

General Info

Members Datasets Scaffolds Average Seq Length
448 280 896 173

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100127432|Ga0070713_1001274324
Length 205
Sequence MDVVAALAPGLTGGAHCTVTDAPSNRVATSRASRSGVPTSDAELMRALHDQHARALWSYAVHLTGGDRARAEDVVQETMLRAWKHPQVLDQSEGSARAWLFTVARRIVIDDWRTSRSRHEVVTAEPPELQVADPTAGTADAAVVTAALRQLSIEHRQVILECYYRGSSVAEAARRLGVPEGTVKSRAHYALRALRLALDELGGVR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 2643221561 Nocardioides sp. Root151 Isolate Unclassified
279 2643221696 Nocardioides sp. Root140 Isolate Unclassified
280 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.3
Metatranscriptomes 6.03
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 7.81
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100127432 3300005436 Bacteria 2241
2 Ga0058859_10879164 3300004798 Bacteria 976
3 Ga0058861_11844891 3300004800 Bacteria 1222
4 Ga0058860_11970695 3300004801 Bacteria 1230
5 Ga0058862_12463978 3300004803 Bacteria 1751
6 Ga0070658_10015103 3300005327 Bacteria 6180
7 Ga0070683_100343486 3300005329 Bacteria 1421
8 Ga0070690_100061141 3300005330 Bacteria 2426
9 Ga0068869_100006727 3300005334 Bacteria 7305
10 Ga0068869_100094027 3300005334 Bacteria 2259
11 Ga0070680_100028124 3300005336 Bacteria 4509
12 Ga0070680_100125051 3300005336 Bacteria 2148
13 Ga0070682_100010958 3300005337 Bacteria 5166
14 Ga0068868_100002983 3300005338 Bacteria 11759
15 Ga0070660_100213069 3300005339 Bacteria 1569
16 Ga0070660_100473091 3300005339 Bacteria 1041
17 Ga0070660_100480582 3300005339 Bacteria 1032
18 Ga0070660_100498605 3300005339 Bacteria 1013
19 Ga0070691_10012173 3300005341 Bacteria 3939
20 Ga0070687_100123982 3300005343 Bacteria 1482
21 Ga0070661_100250535 3300005344 Bacteria 1366
22 Ga0070692_10042608 3300005345 Bacteria 2331
23 Ga0070668_100061443 3300005347 Bacteria 2910
24 Ga0070675_100535338 3300005354 Bacteria 1058
25 Ga0070674_100031324 3300005356 Bacteria 3524
26 Ga0070673_100074608 3300005364 Bacteria 2734
27 Ga0070688_101069074 3300005365 Bacteria 644
28 Ga0070659_100104019 3300005366 Bacteria 2287
29 Ga0070659_100271579 3300005366 Bacteria 1409
30 Ga0070667_100050588 3300005367 Bacteria 3503
31 Ga0070703_10073764 3300005406 Bacteria 1146
32 Ga0070709_10011280 3300005434 Bacteria 4974
33 Ga0070714_100324759 3300005435 Bacteria 1440
34 Ga0070714_100757275 3300005435 Bacteria 939
35 Ga0070714_100980922 3300005435 Bacteria 822
36 Ga0070713_100006071 3300005436 Bacteria 8327
37 Ga0070710_10186387 3300005437 Bacteria 1302
38 Ga0070701_10019335 3300005438 Bacteria 3216
39 Ga0070711_100219656 3300005439 Bacteria 1476
40 Ga0070705_100006250 3300005440 Bacteria 5834
41 Ga0070700_100005376 3300005441 Bacteria 6781
42 Ga0070694_100038875 3300005444 Bacteria 3164
43 Ga0070663_100004408 3300005455 Bacteria 8274
44 Ga0070678_100200415 3300005456 Unclassified 1647
45 Ga0070678_100209168 3300005456 Bacteria 1615
46 Ga0070662_100010666 3300005457 Bacteria 6045
47 Ga0070681_10118479 3300005458 Bacteria 2584
48 Ga0070681_10244263 3300005458 Bacteria 1708
49 Ga0070681_10337702 3300005458 Bacteria 1416
50 Ga0070685_10009688 3300005466 Bacteria 4987
51 Ga0070698_100947150 3300005471 Bacteria 807
52 Ga0070699_100479382 3300005518 Bacteria 1129
53 Ga0070679_100008643 3300005530 Bacteria 9595
54 Ga0070679_100155802 3300005530 Bacteria 2259
55 Ga0070679_100282764 3300005530 Bacteria 1611
56 Ga0070684_100075746 3300005535 Bacteria 2968
57 Ga0070684_100245167 3300005535 Bacteria 1637
58 Ga0070684_100599961 3300005535 Bacteria 1024
59 Ga0070697_100274947 3300005536 Bacteria 1444
60 Ga0068853_100004965 3300005539 Bacteria 10367
61 Ga0070672_100427493 3300005543 Bacteria 1138
62 Ga0070686_100001961 3300005544 Bacteria 11425
63 Ga0070696_100011642 3300005546 Bacteria 5893
64 Ga0070665_100217573 3300005548 Bacteria 1911
65 Ga0070665_100280836 3300005548 Bacteria 1667
66 Ga0070704_100020388 3300005549 Bacteria 4273
67 Ga0068855_100001894 3300005563 Bacteria 25943
68 Ga0068855_100037263 3300005563 Bacteria 5785
69 Ga0070664_100087343 3300005564 Bacteria 2696
70 Ga0068857_100080827 3300005577 Bacteria 2902
71 Ga0068854_100096271 3300005578 Bacteria 2211
72 Ga0068856_100008297 3300005614 Bacteria 10124
73 Ga0068856_100070832 3300005614 Bacteria 3450
74 Ga0068856_100154386 3300005614 Bacteria 2305
75 Ga0070702_100001033 3300005615 Bacteria 11049
76 Ga0068852_100024449 3300005616 Bacteria 4882
77 Ga0068859_100372878 3300005617 Bacteria 1523
78 Ga0068864_100270420 3300005618 Bacteria 1583
79 Ga0068866_10024881 3300005718 Bacteria 2808
80 Ga0068861_100021178 3300005719 Bacteria 4672
81 Ga0068863_100137271 3300005841 Bacteria 2336
82 Ga0068858_100011577 3300005842 Bacteria 8319
83 Ga0068862_100047849 3300005844 Bacteria 3650
84 Ga0081455_10005680 3300005937 Bacteria 13614
85 Ga0081540_1001979 3300005983 Bacteria 17094
86 Ga0081540_1015176 3300005983 Bacteria 4889
87 Ga0070717_10002850 3300006028 Bacteria 12261
88 Ga0070715_10013996 3300006163 Bacteria 2960
89 Ga0070716_100005595 3300006173 Bacteria 6100
90 Ga0070712_100612115 3300006175 Bacteria 923
91 Ga0097621_100012803 3300006237 Bacteria 6231
92 Ga0068871_100014988 3300006358 Bacteria 5796
93 Ga0075428_100034545 3300006844 Bacteria 5576
94 Ga0075430_100017371 3300006846 Bacteria 6128
95 Ga0075430_100162124 3300006846 Bacteria 1861
96 Ga0075431_100009056 3300006847 Bacteria 9983
97 Ga0075431_100321173 3300006847 Bacteria 1561
98 Ga0075433_10004265 3300006852 Bacteria 11103
99 Ga0075433_10123548 3300006852 Bacteria 2300
100 Ga0075434_100008502 3300006871 Bacteria 9547
101 Ga0075434_100049197 3300006871 Bacteria 4185
102 Ga0075429_100001044 3300006880 Bacteria 22126
103 Ga0075429_100086111 3300006880 Bacteria 2739
104 Ga0075429_100204110 3300006880 Bacteria 1732
105 Ga0068865_100051257 3300006881 Bacteria 2856
106 Ga0075436_100010396 3300006914 Bacteria 6378
107 Ga0075436_100012397 3300006914 Bacteria 5845
108 Ga0097620_100372904 3300006931 Bacteria 1523
109 Ga0075435_100006633 3300007076 Bacteria 8201
110 Ga0075435_100013995 3300007076 Bacteria 5983
111 Ga0105244_10108619 3300009036 Bacteria 1351
112 Ga0105240_10064067 3300009093 Bacteria 4569
113 Ga0105240_10151769 3300009093 Bacteria 2759
114 Ga0111539_10070061 3300009094 Bacteria 4139
115 Ga0105245_10004630 3300009098 Bacteria 12149
116 Ga0105245_10556481 3300009098 Bacteria 1169
117 Ga0105247_10004474 3300009101 Bacteria 8914
118 Ga0105247_10013172 3300009101 Bacteria 4962
119 Ga0114129_10014314 3300009147 Bacteria 11306
120 Ga0114129_10602239 3300009147 Bacteria 1423
121 Ga0114129_10656774 3300009147 Bacteria 1353
122 Ga0105243_10127426 3300009148 Bacteria 2155
123 Ga0105241_10005975 3300009174 Bacteria 8979
124 Ga0105242_10006178 3300009176 Bacteria 9227
125 Ga0105242_10106967 3300009176 Bacteria 2378
126 Ga0105237_10009477 3300009545 Bacteria 10430
127 Ga0105237_10035579 3300009545 Bacteria 5039
128 Ga0105237_10095068 3300009545 Bacteria 2969
129 Ga0105237_10269386 3300009545 Bacteria 1706
130 Ga0105238_10040812 3300009551 Bacteria 4701
131 Ga0105238_10145225 3300009551 Bacteria 2349
132 Ga0105249_10000724 3300009553 Bacteria 30062
133 Ga0105239_10027539 3300010375 Bacteria 6255
134 Ga0105239_10030711 3300010375 Bacteria 5909
135 Ga0105239_10753998 3300010375 Bacteria 1114
136 Ga0105246_10006843 3300011119 Bacteria 6971
137 Ga0157371_10175488 3300013102 Bacteria 1532
138 Ga0157370_10050302 3300013104 Bacteria 3983
139 Ga0157370_10491494 3300013104 Bacteria 1127
140 Ga0157370_11014072 3300013104 Bacteria 751
141 Ga0157369_10010548 3300013105 Bacteria 10515
142 Ga0157369_10010747 3300013105 Bacteria 10421
143 Ga0157369_10012138 3300013105 Bacteria 9783
144 Ga0157369_10013666 3300013105 Bacteria 9180
145 Ga0157369_11111098 3300013105 Bacteria 808
146 Ga0157369_11341731 3300013105 Bacteria 729
147 Ga0157374_10006979 3300013296 Bacteria 9611
148 Ga0157378_10101381 3300013297 Bacteria 2629
149 Ga0163162_10005227 3300013306 Bacteria 12516
150 Ga0157372_10162249 3300013307 Bacteria 2583
151 Ga0163163_10400199 3300014325 Bacteria 1431
152 Ga0157380_10006888 3300014326 Bacteria 8036
153 Ga0182008_10364624 3300014497 Bacteria 769
154 Ga0157377_10026506 3300014745 Bacteria 3102
155 Ga0157379_10018019 3300014968 Bacteria 6223
156 Ga0157376_10003301 3300014969 Bacteria 11103
157 Ga0163161_10003514 3300017792 Bacteria 10970
158 Ga0197907_10077700 3300020069 Bacteria 1280
159 Ga0197907_10109127 3300020069 Bacteria 765
160 Ga0197907_10658548 3300020069 Bacteria 2311
161 Ga0206356_10032357 3300020070 Bacteria 2424
162 Ga0206356_11584288 3300020070 Bacteria 1264
163 Ga0206349_1627240 3300020075 Bacteria 1860
164 Ga0206355_1688975 3300020076 Bacteria 1448
165 Ga0206351_10002270 3300020077 Bacteria 1966
166 Ga0206352_10672896 3300020078 Bacteria 1623
167 Ga0206352_10797809 3300020078 Bacteria 782
168 Ga0206350_11089449 3300020080 Bacteria 1282
169 Ga0206354_10018434 3300020081 Bacteria 2537
170 Ga0206354_10318259 3300020081 Bacteria 1687
171 Ga0206354_10731265 3300020081 Bacteria 2262
172 Ga0206354_11327251 3300020081 Bacteria 886
173 Ga0206353_11341863 3300020082 Bacteria 852
174 Ga0206353_11467684 3300020082 Unclassified 972
175 Ga0206353_11693350 3300020082 Bacteria 4556
176 Ga0206353_11808677 3300020082 Bacteria 960
177 Ga0213876_10033032 3300021384 Bacteria 2728
178 Ga0224712_10018279 3300022467 Bacteria 2340
179 Ga0224712_10020306 3300022467 Bacteria 2252
180 Ga0224712_10051219 3300022467 Bacteria 1607
181 Ga0224712_10129766 3300022467 Bacteria 1100
182 Ga0207653_10037920 3300025885 Bacteria 1573
183 Ga0207642_10824004 3300025899 Bacteria 591
184 Ga0207710_10006732 3300025900 Bacteria 4898
185 Ga0207710_10021011 3300025900 Bacteria 2795
186 Ga0207688_10001308 3300025901 Bacteria 12926
187 Ga0207680_10040933 3300025903 Bacteria 2700
188 Ga0207647_10094791 3300025904 Bacteria 1777
189 Ga0207647_10294081 3300025904 Bacteria 926
190 Ga0207685_10009016 3300025905 Bacteria 2877
191 Ga0207699_10187210 3300025906 Bacteria 1395
192 Ga0207643_10023782 3300025908 Bacteria 3380
193 Ga0207705_10023298 3300025909 Bacteria 4417
194 Ga0207705_10104047 3300025909 Bacteria 2091
195 Ga0207654_10035543 3300025911 Bacteria 2777
196 Ga0207654_10331813 3300025911 Bacteria 1043
197 Ga0207707_10083268 3300025912 Bacteria 2793
198 Ga0207707_10266943 3300025912 Bacteria 1484
199 Ga0207695_10158350 3300025913 Bacteria 2198
200 Ga0207695_10257809 3300025913 Bacteria 1642
201 Ga0207671_10077260 3300025914 Bacteria 2492
202 Ga0207671_10146014 3300025914 Bacteria 1825
203 Ga0207671_10189166 3300025914 Bacteria 1605
204 Ga0207671_10558333 3300025914 Bacteria 913
205 Ga0207693_10004181 3300025915 Bacteria 12245
206 Ga0207693_10533909 3300025915 Bacteria 915
207 Ga0207663_10153606 3300025916 Bacteria 1617
208 Ga0207660_10037416 3300025917 Bacteria 3381
209 Ga0207660_10091462 3300025917 Bacteria 2257
210 Ga0207662_10011020 3300025918 Bacteria 5003
211 Ga0207657_10005486 3300025919 Bacteria 13247
212 Ga0207657_10074713 3300025919 Bacteria 2861
213 Ga0207657_10186785 3300025919 Bacteria 1673
214 Ga0207657_10301443 3300025919 Bacteria 1269
215 Ga0207657_10321800 3300025919 Bacteria 1223
216 Ga0207652_10085623 3300025921 Bacteria 2762
217 Ga0207652_10126468 3300025921 Bacteria 2277
218 Ga0207652_10209994 3300025921 Bacteria 1753
219 Ga0207652_10982722 3300025921 Bacteria 743
220 Ga0207687_10017868 3300025927 Bacteria 4680
221 Ga0207700_10015656 3300025928 Bacteria 5012
222 Ga0207700_10241936 3300025928 Bacteria 1538
223 Ga0207664_10226619 3300025929 Bacteria 1623
224 Ga0207664_10250208 3300025929 Bacteria 1546
225 Ga0207664_10444986 3300025929 Bacteria 1156
226 Ga0207664_10571356 3300025929 Bacteria 1015
227 Ga0207644_10038350 3300025931 Bacteria 3375
228 Ga0207690_10139514 3300025932 Bacteria 1784
229 Ga0207706_10051790 3300025933 Bacteria 3625
230 Ga0207686_10082160 3300025934 Bacteria 2105
231 Ga0207709_10622463 3300025935 Bacteria 857
232 Ga0207704_10055165 3300025938 Bacteria 2427
233 Ga0207665_10002005 3300025939 Bacteria 13721
234 Ga0207691_10055228 3300025940 Bacteria 3620
235 Ga0207711_10122022 3300025941 Bacteria 2327
236 Ga0207689_10004597 3300025942 Bacteria 12488
237 Ga0207661_10409365 3300025944 Bacteria 1231
238 Ga0207679_10111355 3300025945 Bacteria 2161
239 Ga0207667_10013432 3300025949 Bacteria 9370
240 Ga0207667_10055319 3300025949 Bacteria 4171
241 Ga0207712_10006229 3300025961 Bacteria 7518
242 Ga0207668_10030217 3300025972 Bacteria 3559
243 Ga0207640_10739120 3300025981 Bacteria 847
244 Ga0207658_10112868 3300025986 Bacteria 2152
245 Ga0207677_10023064 3300026023 Bacteria 3837
246 Ga0207703_10408406 3300026035 Bacteria 1261
247 Ga0207639_10016235 3300026041 Bacteria 5263
248 Ga0207678_10001227 3300026067 Bacteria 23601
249 Ga0207708_10025709 3300026075 Bacteria 4455
250 Ga0207702_10099159 3300026078 Bacteria 2568
251 Ga0207702_10181155 3300026078 Bacteria 1940
252 Ga0207702_10341174 3300026078 Bacteria 1431
253 Ga0207702_10722661 3300026078 Bacteria 982
254 Ga0207641_10071620 3300026088 Bacteria 2982
255 Ga0207648_10309554 3300026089 Bacteria 1418
256 Ga0207676_10068294 3300026095 Bacteria 2842
257 Ga0207674_10108986 3300026116 Bacteria 2746
258 Ga0207675_100030773 3300026118 Bacteria 4999
259 Ga0207683_10002660 3300026121 Bacteria 15605
260 Ga0207698_10678664 3300026142 Bacteria 1023
261 Ga0207698_10849394 3300026142 Bacteria 918
262 Ga0268265_10049044 3300028380 Bacteria 3174
263 Ga0307515_10135972 3300028794 Bacteria 2673
264 Ga0307513_10000085 3300031456 Bacteria 131110
265 Ga0307415_101696667 3300032126 Bacteria 609
266 Ga0373930_0009452 3300034816 Bacteria 1725
267 Ga0373950_0005938 3300034818 Bacteria 1842
268 Ga0373938_0001986 3300034957 Bacteria 3279
269 Ga0373949_0017540 3300035090 Bacteria 1615
270 Ga0373951_0011207 3300035091 Bacteria 2011
271 Ga0373952_0008354 3300035092 Bacteria 1963
272 Ga0373932_0029610 3300035112 Bacteria 1512
273 Ga0373960_0033106 3300035121 Bacteria 1455
274 Ga0373955_0307943 3300035172 Bacteria 956
275 Ga0373961_0013708 3300035241 Bacteria 2048
276 Ga0373962_0001463 3300035242 Bacteria 5584
277 Ga0373931_0014238 3300035691 Bacteria 3884
278 Ga0373927_0499257 3300035695 Bacteria 804
279 Ga0373937_0182480 3300036401 Bacteria 1971
280 Ga0395900_0088576 3300037418 Bacteria 3182
281 Ga0436365_0671926 3300039437 Bacteria 2728
282 Ga0451798_0162887 3300041458 Unclassified 930
283 Ga0451800_1601244 3300041459 Bacteria 1979
284 Ga0451853_3328068 3300041512 Unclassified 698
285 Ga0466969_0011807 3300044656 Bacteria 4620
286 Ga0466972_0034383 3300044658 Bacteria 2484
287 Ga0466965_0211140 3300044683 Bacteria 1032
288 Ga0466966_0009963 3300044684 Bacteria 6298
289 Ga0466966_0083288 3300044684 Bacteria 1990
290 Ga0466966_0119150 3300044684 Bacteria 1623
291 Ga0466966_0172580 3300044684 Bacteria 1313
292 Ga0466966_0180915 3300044684 Bacteria 1279
293 Ga0466966_0253932 3300044684 Bacteria 1059
294 Ga0466966_0743168 3300044684 Bacteria 591
295 Ga0466961_0007532 3300044693 Bacteria 6926
296 Ga0466961_0039888 3300044693 Bacteria 3010
297 Ga0466961_0177765 3300044693 Bacteria 1322
298 Ga0466961_0232036 3300044693 Bacteria 1135
299 Ga0466961_0310999 3300044693 Bacteria 961
300 Ga0466961_0412980 3300044693 Bacteria 818
301 Ga0466963_0001782 3300044694 Bacteria 11716
302 Ga0466963_0004806 3300044694 Bacteria 7874
303 Ga0466963_0014433 3300044694 Bacteria 4871
304 Ga0466963_0018612 3300044694 Bacteria 4345
305 Ga0466963_0022574 3300044694 Bacteria 3986
306 Ga0466963_0086387 3300044694 Bacteria 2131
307 Ga0466963_0325763 3300044694 Bacteria 1081
308 Ga0466964_0038799 3300044706 Bacteria 1916
309 Ga0466971_0010047 3300044719 Bacteria 4134
310 Ga0466971_0022074 3300044719 Bacteria 2834
311 Ga0466971_0082675 3300044719 Bacteria 1466
312 Ga0466971_0090452 3300044719 Bacteria 1401
313 Ga0466971_0210181 3300044719 Bacteria 920
314 Ga0466968_0251195 3300044735 Bacteria 840
315 Ga0466968_0350863 3300044735 Bacteria 717
316 Ga0466970_0041402 3300044765 Bacteria 2448
317 Ga0466970_0462007 3300044765 Bacteria 728
318 Ga0466957_0010080 3300044842 Bacteria 5407
319 Ga0466957_0018398 3300044842 Bacteria 4103
320 Ga0466957_0034216 3300044842 Bacteria 3049
321 Ga0466957_0064134 3300044842 Bacteria 2260
322 Ga0466957_0070973 3300044842 Bacteria 2153
323 Ga0466957_0110653 3300044842 Bacteria 1741
324 Ga0466957_0697142 3300044842 Bacteria 716
325 Ga0466960_0003605 3300044901 Bacteria 5975
326 Ga0466960_0064530 3300044901 Bacteria 1806
327 Ga0466959_0007717 3300045049 Bacteria 7560
328 Ga0466959_0029100 3300045049 Bacteria 4093
329 Ga0466959_0036894 3300045049 Bacteria 3611
330 Ga0466959_0106450 3300045049 Bacteria 2005
331 Ga0466959_0239276 3300045049 Bacteria 1254
332 Ga0466959_0303143 3300045049 Bacteria 1094
333 Ga0466959_0862315 3300045049 Bacteria 604
334 Ga0466958_0004306 3300045836 Bacteria 7497
335 Ga0466958_0005042 3300045836 Bacteria 7053
336 Ga0466958_0152641 3300045836 Bacteria 1457
337 Ga0466958_0160108 3300045836 Bacteria 1422
338 Ga0466958_0163696 3300045836 Bacteria 1406
339 Ga0466958_0172354 3300045836 Bacteria 1370
340 Ga0466967_0000184 3300045976 Bacteria 25866
341 Ga0466967_0003319 3300045976 Bacteria 10451
342 Ga0466967_0037138 3300045976 Bacteria 4165
343 Ga0466967_0038494 3300045976 Bacteria 4102
344 Ga0466967_0054764 3300045976 Bacteria 3512
345 Ga0466967_0104283 3300045976 Bacteria 2595
346 Ga0466967_0330754 3300045976 Bacteria 1471
347 Ga0466967_1308777 3300045976 Bacteria 722
348 Ga0495667_0595651 3300046559 Bacteria 689
349 Ga0496100_0285786 3300048903 Bacteria 1231
350 Ga0496101_0050655 3300048904 Bacteria 2990
351 Ga0496101_0230981 3300048904 Bacteria 1438
352 Ga0496101_0296737 3300048904 Bacteria 1265
353 Ga0496102_0000439 3300048905 Bacteria 47479
354 Ga0496102_0000474 3300048905 Bacteria 44502
355 Ga0496103_0000976 3300048906 Bacteria 20250
356 Ga0496104_0159528 3300048907 Bacteria 2164
357 Ga0496104_0525354 3300048907 Bacteria 1094
358 Ga0496105_0024144 3300048908 Bacteria 4937
359 Ga0496105_0033751 3300048908 Bacteria 4205
360 Ga0496106_0005816 3300048909 Bacteria 9116
361 Ga0496106_0665747 3300048909 Bacteria 831
362 Ga0496107_0174397 3300048910 Bacteria 1596
363 Ga0496108_0102722 3300048911 Bacteria 2439
364 Ga0496109_0015583 3300048912 Bacteria 6628
365 Ga0496109_0753239 3300048912 Bacteria 912
366 Ga0496110_0032008 3300048913 Bacteria 4540
367 Ga0496110_0208657 3300048913 Bacteria 1776
368 Ga0496110_0296163 3300048913 Bacteria 1474
369 Ga0496111_0008176 3300048914 Bacteria 6915
370 Ga0496112_0060819 3300048915 Bacteria 3722
371 Ga0496113_0010593 3300048916 Bacteria 6102
372 Ga0496113_0670353 3300048916 Bacteria 829
373 Ga0496114_0003092 3300048917 Bacteria 12756
374 Ga0496114_0003580 3300048917 Bacteria 11933
375 Ga0496114_0004585 3300048917 Bacteria 10730
376 Ga0496114_0161661 3300048917 Bacteria 1948
377 Ga0496114_0641805 3300048917 Bacteria 934
378 Ga0496114_1578133 3300048917 Bacteria 544
379 Ga0496115_0132579 3300048918 Bacteria 2054
380 Ga0496115_0158703 3300048918 Bacteria 1869
381 Ga0496115_0439826 3300048918 Bacteria 1054
382 Ga0496117_0053975 3300048920 Bacteria 2819
383 Ga0496118_0007091 3300048921 Bacteria 12029
384 Ga0496119_0008097 3300048922 Bacteria 9316
385 Ga0496121_0289001 3300048924 Bacteria 1118
386 Ga0501031_0035791 3300049568 Bacteria 3239
387 Ga0501033_0234724 3300049570 Bacteria 1302
388 Ga0501034_0846985 3300049571 Bacteria 805
389 Ga0501036_0028635 3300049572 Bacteria 4707
390 Ga0501037_0169960 3300049573 Bacteria 1550
391 Ga0501038_0080520 3300049574 Bacteria 2745
392 Ga0501039_0015584 3300049575 Bacteria 5817
393 Ga0501040_0099222 3300049576 Bacteria 2030
394 Ga0501041_0047305 3300049577 Bacteria 2618
395 Ga0501042_0004994 3300049578 Bacteria 8498
396 Ga0501043_0151493 3300049579 Bacteria 1815
397 Ga0501046_0349179 3300049580 Bacteria 1074
398 Ga0501046_0566374 3300049580 Bacteria 809
399 Ga0501047_0336217 3300049581 Bacteria 1348
400 Ga0501047_0934873 3300049581 Bacteria 680
401 Ga0501048_0049834 3300049582 Bacteria 2983
402 Ga0501069_0598202 3300049585 Bacteria 662
403 Ga0501070_0165441 3300049586 Bacteria 1823
404 Ga0501070_0486687 3300049586 Bacteria 992
405 Ga0501071_0043902 3300049587 Bacteria 3206
406 Ga0501073_0358160 3300049589 Bacteria 1007
407 Ga0501074_0089973 3300049590 Bacteria 2198
408 Ga0501075_0077781 3300049591 Bacteria 2510
409 Ga0501076_0005236 3300049592 Bacteria 9298
410 Ga0501077_0033103 3300049593 Bacteria 3291
411 Ga0501079_0087663 3300049741 Bacteria 2409
412 Ga0501080_0031804 3300049742 Bacteria 4917
413 Ga0501080_0300871 3300049742 Bacteria 1455
414 Ga0501081_0053691 3300049743 Bacteria 2782
415 Ga0501083_0152271 3300049744 Bacteria 1514
416 Ga0501035_0014668 3300049822 Bacteria 7235
417 Ga0501044_0084013 3300049823 Bacteria 3218
418 Ga0501044_0300766 3300049823 Bacteria 1533
419 Ga0501045_0029195 3300049824 Bacteria 3984
420 nmdc:mga05p37_486339_c1 3300050507 Bacteria 1420
421 nmdc:mga05p37_6871_c1 3300050507 Bacteria 13412
422 nmdc:mga05p37_731417_c1 3300050507 Bacteria 1094
423 nmdc:mga09592_237441_c1 3300050508 Bacteria 1579
424 nmdc:mga09592_8504_c1 3300050508 Bacteria 8346
425 nmdc:mga09592_90711_c1 3300050508 Bacteria 2611
426 nmdc:mga0qj67_151705_c1 3300050509 Bacteria 1880
427 nmdc:mga0qj67_2006_c1 3300050509 Bacteria 14507
428 nmdc:mga06r32_17351_c1 3300050510 Bacteria 6571
429 nmdc:mga06r32_393710_c1 3300050510 Bacteria 1368
430 nmdc:mga08y16_297030_c1 3300050511 Bacteria 1665
431 nmdc:mga0n895_535721_c1 3300050512 Bacteria 1178
432 nmdc:mga0rr50_95969_c1 3300050513 Bacteria 2319
433 nmdc:mga08x19_25489_c1 3300050514 Bacteria 3683
434 nmdc:mga08x19_56275_c1 3300050514 Bacteria 2538
435 nmdc:mga0a205_141692_c1 3300050515 Bacteria 2304
436 nmdc:mga0a205_148195_c1 3300050515 Bacteria 2247
437 Ga0500644_0266125 3300053088 Bacteria 726
438 Ga0500604_0036696 3300053151 Bacteria 1462
439 Ga0500616_0001294 3300053153 Bacteria 24859
440 Ga0501084_0148589 3300054114 Bacteria 1974
441 Ga0501082_0061859 3300060353 Bacteria 3222
442 Ga0466962_0003314 3300061719 Bacteria 7651
443 Ga0466962_0041841 3300061719 Bacteria 2192
444 Ga0466962_0048551 3300061719 Bacteria 2028
445 Ga0530510_0176719 3300061734 Bacteria 1582
446 2643826229 2643221561 Bacteria 4984412
447 2644532206 2643221696 Bacteria 5431823
448 2866553895 2866552031 Bacteria 5824618
449 Ga0070713_100127432
450 Ga0058859_10879164
451 Ga0058861_11844891
452 Ga0058860_11970695
453 Ga0058862_12463978
454 Ga0070658_10015103
455 Ga0070683_100343486
456 Ga0070690_100061141
457 Ga0068869_100006727
458 Ga0068869_100094027
459 Ga0070680_100028124
460 Ga0070680_100125051
461 Ga0070682_100010958
462 Ga0068868_100002983
463 Ga0070660_100213069
464 Ga0070660_100473091
465 Ga0070660_100480582
466 Ga0070660_100498605
467 Ga0070691_10012173
468 Ga0070687_100123982
469 Ga0070661_100250535
470 Ga0070692_10042608
471 Ga0070668_100061443
472 Ga0070675_100535338
473 Ga0070674_100031324
474 Ga0070673_100074608
475 Ga0070688_101069074
476 Ga0070659_100104019
477 Ga0070659_100271579
478 Ga0070667_100050588
479 Ga0070703_10073764
480 Ga0070709_10011280
481 Ga0070714_100324759
482 Ga0070714_100757275
483 Ga0070714_100980922
484 Ga0070713_100006071
485 Ga0070710_10186387
486 Ga0070701_10019335
487 Ga0070711_100219656
488 Ga0070705_100006250
489 Ga0070700_100005376
490 Ga0070694_100038875
491 Ga0070663_100004408
492 Ga0070678_100200415
493 Ga0070678_100209168
494 Ga0070662_100010666
495 Ga0070681_10118479
496 Ga0070681_10244263
497 Ga0070681_10337702
498 Ga0070685_10009688
499 Ga0070698_100947150
500 Ga0070699_100479382
501 Ga0070679_100008643
502 Ga0070679_100155802
503 Ga0070679_100282764
504 Ga0070684_100075746
505 Ga0070684_100245167
506 Ga0070684_100599961
507 Ga0070697_100274947
508 Ga0068853_100004965
509 Ga0070672_100427493
510 Ga0070686_100001961
511 Ga0070696_100011642
512 Ga0070665_100217573
513 Ga0070665_100280836
514 Ga0070704_100020388
515 Ga0068855_100001894
516 Ga0068855_100037263
517 Ga0070664_100087343
518 Ga0068857_100080827
519 Ga0068854_100096271
520 Ga0068856_100008297
521 Ga0068856_100070832
522 Ga0068856_100154386
523 Ga0070702_100001033
524 Ga0068852_100024449
525 Ga0068859_100372878
526 Ga0068864_100270420
527 Ga0068866_10024881
528 Ga0068861_100021178
529 Ga0068863_100137271
530 Ga0068858_100011577
531 Ga0068862_100047849
532 Ga0081455_10005680
533 Ga0081540_1001979
534 Ga0081540_1015176
535 Ga0070717_10002850
536 Ga0070715_10013996
537 Ga0070716_100005595
538 Ga0070712_100612115
539 Ga0097621_100012803
540 Ga0068871_100014988
541 Ga0075428_100034545
542 Ga0075430_100017371
543 Ga0075430_100162124
544 Ga0075431_100009056
545 Ga0075431_100321173
546 Ga0075433_10004265
547 Ga0075433_10123548
548 Ga0075434_100008502
549 Ga0075434_100049197
550 Ga0075429_100001044
551 Ga0075429_100086111
552 Ga0075429_100204110
553 Ga0068865_100051257
554 Ga0075436_100010396
555 Ga0075436_100012397
556 Ga0097620_100372904
557 Ga0075435_100006633
558 Ga0075435_100013995
559 Ga0105244_10108619
560 Ga0105240_10064067
561 Ga0105240_10151769
562 Ga0111539_10070061
563 Ga0105245_10004630
564 Ga0105245_10556481
565 Ga0105247_10004474
566 Ga0105247_10013172
567 Ga0114129_10014314
568 Ga0114129_10602239
569 Ga0114129_10656774
570 Ga0105243_10127426
571 Ga0105241_10005975
572 Ga0105242_10006178
573 Ga0105242_10106967
574 Ga0105237_10009477
575 Ga0105237_10035579
576 Ga0105237_10095068
577 Ga0105237_10269386
578 Ga0105238_10040812
579 Ga0105238_10145225
580 Ga0105249_10000724
581 Ga0105239_10027539
582 Ga0105239_10030711
583 Ga0105239_10753998
584 Ga0105246_10006843
585 Ga0157371_10175488
586 Ga0157370_10050302
587 Ga0157370_10491494
588 Ga0157370_11014072
589 Ga0157369_10010548
590 Ga0157369_10010747
591 Ga0157369_10012138
592 Ga0157369_10013666
593 Ga0157369_11111098
594 Ga0157369_11341731
595 Ga0157374_10006979
596 Ga0157378_10101381
597 Ga0163162_10005227
598 Ga0157372_10162249
599 Ga0163163_10400199
600 Ga0157380_10006888
601 Ga0182008_10364624
602 Ga0157377_10026506
603 Ga0157379_10018019
604 Ga0157376_10003301
605 Ga0163161_10003514
606 Ga0197907_10077700
607 Ga0197907_10109127
608 Ga0197907_10658548
609 Ga0206356_10032357
610 Ga0206356_11584288
611 Ga0206349_1627240
612 Ga0206355_1688975
613 Ga0206351_10002270
614 Ga0206352_10672896
615 Ga0206352_10797809
616 Ga0206350_11089449
617 Ga0206354_10018434
618 Ga0206354_10318259
619 Ga0206354_10731265
620 Ga0206354_11327251
621 Ga0206353_11341863
622 Ga0206353_11467684
623 Ga0206353_11693350
624 Ga0206353_11808677
625 Ga0213876_10033032
626 Ga0224712_10018279
627 Ga0224712_10020306
628 Ga0224712_10051219
629 Ga0224712_10129766
630 Ga0207653_10037920
631 Ga0207642_10824004
632 Ga0207710_10006732
633 Ga0207710_10021011
634 Ga0207688_10001308
635 Ga0207680_10040933
636 Ga0207647_10094791
637 Ga0207647_10294081
638 Ga0207685_10009016
639 Ga0207699_10187210
640 Ga0207643_10023782
641 Ga0207705_10023298
642 Ga0207705_10104047
643 Ga0207654_10035543
644 Ga0207654_10331813
645 Ga0207707_10083268
646 Ga0207707_10266943
647 Ga0207695_10158350
648 Ga0207695_10257809
649 Ga0207671_10077260
650 Ga0207671_10146014
651 Ga0207671_10189166
652 Ga0207671_10558333
653 Ga0207693_10004181
654 Ga0207693_10533909
655 Ga0207663_10153606
656 Ga0207660_10037416
657 Ga0207660_10091462
658 Ga0207662_10011020
659 Ga0207657_10005486
660 Ga0207657_10074713
661 Ga0207657_10186785
662 Ga0207657_10301443
663 Ga0207657_10321800
664 Ga0207652_10085623
665 Ga0207652_10126468
666 Ga0207652_10209994
667 Ga0207652_10982722
668 Ga0207687_10017868
669 Ga0207700_10015656
670 Ga0207700_10241936
671 Ga0207664_10226619
672 Ga0207664_10250208
673 Ga0207664_10444986
674 Ga0207664_10571356
675 Ga0207644_10038350
676 Ga0207690_10139514
677 Ga0207706_10051790
678 Ga0207686_10082160
679 Ga0207709_10622463
680 Ga0207704_10055165
681 Ga0207665_10002005
682 Ga0207691_10055228
683 Ga0207711_10122022
684 Ga0207689_10004597
685 Ga0207661_10409365
686 Ga0207679_10111355
687 Ga0207667_10013432
688 Ga0207667_10055319
689 Ga0207712_10006229
690 Ga0207668_10030217
691 Ga0207640_10739120
692 Ga0207658_10112868
693 Ga0207677_10023064
694 Ga0207703_10408406
695 Ga0207639_10016235
696 Ga0207678_10001227
697 Ga0207708_10025709
698 Ga0207702_10099159
699 Ga0207702_10181155
700 Ga0207702_10341174
701 Ga0207702_10722661
702 Ga0207641_10071620
703 Ga0207648_10309554
704 Ga0207676_10068294
705 Ga0207674_10108986
706 Ga0207675_100030773
707 Ga0207683_10002660
708 Ga0207698_10678664
709 Ga0207698_10849394
710 Ga0268265_10049044
711 Ga0307515_10135972
712 Ga0307513_10000085
713 Ga0307415_101696667
714 Ga0373930_0009452
715 Ga0373950_0005938
716 Ga0373938_0001986
717 Ga0373949_0017540
718 Ga0373951_0011207
719 Ga0373952_0008354
720 Ga0373932_0029610
721 Ga0373960_0033106
722 Ga0373955_0307943
723 Ga0373961_0013708
724 Ga0373962_0001463
725 Ga0373931_0014238
726 Ga0373927_0499257
727 Ga0373937_0182480
728 Ga0395900_0088576
729 Ga0436365_0671926
730 Ga0451798_0162887
731 Ga0451800_1601244
732 Ga0451853_3328068
733 Ga0466969_0011807
734 Ga0466972_0034383
735 Ga0466965_0211140
736 Ga0466966_0009963
737 Ga0466966_0083288
738 Ga0466966_0119150
739 Ga0466966_0172580
740 Ga0466966_0180915
741 Ga0466966_0253932
742 Ga0466966_0743168
743 Ga0466961_0007532
744 Ga0466961_0039888
745 Ga0466961_0177765
746 Ga0466961_0232036
747 Ga0466961_0310999
748 Ga0466961_0412980
749 Ga0466963_0001782
750 Ga0466963_0004806
751 Ga0466963_0014433
752 Ga0466963_0018612
753 Ga0466963_0022574
754 Ga0466963_0086387
755 Ga0466963_0325763
756 Ga0466964_0038799
757 Ga0466971_0010047
758 Ga0466971_0022074
759 Ga0466971_0082675
760 Ga0466971_0090452
761 Ga0466971_0210181
762 Ga0466968_0251195
763 Ga0466968_0350863
764 Ga0466970_0041402
765 Ga0466970_0462007
766 Ga0466957_0010080
767 Ga0466957_0018398
768 Ga0466957_0034216
769 Ga0466957_0064134
770 Ga0466957_0070973
771 Ga0466957_0110653
772 Ga0466957_0697142
773 Ga0466960_0003605
774 Ga0466960_0064530
775 Ga0466959_0007717
776 Ga0466959_0029100
777 Ga0466959_0036894
778 Ga0466959_0106450
779 Ga0466959_0239276
780 Ga0466959_0303143
781 Ga0466959_0862315
782 Ga0466958_0004306
783 Ga0466958_0005042
784 Ga0466958_0152641
785 Ga0466958_0160108
786 Ga0466958_0163696
787 Ga0466958_0172354
788 Ga0466967_0000184
789 Ga0466967_0003319
790 Ga0466967_0037138
791 Ga0466967_0038494
792 Ga0466967_0054764
793 Ga0466967_0104283
794 Ga0466967_0330754
795 Ga0466967_1308777
796 Ga0495667_0595651
797 Ga0496100_0285786
798 Ga0496101_0050655
799 Ga0496101_0230981
800 Ga0496101_0296737
801 Ga0496102_0000439
802 Ga0496102_0000474
803 Ga0496103_0000976
804 Ga0496104_0159528
805 Ga0496104_0525354
806 Ga0496105_0024144
807 Ga0496105_0033751
808 Ga0496106_0005816
809 Ga0496106_0665747
810 Ga0496107_0174397
811 Ga0496108_0102722
812 Ga0496109_0015583
813 Ga0496109_0753239
814 Ga0496110_0032008
815 Ga0496110_0208657
816 Ga0496110_0296163
817 Ga0496111_0008176
818 Ga0496112_0060819
819 Ga0496113_0010593
820 Ga0496113_0670353
821 Ga0496114_0003092
822 Ga0496114_0003580
823 Ga0496114_0004585
824 Ga0496114_0161661
825 Ga0496114_0641805
826 Ga0496114_1578133
827 Ga0496115_0132579
828 Ga0496115_0158703
829 Ga0496115_0439826
830 Ga0496117_0053975
831 Ga0496118_0007091
832 Ga0496119_0008097
833 Ga0496121_0289001
834 Ga0501031_0035791
835 Ga0501033_0234724
836 Ga0501034_0846985
837 Ga0501036_0028635
838 Ga0501037_0169960
839 Ga0501038_0080520
840 Ga0501039_0015584
841 Ga0501040_0099222
842 Ga0501041_0047305
843 Ga0501042_0004994
844 Ga0501043_0151493
845 Ga0501046_0349179
846 Ga0501046_0566374
847 Ga0501047_0336217
848 Ga0501047_0934873
849 Ga0501048_0049834
850 Ga0501069_0598202
851 Ga0501070_0165441
852 Ga0501070_0486687
853 Ga0501071_0043902
854 Ga0501073_0358160
855 Ga0501074_0089973
856 Ga0501075_0077781
857 Ga0501076_0005236
858 Ga0501077_0033103
859 Ga0501079_0087663
860 Ga0501080_0031804
861 Ga0501080_0300871
862 Ga0501081_0053691
863 Ga0501083_0152271
864 Ga0501035_0014668
865 Ga0501044_0084013
866 Ga0501044_0300766
867 Ga0501045_0029195
868 nmdc:mga05p37_486339_c1
869 nmdc:mga05p37_6871_c1
870 nmdc:mga05p37_731417_c1
871 nmdc:mga09592_237441_c1
872 nmdc:mga09592_8504_c1
873 nmdc:mga09592_90711_c1
874 nmdc:mga0qj67_151705_c1
875 nmdc:mga0qj67_2006_c1
876 nmdc:mga06r32_17351_c1
877 nmdc:mga06r32_393710_c1
878 nmdc:mga08y16_297030_c1
879 nmdc:mga0n895_535721_c1
880 nmdc:mga0rr50_95969_c1
881 nmdc:mga08x19_25489_c1
882 nmdc:mga08x19_56275_c1
883 nmdc:mga0a205_141692_c1
884 nmdc:mga0a205_148195_c1
885 Ga0500644_0266125
886 Ga0500604_0036696
887 Ga0500616_0001294
888 Ga0501084_0148589
889 Ga0501082_0061859
890 Ga0466962_0003314
891 Ga0466962_0041841
892 Ga0466962_0048551
893 Ga0530510_0176719
894 2643826229
895 2644532206
896 2866553895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

147

196

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

142

194

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

48

118

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8904 104 158
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8903 97 166
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8899 97 166
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.8878 114 162
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8857 104 158
ID Description Score Start End Superfamily
af_P9WGH5_2_93_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9362 2 83 1.10.1740.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9332 103 166 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 100 166 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8904 104 158 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8857 104 158 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7G1KVD7-F1-model_v4 RNA polymerase sigma factor 0.8172 3 169 GO:0003677
GO:0006352
GO:0016987
AF-A0A8B2DTB7-F1-model_v4 deleted 0.8141 3 169
AF-A0A543HFT3-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.8041 7 166 GO:0003677
GO:0006352
GO:0016987
AF-A0A7G1KVD7-F1-model_v4 RNA polymerase sigma factor 0.7997 3 169 GO:0003677
GO:0006352
GO:0016987
AF-A0A8B2DTB7-F1-model_v4 deleted 0.7968 3 169

Map