metagRoot

F445713

General Info

Members	Datasets	Scaffolds	Average Seq Length
446	256	429	297

Family's Representative Sequence

Representative Sequence	3300009174\|Ga0105241_10183777\|Ga0105241_101837772
Length	343
Sequence	MEIAMIGLGRMGMNMLERLVLGGHTVFGFDLDPKKLDEVNERGGVGVETLETAASKFTQTPKIFWIMVPQGKPVDDTIAKLQPHLSKGDIIIDGGNSYFKDTVRRGKQLEEAGIDFLDCGTSGGIWGLKEGYCLMYGGADGAAKFCEPIFKTLAPTDGYVYTGASGSGHYVKMVHNGIEYGMLQSYGEGFDILHASEYKLDLTAIASAWRFGSVVRSWLLDLLVLAFNSDTNLENVRGYVEDSGEGRWTIQEAIDHNVPAPVITASLYERFHSREDENFAAKVIASLRNEFGGHAIKTGKSTVEDATGSGSAVIHSGTSDTHADQISPGDSATKAADTIQGSR

Samples

	Sample ID	Description	Type	Environment
1	2548877040	Paenibacillus sonchi X19-5	Isolate	Rhizosphere
2	2563366752	Paenibacillus pini JCM 16418	Isolate	Rhizosphere
3	2571042143	Paenibacillus graminis RSA19	Isolate	Unclassified
4	2576861424	Paenibacillus sabinae T27	Isolate	Rhizosphere
5	2579778775	Paenibacillus durus P3L-5	Isolate	Unclassified
6	2619619294	Paenibacillus durus ATCC 35681	Isolate	Unclassified
7	2728368933	Paenibacillus jilunlii DSM 23019	Isolate	Rhizosphere
8	2818991441	Niallia circulans 3243	Isolate	Rhizosphere
9	2852673933	Sporosarcina sp. JAI121	Isolate	Rhizosphere
10	2938649242	Paenibacillus helianthi P26E	Isolate	Rhizosphere
11	2968558590	Paenibacillus sp. P3E	Isolate	Rhizosphere
12	2971511577	Paenibacillus apii 7124	Isolate	Rhizosphere
13	2980176882	Paenibacillus apii 7028	Isolate	Rhizosphere
14	2988225383	Paenibacillus sp. P46E	Isolate	Rhizosphere
15	2996632988	Paenibacillus sp. P32E	Isolate	Rhizosphere
16	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
17	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
18	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
19	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
22	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
23	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
24	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
25	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
26	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
29	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
30	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
31	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
32	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
33	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
34	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
35	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
36	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
37	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
38	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
39	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
40	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
41	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
42	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
43	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
44	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
45	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
46	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
47	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
48	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
49	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
50	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
51	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
52	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
53	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
54	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
55	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
56	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
58	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
61	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
62	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
63	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
64	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
65	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
66	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
67	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
68	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
69	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
70	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
71	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
72	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
73	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
74	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
111	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
112	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
113	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
114	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
115	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
116	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
117	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
118	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
119	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
120	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
121	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
122	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
123	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
124	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
125	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
126	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
127	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
128	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
129	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
130	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
131	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
132	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
133	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
134	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
135	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
136	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
137	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
138	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
139	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
140	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
141	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
142	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
143	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
144	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
145	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
146	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
147	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
148	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
149	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
150	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
151	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
152	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
153	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
154	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
155	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
156	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
157	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
158	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
159	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
160	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
161	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
162	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
163	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
164	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
165	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
166	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
167	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
168	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
169	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
170	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
171	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
172	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
173	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
174	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
175	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
176	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
177	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
178	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
179	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
180	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
181	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
182	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
183	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
184	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
185	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
186	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
187	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
188	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
189	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
190	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
191	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
192	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
193	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
194	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
195	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
196	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
197	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
198	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
199	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
200	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
201	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
202	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
203	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
204	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
205	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
206	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
207	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
208	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
212	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
219	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
221	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
222	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
225	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
226	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
227	3300049667	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control	Metagenome	Rhizosphere
228	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
229	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
230	3300049677	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control	Metagenome	Rhizosphere
231	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
232	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
233	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
234	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
235	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
237	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
239	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
241	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
242	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
243	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
244	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
245	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
246	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
247	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
248	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
249	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
250	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
251	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
252	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
253	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
254	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
255	8007375930	Clostridium sp. YIM B02565	Isolate	Unclassified
256	8054465665	Paenibacillus sonchi IIRRBNF1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.96
Metatranscriptomes	0.22
Isolates	3.81

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.22
Nodule	0
Rhizoplane	2.47
Rhizosphere	94.84
Stem	0
Stem Tuber	0
Unclassified	2.47

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065712_10123075	3300005290	Bacteria	1643
2	Ga0065712_10130303	3300005290	Bacteria	1558
3	Ga0065715_10003577	3300005293	Bacteria	5239
4	Ga0065715_10124032	3300005293	Bacteria	2163
5	Ga0065715_10166505	3300005293	Bacteria	1582
6	Ga0070676_10078616	3300005328	Bacteria	1996
7	Ga0070683_100076229	3300005329	Bacteria	3134
8	Ga0070660_100118511	3300005339	Bacteria	2111
9	Ga0070667_100335441	3300005367	Bacteria	1367
10	Ga0070709_10063850	3300005434	Bacteria	2353
11	Ga0070709_10236691	3300005434	Bacteria	1309
12	Ga0070714_100000021	3300005435	Bacteria	165681
13	Ga0070714_100054137	3300005435	Bacteria	3427
14	Ga0070714_100058055	3300005435	Bacteria	3314
15	Ga0070714_100074702	3300005435	Bacteria	2939
16	Ga0070714_100124533	3300005435	Bacteria	2296
17	Ga0070714_100215835	3300005435	Bacteria	1761
18	Ga0070714_100286815	3300005435	Bacteria	1531
19	Ga0070713_100002888	3300005436	Bacteria	11234
20	Ga0070713_100005905	3300005436	Bacteria	8416
21	Ga0070711_100055008	3300005439	Bacteria	2748
22	Ga0070700_100129581	3300005441	Bacteria	1700
23	Ga0070708_100000008	3300005445	Bacteria	146021
24	Ga0070708_100009153	3300005445	Bacteria	7985
25	Ga0070708_100022798	3300005445	Bacteria	5315
26	Ga0070708_100024703	3300005445	Bacteria	5133
27	Ga0070708_100071049	3300005445	Bacteria	3133
28	Ga0070708_100288675	3300005445	Bacteria	1544
29	Ga0070708_100398699	3300005445	Bacteria	1297
30	Ga0070681_10002516	3300005458	Bacteria	16794
31	Ga0070681_10120250	3300005458	Bacteria	2562
32	Ga0070706_100000026	3300005467	Bacteria	156154
33	Ga0070706_100000354	3300005467	Bacteria	55290
34	Ga0070706_100001051	3300005467	Bacteria	29972
35	Ga0070706_100057931	3300005467	Bacteria	3575
36	Ga0070706_100112401	3300005467	Bacteria	2535
37	Ga0070707_100000004	3300005468	Bacteria	265003
38	Ga0070707_100000241	3300005468	Bacteria	54398
39	Ga0070707_100000575	3300005468	Bacteria	36954
40	Ga0070707_100129572	3300005468	Bacteria	2452
41	Ga0070707_100132899	3300005468	Bacteria	2420
42	Ga0070707_100219030	3300005468	Bacteria	1854
43	Ga0070707_100282024	3300005468	Bacteria	1614
44	Ga0070707_100347184	3300005468	Bacteria	1441
45	Ga0070698_100000142	3300005471	Bacteria	64937
46	Ga0070698_100000359	3300005471	Bacteria	47277
47	Ga0070698_100026910	3300005471	Bacteria	5981
48	Ga0070698_100034028	3300005471	Bacteria	5279
49	Ga0070698_100056838	3300005471	Bacteria	3962
50	Ga0070698_100637703	3300005471	Bacteria	1006
51	Ga0070699_100000118	3300005518	Bacteria	72787
52	Ga0070699_100000220	3300005518	Bacteria	56957
53	Ga0070699_100000277	3300005518	Bacteria	48884
54	Ga0070699_100003040	3300005518	Bacteria	14882
55	Ga0070699_100012069	3300005518	Bacteria	7455
56	Ga0070699_100066466	3300005518	Bacteria	3130
57	Ga0070699_100067578	3300005518	Bacteria	3104
58	Ga0070699_100205732	3300005518	Bacteria	1751
59	Ga0070699_100650752	3300005518	Bacteria	962
60	Ga0070697_100000007	3300005536	Bacteria	197603
61	Ga0070697_100000022	3300005536	Bacteria	132993
62	Ga0070697_100004020	3300005536	Bacteria	11278
63	Ga0070697_100051479	3300005536	Bacteria	3345
64	Ga0070695_100227102	3300005545	Bacteria	1348
65	Ga0070696_100231648	3300005546	Bacteria	1390
66	Ga0070693_100105539	3300005547	Bacteria	1724
67	Ga0070693_100291894	3300005547	Bacteria	1096
68	Ga0070704_100020965	3300005549	Bacteria	4227
69	Ga0070704_100245030	3300005549	Bacteria	1469
70	Ga0068855_100000056	3300005563	Bacteria	135739
71	Ga0070664_100105331	3300005564	Bacteria	2456
72	Ga0068854_100000006	3300005578	Bacteria	186299
73	Ga0068856_100003633	3300005614	Bacteria	15493
74	Ga0068856_100024023	3300005614	Bacteria	5930
75	Ga0068859_100350994	3300005617	Bacteria	1570
76	Ga0068863_100238918	3300005841	Bacteria	1753
77	Ga0068858_100333550	3300005842	Bacteria	1451
78	Ga0081539_10000679	3300005985	Bacteria	68172
79	Ga0081539_10002539	3300005985	Bacteria	25392
80	Ga0070717_10008048	3300006028	Bacteria	7859
81	Ga0070717_10012798	3300006028	Bacteria	6406
82	Ga0070717_10033983	3300006028	Bacteria	4117
83	Ga0070717_10075638	3300006028	Bacteria	2817
84	Ga0075365_10257053	3300006038	Bacteria	1228
85	Ga0070716_100003265	3300006173	Bacteria	7616
86	Ga0075428_100013316	3300006844	Bacteria	9149
87	Ga0075428_100025885	3300006844	Bacteria	6497
88	Ga0075428_100062396	3300006844	Bacteria	4080
89	Ga0075428_100235391	3300006844	Bacteria	1976
90	Ga0075428_100678504	3300006844	Bacteria	1098
91	Ga0075430_100093761	3300006846	Bacteria	2510
92	Ga0075430_100216618	3300006846	Bacteria	1589
93	Ga0075430_100366487	3300006846	Bacteria	1189
94	Ga0075431_100077708	3300006847	Bacteria	3426
95	Ga0075431_100088213	3300006847	Bacteria	3201
96	Ga0075431_100181878	3300006847	Bacteria	2157
97	Ga0075431_100505966	3300006847	Bacteria	1199
98	Ga0075433_10003399	3300006852	Bacteria	12295
99	Ga0075433_10030767	3300006852	Bacteria	4582
100	Ga0075434_100005815	3300006871	Bacteria	11264
101	Ga0075434_100161038	3300006871	Bacteria	2264
102	Ga0075434_100296823	3300006871	Bacteria	1636
103	Ga0075429_100003932	3300006880	Bacteria	12707
104	Ga0075429_100094722	3300006880	Bacteria	2604
105	Ga0075429_100217538	3300006880	Bacteria	1674
106	Ga0075436_100024312	3300006914	Bacteria	4164
107	Ga0075436_100038261	3300006914	Bacteria	3311
108	Ga0097620_100351018	3300006931	Bacteria	1570
109	Ga0075435_100068868	3300007076	Bacteria	2883
110	Ga0111539_10117214	3300009094	Bacteria	3122
111	Ga0114129_10001238	3300009147	Bacteria	34034
112	Ga0114129_10054201	3300009147	Bacteria	5623
113	Ga0114129_10057333	3300009147	Bacteria	5452
114	Ga0114129_10450687	3300009147	Bacteria	1688
115	Ga0105243_10110019	3300009148	Bacteria	2303
116	Ga0105241_10183777	3300009174	Bacteria	1736
117	Ga0105242_10103274	3300009176	Bacteria	2418
118	Ga0105248_10915703	3300009177	Unclassified	990
119	Ga0105237_10000060	3300009545	Bacteria	146242
120	Ga0105249_10123220	3300009553	Bacteria	2466
121	Ga0105239_10098240	3300010375	Bacteria	3236
122	Ga0105239_10770685	3300010375	Bacteria	1101
123	Ga0157370_10285830	3300013104	Bacteria	1524
124	Ga0157374_10123694	3300013296	Bacteria	2499
125	Ga0157375_10509611	3300013308	Unclassified	1367
126	Ga0157376_10196398	3300014969	Bacteria	1854
127	Ga0206356_10384554	3300020070	Bacteria	22786
128	Ga0213874_10001279	3300021377	Bacteria	5204
129	Ga0213875_10007480	3300021388	Bacteria	5632
130	Ga0213875_10014810	3300021388	Bacteria	3800
131	Ga0207699_10005130	3300025906	Bacteria	6271
132	Ga0207699_10043967	3300025906	Bacteria	2598
133	Ga0207699_10209555	3300025906	Bacteria	1325
134	Ga0207645_10083602	3300025907	Bacteria	2047
135	Ga0207684_10000005	3300025910	Bacteria	736617
136	Ga0207684_10000034	3300025910	Bacteria	291009
137	Ga0207684_10000183	3300025910	Bacteria	100388
138	Ga0207684_10000774	3300025910	Bacteria	37096
139	Ga0207684_10004870	3300025910	Bacteria	12552
140	Ga0207684_10006207	3300025910	Bacteria	10911
141	Ga0207684_10325153	3300025910	Bacteria	1325
142	Ga0207684_10407212	3300025910	Bacteria	1169
143	Ga0207684_10460641	3300025910	Bacteria	1091
144	Ga0207684_10490680	3300025910	Bacteria	1053
145	Ga0207707_10004653	3300025912	Bacteria	12055
146	Ga0207707_10074920	3300025912	Bacteria	2952
147	Ga0207707_10122606	3300025912	Bacteria	2273
148	Ga0207671_10000062	3300025914	Bacteria	172081
149	Ga0207693_10041798	3300025915	Bacteria	3608
150	Ga0207663_10071241	3300025916	Bacteria	2243
151	Ga0207662_10011570	3300025918	Bacteria	4900
152	Ga0207657_10173010	3300025919	Bacteria	1749
153	Ga0207649_10163300	3300025920	Bacteria	1545
154	Ga0207649_10167103	3300025920	Bacteria	1529
155	Ga0207652_10132088	3300025921	Bacteria	2227
156	Ga0207646_10000018	3300025922	Bacteria	291009
157	Ga0207646_10000119	3300025922	Bacteria	107784
158	Ga0207646_10000896	3300025922	Bacteria	38382
159	Ga0207646_10001006	3300025922	Bacteria	36133
160	Ga0207646_10002249	3300025922	Bacteria	22969
161	Ga0207646_10017140	3300025922	Bacteria	6785
162	Ga0207646_10026648	3300025922	Bacteria	5272
163	Ga0207646_10096135	3300025922	Bacteria	2654
164	Ga0207646_10100202	3300025922	Bacteria	2597
165	Ga0207646_10169046	3300025922	Bacteria	1974
166	Ga0207681_10261616	3300025923	Bacteria	1355
167	Ga0207650_10530049	3300025925	Bacteria	986
168	Ga0207700_10010944	3300025928	Bacteria	5759
169	Ga0207664_10000005	3300025929	Bacteria	485048
170	Ga0207664_10081277	3300025929	Bacteria	2637
171	Ga0207664_10089316	3300025929	Bacteria	2523
172	Ga0207664_10094670	3300025929	Bacteria	2455
173	Ga0207664_10155346	3300025929	Bacteria	1947
174	Ga0207644_10089693	3300025931	Bacteria	2289
175	Ga0207706_10087840	3300025933	Bacteria	2734
176	Ga0207670_10221041	3300025936	Unclassified	1450
177	Ga0207665_10002073	3300025939	Bacteria	13528
178	Ga0207665_10096969	3300025939	Bacteria	2052
179	Ga0207711_10437513	3300025941	Unclassified	1217
180	Ga0207661_10032614	3300025944	Bacteria	4037
181	Ga0207679_10323167	3300025945	Bacteria	1337
182	Ga0207667_10000083	3300025949	Bacteria	154785
183	Ga0207712_10252579	3300025961	Bacteria	1426
184	Ga0207640_10000005	3300025981	Bacteria	408618
185	Ga0207658_10145508	3300025986	Bacteria	1924
186	Ga0207639_10128365	3300026041	Bacteria	2095
187	Ga0207708_10097268	3300026075	Bacteria	2275
188	Ga0207702_10013498	3300026078	Bacteria	6786
189	Ga0207702_10024224	3300026078	Bacteria	5036
190	Ga0207702_10241157	3300026078	Bacteria	1694
191	Ga0207648_10018803	3300026089	Bacteria	6246
192	Ga0207675_100426347	3300026118	Bacteria	1311
193	Ga0209995_1000593	3300027471	Bacteria	5534
194	Ga0209968_1002113	3300027526	Bacteria	3020
195	Ga0209999_1004025	3300027543	Bacteria	2644
196	Ga0209974_10003514	3300027876	Bacteria	5643
197	Ga0265356_1000145	3300028017	Bacteria	12707
198	Ga0265336_10003435	3300028666	Bacteria	6209
199	Ga0265338_10071117	3300028800	Bacteria	2979
200	Ga0265338_10103221	3300028800	Bacteria	2316
201	Ga0265338_10125625	3300028800	Bacteria	2036
202	Ga0265338_10155584	3300028800	Bacteria	1771
203	Ga0265316_10035963	3300031344	Bacteria	4007
204	Ga0316579_10052572	3300031691	Bacteria	1908
205	Ga0316579_10068756	3300031691	Bacteria	1675
206	Ga0265314_10040288	3300031711	Bacteria	3354
207	Ga0316576_10081917	3300031727	Bacteria	2395
208	Ga0307405_10054669	3300031731	Bacteria	2494
209	Ga0307413_10225728	3300031824	Bacteria	1371
210	Ga0307410_10035454	3300031852	Bacteria	3241
211	Ga0307410_10096550	3300031852	Bacteria	2110
212	Ga0307406_10055644	3300031901	Unclassified	2530
213	Ga0307406_10069137	3300031901	Bacteria	2308
214	Ga0307406_10101010	3300031901	Bacteria	1965
215	Ga0307407_10222510	3300031903	Bacteria	1277
216	Ga0307412_10047215	3300031911	Bacteria	2827
217	Ga0307412_10212562	3300031911	Bacteria	1477
218	Ga0307412_10352562	3300031911	Unclassified	1182
219	Ga0307409_100022269	3300031995	Bacteria	4365
220	Ga0307409_100570431	3300031995	Bacteria	1114
221	Ga0307416_100001722	3300032002	Bacteria	12105
222	Ga0307416_100011947	3300032002	Bacteria	5825
223	Ga0307416_100349898	3300032002	Bacteria	1495
224	Ga0307414_10212260	3300032004	Bacteria	1583
225	Ga0307411_10062154	3300032005	Bacteria	2490
226	Ga0307415_100054137	3300032126	Bacteria	2738
227	Ga0316583_10001911	3300032133	Bacteria	7108
228	Ga0316583_10030931	3300032133	Bacteria	1906
229	Ga0316580_10062152	3300032139	Bacteria	1146
230	Ga0373944_0006310	3300035089	Bacteria	3143
231	Ga0373932_0016465	3300035112	Bacteria	1887
232	Ga0373945_0008303	3300035116	Bacteria	3378
233	Ga0373954_0128494	3300035118	Bacteria	1233
234	Ga0373956_0021173	3300035119	Bacteria	2772
235	Ga0373943_0001544	3300035170	Bacteria	10430
236	Ga0373946_0003804	3300035171	Bacteria	5357
237	Ga0373955_0029824	3300035172	Bacteria	2841
238	Ga0316574_0041397	3300035398	Bacteria	2840
239	Ga0373935_0004327	3300035692	Bacteria	8330
240	Ga0373933_0057015	3300035724	Bacteria	2346
241	Ga0373933_0059719	3300035724	Bacteria	2297
242	Ga0373933_0213145	3300035724	Bacteria	1238
243	Ga0373947_0010968	3300035725	Bacteria	5200
244	Ga0373937_0042553	3300036401	Bacteria	4144
245	Ga0373937_0086848	3300036401	Bacteria	2894
246	Ga0316582_0010698	3300036647	Bacteria	5036
247	Ga0316584_0173263	3300036712	Bacteria	1599
248	Ga0316584_0231552	3300036712	Bacteria	1354
249	Ga0373925_0002199	3300037068	Bacteria	15846
250	Ga0395899_0003251	3300037312	Bacteria	12881
251	Ga0395899_0057717	3300037312	Bacteria	2865
252	Ga0395900_0019807	3300037418	Bacteria	6856
253	Ga0395900_0055963	3300037418	Bacteria	4060
254	Ga0395900_0109970	3300037418	Bacteria	2831
255	Ga0395900_0166619	3300037418	Bacteria	2245
256	Ga0395900_0536315	3300037418	Bacteria	1116
257	Ga0395898_0002480	3300037466	Bacteria	21721
258	Ga0395898_0008563	3300037466	Bacteria	10798
259	Ga0395898_0089934	3300037466	Bacteria	2954
260	Ga0395898_0217160	3300037466	Bacteria	1824
261	Ga0395898_0311641	3300037466	Bacteria	1501
262	Ga0395905_0065926	3300037471	Bacteria	3390
263	Ga0395905_0073185	3300037471	Bacteria	3212
264	Ga0316581_0019880	3300037588	Bacteria	1962
265	Ga0436364_1372510	3300037853	Bacteria	2265
266	Ga0436364_1515186	3300037853	Bacteria	18968
267	Ga0395901_0002364	3300038443	Bacteria	19190
268	Ga0395901_0021906	3300038443	Bacteria	6550
269	Ga0395901_0045466	3300038443	Bacteria	4556
270	Ga0395901_0140983	3300038443	Bacteria	2533
271	Ga0395901_0448191	3300038443	Bacteria	1320
272	Ga0436365_1357815	3300039437	Bacteria	8979
273	Ga0436363_0044681	3300039450	Bacteria	10591
274	Ga0436362_0916976	3300039453	Bacteria	8963
275	Ga0439434_0085698	3300042435	Bacteria	1004
276	Ga0439444_0033663	3300042437	Bacteria	975
277	Ga0453684_0329817	3300044712	Bacteria	1726
278	Ga0466968_0178681	3300044735	Bacteria	986
279	Ga0466957_0010524	3300044842	Bacteria	5316
280	Ga0451576_0481374	3300045051	Bacteria	1304
281	Ga0451576_0637735	3300045051	Bacteria	1119
282	Ga0466967_0034556	3300045976	Bacteria	4293
283	Ga0466967_0062284	3300045976	Bacteria	3311
284	Ga0466967_0069007	3300045976	Bacteria	3158
285	Ga0495592_0034014	3300046454	Bacteria	3844
286	Ga0495592_0191403	3300046454	Bacteria	1386
287	Ga0495629_0005476	3300046459	Bacteria	9475
288	Ga0495641_0001808	3300046461	Bacteria	17660
289	Ga0495651_0081055	3300046462	Bacteria	2450
290	Ga0495582_0000265	3300046473	Bacteria	29160
291	Ga0495639_0002447	3300046475	Bacteria	8109
292	Ga0495662_0001201	3300046476	Bacteria	12787
293	Ga0495664_0019270	3300046477	Bacteria	3922
294	Ga0495594_0135656	3300046499	Bacteria	1394
295	Ga0495618_0037905	3300046514	Bacteria	3028
296	Ga0495628_0112359	3300046516	Bacteria	2094
297	Ga0495628_0219798	3300046516	Bacteria	1427
298	Ga0495630_0039578	3300046517	Bacteria	3524
299	Ga0495630_0235057	3300046517	Bacteria	1400
300	Ga0495652_0120965	3300046529	Bacteria	2088
301	Ga0495652_0122281	3300046529	Bacteria	2073
302	Ga0495665_0000375	3300046531	Bacteria	22517
303	Ga0495586_0063113	3300046535	Bacteria	2018
304	Ga0495645_0063091	3300046543	Bacteria	2683
305	Ga0495667_0016327	3300046559	Bacteria	5017
306	Ga0495667_0064819	3300046559	Bacteria	2389
307	Ga0495656_0096809	3300046615	Bacteria	1359
308	Ga0495634_0100746	3300046642	Bacteria	1866
309	Ga0495635_0005364	3300046663	Bacteria	8922
310	Ga0495635_0107762	3300046663	Bacteria	1903
311	Ga0495635_0159581	3300046663	Bacteria	1534
312	Ga0495657_0196037	3300046675	Bacteria	1233
313	Ga0495599_0073544	3300046678	Bacteria	2133
314	Ga0495623_0046231	3300046679	Bacteria	2764
315	Ga0495647_0002610	3300046681	Bacteria	5712
316	Ga0495658_0000804	3300046683	Bacteria	16839
317	Ga0495613_0004206	3300046689	Bacteria	10775
318	Ga0495624_0011016	3300046690	Bacteria	6224
319	Ga0495624_0091217	3300046690	Bacteria	1880
320	Ga0495600_0026216	3300046809	Bacteria	3760
321	Ga0495600_0068668	3300046809	Bacteria	2316
322	Ga0495581_0000874	3300047315	Bacteria	16088
323	Ga0495604_0001585	3300047317	Bacteria	18737
324	Ga0495674_0029122	3300047319	Bacteria	5030
325	Ga0495674_0127421	3300047319	Bacteria	2146
326	Ga0495674_0237878	3300047319	Bacteria	1501
327	Ga0495676_0002319	3300047321	Bacteria	16877
328	Ga0495680_0010232	3300047322	Bacteria	8375
329	Ga0495680_0045343	3300047322	Bacteria	3471
330	Ga0495680_0055860	3300047322	Bacteria	3060
331	Ga0495684_0040823	3300047471	Bacteria	3556
332	Ga0495684_0064811	3300047471	Bacteria	2777
333	Ga0495684_0104613	3300047471	Bacteria	2139
334	Ga0495593_0007572	3300047673	Bacteria	6343
335	Ga0495602_0006352	3300048088	Bacteria	12396
336	Ga0495602_0031847	3300048088	Bacteria	4976
337	Ga0495602_0113023	3300048088	Bacteria	2202
338	Ga0496101_0002028	3300048904	Bacteria	12308
339	Ga0496102_0105792	3300048905	Bacteria	2618
340	Ga0496104_0215173	3300048907	Bacteria	1833
341	Ga0496108_0000009	3300048911	Bacteria	276390
342	Ga0496108_0000084	3300048911	Bacteria	101818
343	Ga0496110_0000603	3300048913	Bacteria	24725
344	Ga0496110_0225417	3300048913	Bacteria	1704
345	Ga0496112_0001280	3300048915	Bacteria	19074
346	Ga0496112_0236999	3300048915	Bacteria	1778
347	Ga0496114_0009693	3300048917	Bacteria	7650
348	Ga0496115_0207282	3300048918	Bacteria	1619
349	Ga0501298_029600	3300049521	Bacteria	1068
350	Ga0501031_0009338	3300049568	Bacteria	6376
351	Ga0501034_0010286	3300049571	Bacteria	9755
352	Ga0501036_0026792	3300049572	Bacteria	4870
353	Ga0501038_0005995	3300049574	Bacteria	11239
354	Ga0501039_0182708	3300049575	Bacteria	1649
355	Ga0501039_0322076	3300049575	Bacteria	1215
356	Ga0501040_0010445	3300049576	Bacteria	6072
357	Ga0501040_0126733	3300049576	Bacteria	1794
358	Ga0501041_0079983	3300049577	Bacteria	2012
359	Ga0501042_0035651	3300049578	Bacteria	3529
360	Ga0501048_0038318	3300049582	Bacteria	3440
361	Ga0501048_0059561	3300049582	Bacteria	2706
362	Ga0501068_0205750	3300049584	Bacteria	1249
363	Ga0501071_0035568	3300049587	Bacteria	3548
364	Ga0501071_0038471	3300049587	Bacteria	3419
365	Ga0501071_0252553	3300049587	Bacteria	1331
366	Ga0501072_0088376	3300049588	Bacteria	2459
367	Ga0501072_0207457	3300049588	Bacteria	1562
368	Ga0501072_0228328	3300049588	Bacteria	1483
369	Ga0501074_0001272	3300049590	Bacteria	16666
370	Ga0501074_0162371	3300049590	Bacteria	1596
371	Ga0501075_0084757	3300049591	Bacteria	2400
372	Ga0501075_0132880	3300049591	Bacteria	1896
373	Ga0501076_0014651	3300049592	Bacteria	5911
374	Ga0501076_0211905	3300049592	Bacteria	1583
375	Ga0501076_0416307	3300049592	Bacteria	1105
376	Ga0501077_0015840	3300049593	Bacteria	4748
377	Ga0501077_0016564	3300049593	Bacteria	4644
378	Ga0501202_015646	3300049652	Unclassified	1463
379	Ga0501217_022180	3300049661	Bacteria	1505
380	Ga0501223_010187	3300049663	Unclassified	1896
381	Ga0501230_005726	3300049667	Bacteria	1773
382	Ga0501233_034424	3300049668	Unclassified	1162
383	Ga0501235_000364	3300049669	Bacteria	8678
384	Ga0501247_001597	3300049677	Unclassified	2231
385	Ga0501249_001201	3300049679	Bacteria	5441
386	Ga0501253_016273	3300049683	Unclassified	1235
387	Ga0501225_0001907	3300049705	Bacteria	6541
388	Ga0501245_011688	3300049708	Unclassified	1280
389	Ga0501079_0189254	3300049741	Bacteria	1606
390	Ga0501079_0223087	3300049741	Bacteria	1473
391	Ga0501081_0060588	3300049743	Bacteria	2622
392	Ga0501081_0141661	3300049743	Bacteria	1723
393	Ga0501083_0094991	3300049744	Bacteria	1968
394	Ga0501268_000467	3300049765	Unclassified	4399
395	Ga0501045_0073813	3300049824	Bacteria	2512
396	nmdc:mga05p37_1953_c1	3300050507	Bacteria	24045
397	nmdc:mga05p37_36051_c1	3300050507	Bacteria	6069
398	nmdc:mga05p37_540297_c1	3300050507	Bacteria	1329
399	nmdc:mga09592_109981_c1	3300050508	Bacteria	2364
400	nmdc:mga09592_140204_c1	3300050508	Bacteria	2083
401	nmdc:mga09592_1751_c1	3300050508	Bacteria	17445
402	nmdc:mga0qj67_48585_c1	3300050509	Bacteria	3352
403	nmdc:mga0qj67_91363_c1	3300050509	Bacteria	2447
404	nmdc:mga06r32_104049_c1	3300050510	Bacteria	2788
405	nmdc:mga06r32_198214_c1	3300050510	Bacteria	1995
406	nmdc:mga06r32_205771_c2	3300050510	Bacteria	1370
407	nmdc:mga06r32_489339_c1	3300050510	Bacteria	1208
408	nmdc:mga06r32_513753_c1	3300050510	Bacteria	1174
409	nmdc:mga08y16_229403_c1	3300050511	Bacteria	1920
410	nmdc:mga08y16_87032_c1	3300050511	Bacteria	3255
411	nmdc:mga0n895_111313_c1	3300050512	Bacteria	2754
412	nmdc:mga0n895_140757_c1	3300050512	Bacteria	2441
413	nmdc:mga0n895_18879_c1	3300050512	Bacteria	6393
414	nmdc:mga0rr50_42522_c1	3300050513	Bacteria	3319
415	nmdc:mga08x19_19421_c1	3300050514	Bacteria	4169
416	nmdc:mga0a205_118424_c1	3300050515	Bacteria	2547
417	nmdc:mga0a205_2290_c1	3300050515	Bacteria	16889
418	nmdc:mga0a205_7998_c1	3300050515	Bacteria	9607
419	Ga0495601_0054065	3300053077	Bacteria	2539
420	Ga0495601_0161204	3300053077	Bacteria	1466
421	Ga0495595_0006133	3300053084	Bacteria	4886
422	Ga0495619_0005280	3300053085	Bacteria	8186
423	Ga0495619_0015012	3300053085	Bacteria	4894
424	Ga0501084_0004460	3300054114	Bacteria	11428
425	Ga0501084_0176982	3300054114	Bacteria	1801
426	Ga0501082_0002569	3300060353	Bacteria	15881
427	Ga0501082_0010176	3300060353	Bacteria	8101
428	Ga0501082_0268491	3300060353	Bacteria	1485
429	Ga0530510_0062585	3300061734	Bacteria	2693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047319	Ga0495674_0237878	Ga0495674_0237878_29_742	233
2	3300049667	Ga0501230_005726	Ga0501230_005726_991_1734	234
3	3300035398	Ga0316574_0041397	Ga0316574_0041397_2060_2827	253
4	3300006871	Ga0075434_100296823	Ga0075434_1002968232	259
5	3300050511	nmdc:mga08y16_229403_c1	nmdc:mga08y16_229403_c1_13_807	261
6	3300005445	Ga0070708_100071049	Ga0070708_1000710492	274
7	3300005468	Ga0070707_100129572	Ga0070707_1001295722	274
8	3300005471	Ga0070698_100026910	Ga0070698_1000269106	274
9	3300005518	Ga0070699_100012069	Ga0070699_1000120693	274
10	3300005518	Ga0070699_100066466	Ga0070699_1000664662	274
11	3300025922	Ga0207646_10100202	Ga0207646_101002023	274
12	3300049578	Ga0501042_0035651	Ga0501042_0035651_1536_2435	274
13	3300049582	Ga0501048_0038318	Ga0501048_0038318_2012_2911	274
14	3300049588	Ga0501072_0228328	Ga0501072_0228328_363_1262	274
15	3300049591	Ga0501075_0132880	Ga0501075_0132880_682_1581	274
16	3300049743	Ga0501081_0060588	Ga0501081_0060588_1569_2468	274
17	3300049824	Ga0501045_0073813	Ga0501045_0073813_148_1047	274
18	3300005545	Ga0070695_100227102	Ga0070695_1002271022	276
19	3300005546	Ga0070696_100231648	Ga0070696_1002316482	276
20	3300006871	Ga0075434_100161038	Ga0075434_1001610382	276
21	3300048905	Ga0496102_0105792	Ga0496102_0105792_1532_2428	276
22	3300050512	nmdc:mga0n895_140757_c1	nmdc:mga0n895_140757_c1_370_1266	276
23	3300028800	Ga0265338_10125625	Ga0265338_101256252	277
24	3300049575	Ga0501039_0322076	Ga0501039_0322076_89_988	279
25	3300049576	Ga0501040_0126733	Ga0501040_0126733_536_1435	279
26	3300049592	Ga0501076_0014651	Ga0501076_0014651_1325_2224	279
27	3300049593	Ga0501077_0015840	Ga0501077_0015840_1005_1904	279
28	3300031852	Ga0307410_10035454	Ga0307410_100354542	280
29	3300031995	Ga0307409_100570431	Ga0307409_1005704311	280
30	3300005434	Ga0070709_10236691	Ga0070709_102366911	281
31	3300005435	Ga0070714_100124533	Ga0070714_1001245333	281
32	3300005436	Ga0070713_100002888	Ga0070713_1000028885	281
33	3300025906	Ga0207699_10209555	Ga0207699_102095551	281
34	3300025928	Ga0207700_10010944	Ga0207700_100109444	281
35	3300025939	Ga0207665_10096969	Ga0207665_100969691	281
36	3300005435	Ga0070714_100286815	Ga0070714_1002868152	282
37	3300025906	Ga0207699_10043967	Ga0207699_100439672	282
38	3300025912	Ga0207707_10122606	Ga0207707_101226062	282
39	3300031901	Ga0307406_10055644	Ga0307406_100556442	282
40	3300031901	Ga0307406_10101010	Ga0307406_101010102	282
41	3300031911	Ga0307412_10212562	Ga0307412_102125622	282
42	3300031911	Ga0307412_10352562	Ga0307412_103525621	282
43	3300049571	Ga0501034_0010286	Ga0501034_0010286_570_1484	282
44	3300049652	Ga0501202_015646	Ga0501202_015646_325_1224	282
45	3300049661	Ga0501217_022180	Ga0501217_022180_325_1224	282
46	3300049663	Ga0501223_010187	Ga0501223_010187_860_1759	282
47	3300049668	Ga0501233_034424	Ga0501233_034424_233_1132	282
48	3300049669	Ga0501235_000364	Ga0501235_000364_287_1186	282
49	3300049677	Ga0501247_001597	Ga0501247_001597_489_1388	282
50	3300049679	Ga0501249_001201	Ga0501249_001201_3819_4718	282
51	3300049683	Ga0501253_016273	Ga0501253_016273_11_910	282
52	3300049705	Ga0501225_0001907	Ga0501225_0001907_3631_4530	282
53	3300049708	Ga0501245_011688	Ga0501245_011688_203_1102	282
54	3300049765	Ga0501268_000467	Ga0501268_000467_3226_4125	282
55	3300005445	Ga0070708_100024703	Ga0070708_1000247032	283
56	3300006844	Ga0075428_100013316	Ga0075428_1000133167	283
57	3300006914	Ga0075436_100024312	Ga0075436_1000243123	283
58	3300025915	Ga0207693_10041798	Ga0207693_100417983	283
59	3300025922	Ga0207646_10169046	Ga0207646_101690462	283
60	3300031711	Ga0265314_10040288	Ga0265314_100402882	283
61	3300031995	Ga0307409_100022269	Ga0307409_1000222691	283
62	3300035089	Ga0373944_0006310	Ga0373944_0006310_1582_2457	283
63	3300035116	Ga0373945_0008303	Ga0373945_0008303_2106_2981	283
64	3300035170	Ga0373943_0001544	Ga0373943_0001544_2354_3229	283
65	3300035171	Ga0373946_0003804	Ga0373946_0003804_1700_2575	283
66	3300035692	Ga0373935_0004327	Ga0373935_0004327_1302_2177	283
67	3300035725	Ga0373947_0010968	Ga0373947_0010968_2848_3723	283
68	3300037068	Ga0373925_0002199	Ga0373925_0002199_4653_5528	283
69	3300037312	Ga0395899_0057717	Ga0395899_0057717_824_1684	283
70	3300037418	Ga0395900_0109970	Ga0395900_0109970_465_1325	283
71	3300037418	Ga0395900_0166619	Ga0395900_0166619_679_1545	283
72	3300037418	Ga0395900_0536315	Ga0395900_0536315_97_975	283
73	3300037466	Ga0395898_0089934	Ga0395898_0089934_1738_2616	283
74	3300037466	Ga0395898_0217160	Ga0395898_0217160_135_995	283
75	3300037466	Ga0395898_0311641	Ga0395898_0311641_162_1040	283
76	3300037471	Ga0395905_0065926	Ga0395905_0065926_978_1838	283
77	3300037471	Ga0395905_0073185	Ga0395905_0073185_1730_2608	283
78	3300038443	Ga0395901_0021906	Ga0395901_0021906_4933_5799	283
79	3300038443	Ga0395901_0045466	Ga0395901_0045466_433_1293	283
80	3300038443	Ga0395901_0140983	Ga0395901_0140983_122_1000	283
81	3300038443	Ga0395901_0448191	Ga0395901_0448191_12_890	283
82	3300045051	Ga0451576_0637735	Ga0451576_0637735_219_1109	283
83	3300046454	Ga0495592_0034014	Ga0495592_0034014_2683_3558	283
84	3300046459	Ga0495629_0005476	Ga0495629_0005476_5913_6788	283
85	3300046461	Ga0495641_0001808	Ga0495641_0001808_12261_13136	283
86	3300046473	Ga0495582_0000265	Ga0495582_0000265_14476_15351	283
87	3300046475	Ga0495639_0002447	Ga0495639_0002447_6729_7604	283
88	3300046476	Ga0495662_0001201	Ga0495662_0001201_680_1555	283
89	3300046477	Ga0495664_0019270	Ga0495664_0019270_2025_2900	283
90	3300046499	Ga0495594_0135656	Ga0495594_0135656_343_1218	283
91	3300046514	Ga0495618_0037905	Ga0495618_0037905_111_986	283
92	3300046516	Ga0495628_0112359	Ga0495628_0112359_968_1843	283
93	3300046517	Ga0495630_0039578	Ga0495630_0039578_106_981	283
94	3300046517	Ga0495630_0235057	Ga0495630_0235057_23_898	283
95	3300046529	Ga0495652_0122281	Ga0495652_0122281_1182_2057	283
96	3300046531	Ga0495665_0000375	Ga0495665_0000375_17880_18755	283
97	3300046535	Ga0495586_0063113	Ga0495586_0063113_705_1580	283
98	3300046543	Ga0495645_0063091	Ga0495645_0063091_1593_2468	283
99	3300046559	Ga0495667_0064819	Ga0495667_0064819_607_1482	283
100	3300046615	Ga0495656_0096809	Ga0495656_0096809_266_1126	283
101	3300046642	Ga0495634_0100746	Ga0495634_0100746_591_1466	283
102	3300046663	Ga0495635_0005364	Ga0495635_0005364_1938_2813	283
103	3300046663	Ga0495635_0159581	Ga0495635_0159581_41_916	283
104	3300046675	Ga0495657_0196037	Ga0495657_0196037_143_1018	283
105	3300046678	Ga0495599_0073544	Ga0495599_0073544_94_969	283
106	3300046681	Ga0495647_0002610	Ga0495647_0002610_3787_4662	283
107	3300046683	Ga0495658_0000804	Ga0495658_0000804_5424_6299	283
108	3300046689	Ga0495613_0004206	Ga0495613_0004206_6563_7438	283
109	3300046690	Ga0495624_0011016	Ga0495624_0011016_2871_3746	283
110	3300046690	Ga0495624_0091217	Ga0495624_0091217_161_1069	283
111	3300046809	Ga0495600_0026216	Ga0495600_0026216_343_1218	283
112	3300047315	Ga0495581_0000874	Ga0495581_0000874_8820_9695	283
113	3300047319	Ga0495674_0029122	Ga0495674_0029122_204_1079	283
114	3300047319	Ga0495674_0127421	Ga0495674_0127421_680_1555	283
115	3300047321	Ga0495676_0002319	Ga0495676_0002319_7832_8707	283
116	3300047322	Ga0495680_0010232	Ga0495680_0010232_3525_4400	283
117	3300047322	Ga0495680_0045343	Ga0495680_0045343_579_1454	283
118	3300047471	Ga0495684_0040823	Ga0495684_0040823_522_1397	283
119	3300047471	Ga0495684_0104613	Ga0495684_0104613_680_1555	283
120	3300047673	Ga0495593_0007572	Ga0495593_0007572_3758_4633	283
121	3300048088	Ga0495602_0113023	Ga0495602_0113023_1287_2162	283
122	3300048907	Ga0496104_0215173	Ga0496104_0215173_838_1713	283
123	3300048917	Ga0496114_0009693	Ga0496114_0009693_4398_5273	283
124	3300048918	Ga0496115_0207282	Ga0496115_0207282_391_1266	283
125	3300053077	Ga0495601_0054065	Ga0495601_0054065_486_1361	283
126	3300053084	Ga0495595_0006133	Ga0495595_0006133_2495_3370	283
127	3300053085	Ga0495619_0005280	Ga0495619_0005280_4121_4996	283
128	3300053085	Ga0495619_0015012	Ga0495619_0015012_3526_4401	283
129	3300005985	Ga0081539_10002539	Ga0081539_1000253925	284
130	3300048915	Ga0496112_0001280	Ga0496112_0001280_3866_4756	284
131	3300050507	nmdc:mga05p37_540297_c1	nmdc:mga05p37_540297_c1_281_1168	284
132	3300053077	Ga0495601_0161204	Ga0495601_0161204_328_1200	284
133	3300060353	Ga0501082_0010176	Ga0501082_0010176_295_1194	284
134	3300005367	Ga0070667_100335441	Ga0070667_1003354412	285
135	3300005435	Ga0070714_100058055	Ga0070714_1000580553	285
136	3300005436	Ga0070713_100005905	Ga0070713_1000059056	285
137	3300005439	Ga0070711_100055008	Ga0070711_1000550081	285
138	3300005518	Ga0070699_100650752	Ga0070699_1006507521	285
139	3300005614	Ga0068856_100024023	Ga0068856_1000240232	285
140	3300005841	Ga0068863_100238918	Ga0068863_1002389182	285
141	3300006028	Ga0070717_10075638	Ga0070717_100756382	285
142	3300006844	Ga0075428_100025885	Ga0075428_1000258853	285
143	3300006846	Ga0075430_100093761	Ga0075430_1000937613	285
144	3300006846	Ga0075430_100366487	Ga0075430_1003664872	285
145	3300006847	Ga0075431_100181878	Ga0075431_1001818782	285
146	3300006880	Ga0075429_100003932	Ga0075429_10000393212	285
147	3300006880	Ga0075429_100217538	Ga0075429_1002175382	285
148	3300009147	Ga0114129_10054201	Ga0114129_100542012	285
149	3300009147	Ga0114129_10450687	Ga0114129_104506872	285
150	3300025910	Ga0207684_10407212	Ga0207684_104072122	285
151	3300025916	Ga0207663_10071241	Ga0207663_100712412	285
152	3300025922	Ga0207646_10017140	Ga0207646_100171405	285
153	3300025929	Ga0207664_10089316	Ga0207664_100893162	285
154	3300025986	Ga0207658_10145508	Ga0207658_101455082	285
155	3300026078	Ga0207702_10013498	Ga0207702_100134987	285
156	3300035112	Ga0373932_0016465	Ga0373932_0016465_892_1764	285
157	3300048911	Ga0496108_0000084	Ga0496108_0000084_85660_86532	285
158	3300049584	Ga0501068_0205750	Ga0501068_0205750_347_1237	285
159	3300049741	Ga0501079_0189254	Ga0501079_0189254_79_969	285
160	3300050507	nmdc:mga05p37_1953_c1	nmdc:mga05p37_1953_c1_8403_9293	285
161	3300050508	nmdc:mga09592_1751_c1	nmdc:mga09592_1751_c1_1247_2137	285
162	3300050509	nmdc:mga0qj67_91363_c1	nmdc:mga0qj67_91363_c1_1157_2047	285
163	3300050510	nmdc:mga06r32_489339_c1	nmdc:mga06r32_489339_c1_24_932	285
164	3300050510	nmdc:mga06r32_513753_c1	nmdc:mga06r32_513753_c1_241_1131	285
165	3300050514	nmdc:mga08x19_19421_c1	nmdc:mga08x19_19421_c1_754_1629	285
166	3300006038	Ga0075365_10257053	Ga0075365_102570532	286
167	3300035118	Ga0373954_0128494	Ga0373954_0128494_295_1185	286
168	3300035119	Ga0373956_0021173	Ga0373956_0021173_1593_2483	286
169	3300035172	Ga0373955_0029824	Ga0373955_0029824_1009_1899	286
170	3300035724	Ga0373933_0057015	Ga0373933_0057015_823_1713	286
171	3300035724	Ga0373933_0059719	Ga0373933_0059719_485_1375	286
172	3300036401	Ga0373937_0042553	Ga0373937_0042553_403_1293	286
173	3300036401	Ga0373937_0086848	Ga0373937_0086848_962_1852	286
174	3300045976	Ga0466967_0069007	Ga0466967_0069007_1654_2550	286
175	3300046454	Ga0495592_0191403	Ga0495592_0191403_289_1179	286
176	3300046462	Ga0495651_0081055	Ga0495651_0081055_706_1596	286
177	3300046516	Ga0495628_0219798	Ga0495628_0219798_175_1065	286
178	3300046529	Ga0495652_0120965	Ga0495652_0120965_1061_1951	286
179	3300046559	Ga0495667_0016327	Ga0495667_0016327_3017_3907	286
180	3300046663	Ga0495635_0107762	Ga0495635_0107762_535_1425	286
181	3300046679	Ga0495623_0046231	Ga0495623_0046231_1059_1949	286
182	3300046809	Ga0495600_0068668	Ga0495600_0068668_1087_1977	286
183	3300047322	Ga0495680_0055860	Ga0495680_0055860_1208_2098	286
184	3300047471	Ga0495684_0064811	Ga0495684_0064811_283_1173	286
185	3300048088	Ga0495602_0031847	Ga0495602_0031847_3117_4007	286
186	3300014969	Ga0157376_10196398	Ga0157376_101963982	287
187	3300025929	Ga0207664_10094670	Ga0207664_100946702	287
188	3300026078	Ga0207702_10024224	Ga0207702_100242244	287
189	3300044842	Ga0466957_0010524	Ga0466957_0010524_359_1228	287
190	3300049588	Ga0501072_0088376	Ga0501072_0088376_992_1897	288
191	3300049741	Ga0501079_0223087	Ga0501079_0223087_252_1157	288
192	3300048904	Ga0496101_0002028	Ga0496101_0002028_9152_10036	289
193	3300028800	Ga0265338_10103221	Ga0265338_101032211	291
194	3300032133	Ga0316583_10001911	Ga0316583_100019115	292
195	3300005435	Ga0070714_100000021	Ga0070714_10000002138	293
196	3300005435	Ga0070714_100054137	Ga0070714_1000541371	293
197	3300005435	Ga0070714_100074702	Ga0070714_1000747022	293
198	3300005435	Ga0070714_100215835	Ga0070714_1002158352	293
199	3300005445	Ga0070708_100009153	Ga0070708_1000091532	293
200	3300005445	Ga0070708_100022798	Ga0070708_1000227983	293
201	3300005467	Ga0070706_100001051	Ga0070706_10000105125	293
202	3300005467	Ga0070706_100057931	Ga0070706_1000579312	293
203	3300005467	Ga0070706_100112401	Ga0070706_1001124012	293
204	3300005468	Ga0070707_100000241	Ga0070707_10000024129	293
205	3300005468	Ga0070707_100000575	Ga0070707_10000057514	293
206	3300005468	Ga0070707_100132899	Ga0070707_1001328991	293
207	3300005468	Ga0070707_100347184	Ga0070707_1003471841	293
208	3300005471	Ga0070698_100000142	Ga0070698_10000014211	293
209	3300005471	Ga0070698_100000359	Ga0070698_10000035922	293
210	3300005471	Ga0070698_100056838	Ga0070698_1000568382	293
211	3300005518	Ga0070699_100000277	Ga0070699_10000027760	293
212	3300005518	Ga0070699_100067578	Ga0070699_1000675782	293
213	3300005518	Ga0070699_100205732	Ga0070699_1002057322	293
214	3300005536	Ga0070697_100000022	Ga0070697_10000002253	293
215	3300005536	Ga0070697_100004020	Ga0070697_1000040203	293
216	3300005536	Ga0070697_100051479	Ga0070697_1000514792	293
217	3300005549	Ga0070704_100245030	Ga0070704_1002450302	293
218	3300005563	Ga0068855_100000056	Ga0068855_10000005642	293
219	3300005578	Ga0068854_100000006	Ga0068854_10000000617	293
220	3300005614	Ga0068856_100003633	Ga0068856_1000036334	293
221	3300005842	Ga0068858_100333550	Ga0068858_1003335502	293
222	3300006028	Ga0070717_10008048	Ga0070717_100080488	293
223	3300006028	Ga0070717_10012798	Ga0070717_100127987	293
224	3300006028	Ga0070717_10033983	Ga0070717_100339834	293
225	3300006847	Ga0075431_100505966	Ga0075431_1005059662	293
226	3300007076	Ga0075435_100068868	Ga0075435_1000688682	293
227	3300009148	Ga0105243_10110019	Ga0105243_101100192	293
228	3300009174	Ga0105241_10183777	Ga0105241_101837772	293
229	3300009545	Ga0105237_10000060	Ga0105237_1000006024	293
230	3300010375	Ga0105239_10098240	Ga0105239_100982402	293
231	3300020070	Ga0206356_10384554	Ga0206356_1038455412	293
232	3300021377	Ga0213874_10001279	Ga0213874_100012792	293
233	3300021388	Ga0213875_10007480	Ga0213875_100074802	293
234	3300021388	Ga0213875_10014810	Ga0213875_100148102	293
235	3300025910	Ga0207684_10000774	Ga0207684_1000077432	293
236	3300025910	Ga0207684_10004870	Ga0207684_1000487015	293
237	3300025910	Ga0207684_10006207	Ga0207684_100062073	293
238	3300025910	Ga0207684_10460641	Ga0207684_104606411	293
239	3300025914	Ga0207671_10000062	Ga0207671_10000062121	293
240	3300025920	Ga0207649_10163300	Ga0207649_101633002	293
241	3300025921	Ga0207652_10132088	Ga0207652_101320881	293
242	3300025922	Ga0207646_10000896	Ga0207646_100008964	293
243	3300025922	Ga0207646_10001006	Ga0207646_1000100620	293
244	3300025922	Ga0207646_10002249	Ga0207646_100022496	293
245	3300025922	Ga0207646_10026648	Ga0207646_100266482	293
246	3300025929	Ga0207664_10000005	Ga0207664_1000000517	293
247	3300025929	Ga0207664_10081277	Ga0207664_100812772	293
248	3300025929	Ga0207664_10155346	Ga0207664_101553462	293
249	3300025949	Ga0207667_10000083	Ga0207667_1000008341	293
250	3300025981	Ga0207640_10000005	Ga0207640_10000005173	293
251	3300026041	Ga0207639_10128365	Ga0207639_101283652	293
252	3300028017	Ga0265356_1000145	Ga0265356_10001452	293
253	3300028666	Ga0265336_10003435	Ga0265336_100034354	293
254	3300028800	Ga0265338_10071117	Ga0265338_100711173	293
255	3300028800	Ga0265338_10155584	Ga0265338_101555842	293
256	3300031344	Ga0265316_10035963	Ga0265316_100359634	293
257	3300031691	Ga0316579_10052572	Ga0316579_100525721	293
258	3300031691	Ga0316579_10068756	Ga0316579_100687562	293
259	3300031727	Ga0316576_10081917	Ga0316576_100819172	293
260	3300031731	Ga0307405_10054669	Ga0307405_100546691	293
261	3300031824	Ga0307413_10225728	Ga0307413_102257282	293
262	3300031901	Ga0307406_10069137	Ga0307406_100691372	293
263	3300031903	Ga0307407_10222510	Ga0307407_102225101	293
264	3300031911	Ga0307412_10047215	Ga0307412_100472151	293
265	3300032002	Ga0307416_100001722	Ga0307416_10000172210	293
266	3300032002	Ga0307416_100011947	Ga0307416_1000119472	293
267	3300032004	Ga0307414_10212260	Ga0307414_102122602	293
268	3300032126	Ga0307415_100054137	Ga0307415_1000541372	293
269	3300032133	Ga0316583_10030931	Ga0316583_100309312	293
270	3300032139	Ga0316580_10062152	Ga0316580_100621522	293
271	3300036647	Ga0316582_0010698	Ga0316582_0010698_2184_3089	293
272	3300036712	Ga0316584_0173263	Ga0316584_0173263_614_1546	293
273	3300036712	Ga0316584_0231552	Ga0316584_0231552_259_1146	293
274	3300037312	Ga0395899_0003251	Ga0395899_0003251_2157_3056	293
275	3300037418	Ga0395900_0019807	Ga0395900_0019807_5471_6370	293
276	3300037418	Ga0395900_0055963	Ga0395900_0055963_639_1664	293
277	3300037466	Ga0395898_0002480	Ga0395898_0002480_12931_13830	293
278	3300037466	Ga0395898_0008563	Ga0395898_0008563_1075_2100	293
279	3300037588	Ga0316581_0019880	Ga0316581_0019880_943_1848	293
280	3300037853	Ga0436364_1372510	Ga0436364_1372510_100_1008	293
281	3300037853	Ga0436364_1515186	Ga0436364_1515186_6508_7593	293
282	3300038443	Ga0395901_0002364	Ga0395901_0002364_10955_11854	293
283	3300039437	Ga0436365_1357815	Ga0436365_1357815_32_940	293
284	3300039450	Ga0436363_0044681	Ga0436363_0044681_9244_10152	293
285	3300039453	Ga0436362_0916976	Ga0436362_0916976_7426_8334	293
286	3300042435	Ga0439434_0085698	Ga0439434_0085698_43_939	293
287	3300042437	Ga0439444_0033663	Ga0439444_0033663_17_913	293
288	3300044735	Ga0466968_0178681	Ga0466968_0178681_17_922	293
289	3300047317	Ga0495604_0001585	Ga0495604_0001585_16266_17171	293
290	3300048088	Ga0495602_0006352	Ga0495602_0006352_10267_11172	293
291	3300048913	Ga0496110_0000603	Ga0496110_0000603_5339_6238	293
292	3300048913	Ga0496110_0225417	Ga0496110_0225417_128_1024	293
293	3300049521	Ga0501298_029600	Ga0501298_029600_58_954	293
294	3300049568	Ga0501031_0009338	Ga0501031_0009338_206_1159	293
295	3300049572	Ga0501036_0026792	Ga0501036_0026792_2116_3018	293
296	3300049574	Ga0501038_0005995	Ga0501038_0005995_298_1200	293
297	3300049575	Ga0501039_0182708	Ga0501039_0182708_535_1437	293
298	3300049576	Ga0501040_0010445	Ga0501040_0010445_610_1512	293
299	3300049577	Ga0501041_0079983	Ga0501041_0079983_1016_1918	293
300	3300049582	Ga0501048_0059561	Ga0501048_0059561_658_1560	293
301	3300049587	Ga0501071_0035568	Ga0501071_0035568_95_991	293
302	3300049587	Ga0501071_0038471	Ga0501071_0038471_950_1873	293
303	3300049588	Ga0501072_0207457	Ga0501072_0207457_624_1526	293
304	3300049590	Ga0501074_0001272	Ga0501074_0001272_2173_3075	293
305	3300049590	Ga0501074_0162371	Ga0501074_0162371_289_1212	293
306	3300049591	Ga0501075_0084757	Ga0501075_0084757_513_1415	293
307	3300049592	Ga0501076_0211905	Ga0501076_0211905_236_1159	293
308	3300049592	Ga0501076_0416307	Ga0501076_0416307_143_1039	293
309	3300049593	Ga0501077_0016564	Ga0501077_0016564_1683_2573	293
310	3300049743	Ga0501081_0141661	Ga0501081_0141661_215_1117	293
311	3300049744	Ga0501083_0094991	Ga0501083_0094991_724_1626	293
312	3300050508	nmdc:mga09592_140204_c1	nmdc:mga09592_140204_c1_19_915	293
313	3300050509	nmdc:mga0qj67_48585_c1	nmdc:mga0qj67_48585_c1_960_1856	293
314	3300054114	Ga0501084_0004460	Ga0501084_0004460_9881_10783	293
315	3300054114	Ga0501084_0176982	Ga0501084_0176982_440_1363	293
316	3300060353	Ga0501082_0002569	Ga0501082_0002569_6525_7427	293
317	3300061734	Ga0530510_0062585	Ga0530510_0062585_905_1828	293
318	iso_pu_bacteria	2548877040	2550903664	293
319	iso_pu_bacteria	2563366752	2563928475	293
320	iso_pu_bacteria	2571042143	2571531359	293
321	iso_pu_bacteria	2576861424	2578334660	293
322	iso_pu_bacteria	2579778775	2580930954	293
323	iso_pu_bacteria	2619619294	2621272686	293
324	iso_pu_bacteria	2728368933	2728532027	293
325	iso_pu_bacteria	2818991441	2819567105	293
326	iso_pu_bacteria	2852673933	2852674547	293
327	iso_pu_bacteria	2938649242	2938651659	293
328	iso_pu_bacteria	2968558590	2968564647	293
329	iso_pu_bacteria	2971511577	2971513724	293
330	iso_pu_bacteria	2980176882	2980178477	293
331	iso_pu_bacteria	2988225383	2988226618	293
332	iso_pu_bacteria	2996632988	2996639187	293
333	iso_pu_bacteria	8007375930	8007379787	293
334	iso_pu_bacteria	8054465665	8054472005	293
335	3300005293	Ga0065715_10003577	Ga0065715_100035772	294
336	3300005293	Ga0065715_10124032	Ga0065715_101240322	294
337	3300005293	Ga0065715_10166505	Ga0065715_101665052	294
338	3300005328	Ga0070676_10078616	Ga0070676_100786162	294
339	3300005329	Ga0070683_100076229	Ga0070683_1000762292	294
340	3300005339	Ga0070660_100118511	Ga0070660_1001185113	294
341	3300005434	Ga0070709_10063850	Ga0070709_100638502	294
342	3300005441	Ga0070700_100129581	Ga0070700_1001295811	294
343	3300005458	Ga0070681_10002516	Ga0070681_100025162	294
344	3300005458	Ga0070681_10120250	Ga0070681_101202503	294
345	3300005468	Ga0070707_100219030	Ga0070707_1002190303	294
346	3300005547	Ga0070693_100105539	Ga0070693_1001055392	294
347	3300005547	Ga0070693_100291894	Ga0070693_1002918941	294
348	3300005564	Ga0070664_100105331	Ga0070664_1001053312	294
349	3300005617	Ga0068859_100350994	Ga0068859_1003509942	294
350	3300005985	Ga0081539_10000679	Ga0081539_1000067922	294
351	3300006173	Ga0070716_100003265	Ga0070716_1000032652	294
352	3300006852	Ga0075433_10003399	Ga0075433_100033999	294
353	3300006931	Ga0097620_100351018	Ga0097620_1003510182	294
354	3300009094	Ga0111539_10117214	Ga0111539_101172143	294
355	3300009176	Ga0105242_10103274	Ga0105242_101032742	294
356	3300009177	Ga0105248_10915703	Ga0105248_109157031	294
357	3300009553	Ga0105249_10123220	Ga0105249_101232203	294
358	3300010375	Ga0105239_10770685	Ga0105239_107706851	294
359	3300013104	Ga0157370_10285830	Ga0157370_102858302	294
360	3300013296	Ga0157374_10123694	Ga0157374_101236942	294
361	3300013308	Ga0157375_10509611	Ga0157375_105096111	294
362	3300025906	Ga0207699_10005130	Ga0207699_100051307	294
363	3300025907	Ga0207645_10083602	Ga0207645_100836021	294
364	3300025910	Ga0207684_10325153	Ga0207684_103251532	294
365	3300025912	Ga0207707_10004653	Ga0207707_100046538	294
366	3300025912	Ga0207707_10074920	Ga0207707_100749202	294
367	3300025918	Ga0207662_10011570	Ga0207662_100115705	294
368	3300025919	Ga0207657_10173010	Ga0207657_101730102	294
369	3300025920	Ga0207649_10167103	Ga0207649_101671032	294
370	3300025923	Ga0207681_10261616	Ga0207681_102616161	294
371	3300025925	Ga0207650_10530049	Ga0207650_105300491	294
372	3300025931	Ga0207644_10089693	Ga0207644_100896932	294
373	3300025933	Ga0207706_10087840	Ga0207706_100878403	294
374	3300025936	Ga0207670_10221041	Ga0207670_102210412	294
375	3300025939	Ga0207665_10002073	Ga0207665_100020732	294
376	3300025941	Ga0207711_10437513	Ga0207711_104375131	294
377	3300025944	Ga0207661_10032614	Ga0207661_100326143	294
378	3300025945	Ga0207679_10323167	Ga0207679_103231672	294
379	3300025961	Ga0207712_10252579	Ga0207712_102525791	294
380	3300026075	Ga0207708_10097268	Ga0207708_100972682	294
381	3300026078	Ga0207702_10241157	Ga0207702_102411571	294
382	3300026089	Ga0207648_10018803	Ga0207648_100188033	294
383	3300027471	Ga0209995_1000593	Ga0209995_10005936	294
384	3300027526	Ga0209968_1002113	Ga0209968_10021132	294
385	3300027543	Ga0209999_1004025	Ga0209999_10040254	294
386	3300027876	Ga0209974_10003514	Ga0209974_100035143	294
387	3300031852	Ga0307410_10096550	Ga0307410_100965502	294
388	3300032002	Ga0307416_100349898	Ga0307416_1003498982	294
389	3300032005	Ga0307411_10062154	Ga0307411_100621542	294
390	3300035724	Ga0373933_0213145	Ga0373933_0213145_189_1193	294
391	3300045051	Ga0451576_0481374	Ga0451576_0481374_318_1247	294
392	3300045976	Ga0466967_0034556	Ga0466967_0034556_2146_3048	294
393	3300045976	Ga0466967_0062284	Ga0466967_0062284_1978_2880	294
394	3300048911	Ga0496108_0000009	Ga0496108_0000009_216651_217604	294
395	3300048915	Ga0496112_0236999	Ga0496112_0236999_418_1320	294
396	3300049587	Ga0501071_0252553	Ga0501071_0252553_256_1236	294
397	3300050511	nmdc:mga08y16_87032_c1	nmdc:mga08y16_87032_c1_1043_1942	294
398	3300050515	nmdc:mga0a205_2290_c1	nmdc:mga0a205_2290_c1_4407_5339	294
399	3300005445	Ga0070708_100000008	Ga0070708_1000000087	295
400	3300005445	Ga0070708_100288675	Ga0070708_1002886752	295
401	3300005445	Ga0070708_100398699	Ga0070708_1003986991	295
402	3300005467	Ga0070706_100000026	Ga0070706_100000026151	295
403	3300005467	Ga0070706_100000354	Ga0070706_10000035419	295
404	3300005468	Ga0070707_100000004	Ga0070707_100000004122	295
405	3300005468	Ga0070707_100282024	Ga0070707_1002820242	295
406	3300005471	Ga0070698_100637703	Ga0070698_1006377031	295
407	3300005518	Ga0070699_100000118	Ga0070699_10000011835	295
408	3300005518	Ga0070699_100000220	Ga0070699_1000002207	295
409	3300005518	Ga0070699_100003040	Ga0070699_1000030403	295
410	3300005536	Ga0070697_100000007	Ga0070697_100000007156	295
411	3300005549	Ga0070704_100020965	Ga0070704_1000209652	295
412	3300006852	Ga0075433_10030767	Ga0075433_100307675	295
413	3300006914	Ga0075436_100038261	Ga0075436_1000382612	295
414	3300025910	Ga0207684_10000005	Ga0207684_10000005241	295
415	3300025910	Ga0207684_10000034	Ga0207684_10000034153	295
416	3300025910	Ga0207684_10000183	Ga0207684_1000018329	295
417	3300025910	Ga0207684_10490680	Ga0207684_104906801	295
418	3300025922	Ga0207646_10000018	Ga0207646_10000018153	295
419	3300025922	Ga0207646_10000119	Ga0207646_1000011946	295
420	3300025922	Ga0207646_10096135	Ga0207646_100961352	295
421	3300050513	nmdc:mga0rr50_42522_c1	nmdc:mga0rr50_42522_c1_2335_3261	295
422	3300050515	nmdc:mga0a205_118424_c1	nmdc:mga0a205_118424_c1_1092_2018	295
423	3300005471	Ga0070698_100034028	Ga0070698_1000340284	296
424	3300006844	Ga0075428_100062396	Ga0075428_1000623965	296
425	3300006844	Ga0075428_100235391	Ga0075428_1002353912	296
426	3300006846	Ga0075430_100216618	Ga0075430_1002166182	296
427	3300006847	Ga0075431_100077708	Ga0075431_1000777082	296
428	3300006871	Ga0075434_100005815	Ga0075434_1000058154	296
429	3300006880	Ga0075429_100094722	Ga0075429_1000947222	296
430	3300009147	Ga0114129_10001238	Ga0114129_1000123815	296
431	3300009147	Ga0114129_10057333	Ga0114129_100573333	296
432	3300044712	Ga0453684_0329817	Ga0453684_0329817_548_1468	296
433	3300050507	nmdc:mga05p37_36051_c1	nmdc:mga05p37_36051_c1_2780_3700	296
434	3300050508	nmdc:mga09592_109981_c1	nmdc:mga09592_109981_c1_981_1889	296
435	3300050510	nmdc:mga06r32_198214_c1	nmdc:mga06r32_198214_c1_540_1490	296
436	3300050510	nmdc:mga06r32_205771_c2	nmdc:mga06r32_205771_c2_437_1345	296
437	3300050512	nmdc:mga0n895_111313_c1	nmdc:mga0n895_111313_c1_1089_1994	296
438	3300050512	nmdc:mga0n895_18879_c1	nmdc:mga0n895_18879_c1_1939_2859	296
439	3300050515	nmdc:mga0a205_7998_c1	nmdc:mga0a205_7998_c1_7422_8342	296
440	3300060353	Ga0501082_0268491	Ga0501082_0268491_286_1194	296
441	3300005290	Ga0065712_10130303	Ga0065712_101303031	297
442	3300005290	Ga0065712_10123075	Ga0065712_101230752	299
443	3300006844	Ga0075428_100678504	Ga0075428_1006785041	299
444	3300006847	Ga0075431_100088213	Ga0075431_1000882132	299
445	3300026118	Ga0207675_100426347	Ga0207675_1004263472	299
446	3300050510	nmdc:mga06r32_104049_c1	nmdc:mga06r32_104049_c1_31_942	299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

168

196

0.96 PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

163

0.96 PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

97

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6vpb-assembly1.cif.gz_B-2	a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd)	0.9409	2	291
4e21-assembly1.cif.gz_B-2	the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens	0.9372	1	291
4e21-assembly1.cif.gz_A-2	the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens	0.9301	1	288
6vpb-assembly1.cif.gz_A-2	a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd)	0.928	2	291
6vpb-assembly1.cif.gz_B-2	a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd)	0.9107	2	291

ID	Description	Score	Start	End	Superfamily
af_Q4DU92_1_145_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.938	2	135	3.40.50.720
2w8zA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9242	2	168	3.40.50.720
4e21A02	Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2	0.9169	163	285	1.10.1040.10
5y8iB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9165	2	162	3.40.50.720
af_Q4D0X5_1_185_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9087	2	171	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A7I7SWX0-F1-model_v4	6-phosphogluconate dehydrogenase NADP-binding domain-containing protein	0.9915	1	151	GO:0004616 GO:0050661
AF-A0A2M7WZ84-F1-model_v4	6-phosphogluconate dehydrogenase (Decarboxylating)	0.9891	1	151	GO:0004616 GO:0050661
AF-M5D4C2-F1-model_v4	deleted	0.9889	89	299
AF-A0A534C3M2-F1-model_v4	6-phosphogluconate dehydrogenase (Decarboxylating)	0.9886	1	143	GO:0004616 GO:0050661
AF-A0A2T2TMS1-F1-model_v4	6-phosphogluconate dehydrogenase	0.9869	179	298	GO:0004616 GO:0006098 GO:0019521

Feature Viewer

pLDDT	pTM	Quality
93.21	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445713

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

168

196

0.96

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

163

0.96

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

97

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map