F445667

General Info

Members Datasets Scaffolds Average Seq Length
446 253 892 129

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100042973|Ga0068867_1000429735
Length 151
Sequence MSGVSLHADTGNGAKVTETEEIWMSAYTRRNLEDVQDSAPQFGFGEVQEAHFASGDLETEQTGVSFHRVKPGKRQGFAHRHDEAEEVYVVIGGSGRVKLDDDIVDLERLDAVRLAPGVTRQFEGGPEGIEILVFGARHEGDGETINDWWTE

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 11.43
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 9.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100042973 3300005459 Bacteria 3307
2 JGI25406J46586_10156739 3300003203 Unclassified 664
3 Ga0070658_10200971 3300005327 Bacteria 1682
4 Ga0070683_100078165 3300005329 Bacteria 3095
5 Ga0070683_101311408 3300005329 Bacteria 696
6 Ga0070683_102173699 3300005329 Bacteria 533
7 Ga0070690_100110612 3300005330 Bacteria 1833
8 Ga0070670_101052986 3300005331 Bacteria 741
9 Ga0068869_100611243 3300005334 Bacteria 922
10 Ga0070666_10149693 3300005335 Bacteria 1628
11 Ga0070680_100112135 3300005336 Bacteria 2271
12 Ga0070680_100361886 3300005336 Bacteria 1234
13 Ga0070682_100255700 3300005337 Bacteria 1265
14 Ga0070682_100409970 3300005337 Bacteria 1027
15 Ga0070682_100413382 3300005337 Bacteria 1023
16 Ga0070682_100548084 3300005337 Bacteria 904
17 Ga0070682_100548372 3300005337 Unclassified 904
18 Ga0068868_100403050 3300005338 Bacteria 1181
19 Ga0068868_100587807 3300005338 Bacteria 985
20 Ga0070660_100008604 3300005339 Bacteria 7145
21 Ga0070660_100040429 3300005339 Bacteria 3549
22 Ga0070691_10000824 3300005341 Bacteria 12457
23 Ga0070691_10951437 3300005341 Bacteria 533
24 Ga0070687_100422763 3300005343 Unclassified 879
25 Ga0070692_10059517 3300005345 Bacteria 2008
26 Ga0070692_10113159 3300005345 Bacteria 1504
27 Ga0070692_10850714 3300005345 Bacteria 627
28 Ga0070668_100021542 3300005347 Bacteria 4870
29 Ga0070668_101062128 3300005347 Bacteria 730
30 Ga0070669_100008017 3300005353 Bacteria 7540
31 Ga0070675_100050924 3300005354 Bacteria 3401
32 Ga0070671_100214226 3300005355 Bacteria 1634
33 Ga0070674_100396921 3300005356 Unclassified 1126
34 Ga0070674_101047882 3300005356 Bacteria 718
35 Ga0070673_102205220 3300005364 Bacteria 523
36 Ga0070659_100000002 3300005366 Bacteria 369239
37 Ga0070667_100006509 3300005367 Bacteria 9712
38 Ga0070667_100148292 3300005367 Bacteria 2059
39 Ga0070667_100767275 3300005367 Unclassified 894
40 Ga0070714_100000019 3300005435 Bacteria 169455
41 Ga0070714_100023720 3300005435 Bacteria 5045
42 Ga0070714_100096074 3300005435 Bacteria 2603
43 Ga0070710_10000007 3300005437 Bacteria 215320
44 Ga0070711_101898744 3300005439 Unclassified 523
45 Ga0070705_100004940 3300005440 Bacteria 6495
46 Ga0070700_100117524 3300005441 Bacteria 1777
47 Ga0070708_100559823 3300005445 Bacteria 1078
48 Ga0070663_100002486 3300005455 Bacteria 10397
49 Ga0070663_100026248 3300005455 Bacteria 3943
50 Ga0070663_100055169 3300005455 Bacteria 2843
51 Ga0070678_100030315 3300005456 Bacteria 3717
52 Ga0070662_101003083 3300005457 Unclassified 715
53 Ga0068867_101949241 3300005459 Bacteria 554
54 Ga0070685_10324181 3300005466 Bacteria 1045
55 Ga0070685_10397386 3300005466 Bacteria 954
56 Ga0070707_100746381 3300005468 Bacteria 942
57 Ga0070698_100040172 3300005471 Bacteria 4810
58 Ga0070679_100007097 3300005530 Bacteria 10453
59 Ga0070684_100125081 3300005535 Bacteria 2316
60 Ga0070684_102337184 3300005535 Unclassified 504
61 Ga0070697_100186564 3300005536 Bacteria 1759
62 Ga0068853_100521932 3300005539 Bacteria 1123
63 Ga0068853_102054508 3300005539 Unclassified 554
64 Ga0070672_100026614 3300005543 Bacteria 4306
65 Ga0070672_100479543 3300005543 Bacteria 1074
66 Ga0070686_100511601 3300005544 Bacteria 933
67 Ga0070695_101253429 3300005545 Bacteria 611
68 Ga0070696_100509959 3300005546 Bacteria 958
69 Ga0070693_100556106 3300005547 Bacteria 822
70 Ga0070665_100071875 3300005548 Bacteria 3467
71 Ga0070665_100106782 3300005548 Bacteria 2802
72 Ga0070665_100213235 3300005548 Bacteria 1932
73 Ga0070665_101164734 3300005548 Bacteria 782
74 Ga0070665_102106537 3300005548 Bacteria 569
75 Ga0070664_100551384 3300005564 Bacteria 1066
76 Ga0070664_101755088 3300005564 Bacteria 588
77 Ga0068857_101582269 3300005577 Bacteria 640
78 Ga0068857_102099282 3300005577 Unclassified 554
79 Ga0068857_102569737 3300005577 Unclassified 500
80 Ga0068854_100516893 3300005578 Bacteria 1008
81 Ga0070702_100079970 3300005615 Bacteria 1955
82 Ga0068852_100020851 3300005616 Bacteria 5217
83 Ga0068859_101274260 3300005617 Bacteria 810
84 Ga0068864_100385592 3300005618 Bacteria 1329
85 Ga0068866_10033866 3300005718 Bacteria 2483
86 Ga0068866_10150189 3300005718 Bacteria 1348
87 Ga0068861_100289454 3300005719 Bacteria 1414
88 Ga0068863_101881991 3300005841 Bacteria 608
89 Ga0068858_100199442 3300005842 Bacteria 1892
90 Ga0068860_100054163 3300005843 Bacteria 3813
91 Ga0068862_100000973 3300005844 Bacteria 27530
92 Ga0081455_10094209 3300005937 Bacteria 2419
93 Ga0081538_10001862 3300005981 Bacteria 21272
94 Ga0081539_10008758 3300005985 Bacteria 8685
95 Ga0081539_10212997 3300005985 Unclassified 884
96 Ga0070717_10000024 3300006028 Bacteria 158890
97 Ga0075365_10102336 3300006038 Bacteria 1962
98 Ga0075365_10356239 3300006038 Bacteria 1031
99 Ga0075363_100010556 3300006048 Bacteria 4393
100 Ga0075364_10146758 3300006051 Bacteria 1588
101 Ga0075364_10183198 3300006051 Bacteria 1418
102 Ga0070715_10110225 3300006163 Bacteria 1297
103 Ga0075367_10294583 3300006178 Bacteria 1021
104 Ga0097621_100023075 3300006237 Bacteria 4839
105 Ga0068871_100023688 3300006358 Bacteria 4753
106 Ga0075428_101373434 3300006844 Bacteria 742
107 Ga0075433_10443165 3300006852 Bacteria 1145
108 Ga0075434_100165621 3300006871 Bacteria 2230
109 Ga0075434_100324856 3300006871 Bacteria 1559
110 Ga0075429_100017685 3300006880 Bacteria 6166
111 Ga0068865_100060954 3300006881 Bacteria 2643
112 Ga0068865_100540582 3300006881 Bacteria 977
113 Ga0075436_100023778 3300006914 Bacteria 4211
114 Ga0097620_101274256 3300006931 Bacteria 810
115 Ga0105240_10093725 3300009093 Bacteria 3665
116 Ga0111539_10692947 3300009094 Bacteria 1186
117 Ga0111539_11326877 3300009094 Bacteria 835
118 Ga0105245_10096829 3300009098 Bacteria 2724
119 Ga0105245_10190978 3300009098 Bacteria 1962
120 Ga0105245_10202102 3300009098 Bacteria 1909
121 Ga0105245_10612152 3300009098 Bacteria 1117
122 Ga0105247_10025061 3300009101 Bacteria 3599
123 Ga0105247_10132996 3300009101 Bacteria 1623
124 Ga0105247_10745169 3300009101 Unclassified 742
125 Ga0105247_11009470 3300009101 Bacteria 650
126 Ga0105247_11662543 3300009101 Unclassified 527
127 Ga0105247_11834536 3300009101 Bacteria 505
128 Ga0114129_10196032 3300009147 Bacteria 2739
129 Ga0114129_10907205 3300009147 Bacteria 1116
130 Ga0105243_10003804 3300009148 Bacteria 12073
131 Ga0105243_10335182 3300009148 Bacteria 1383
132 Ga0105241_10013007 3300009174 Bacteria 6103
133 Ga0105241_11915294 3300009174 Bacteria 581
134 Ga0105242_10005984 3300009176 Bacteria 9380
135 Ga0105242_10890769 3300009176 Bacteria 889
136 Ga0105242_12015931 3300009176 Unclassified 620
137 Ga0105248_10173797 3300009177 Bacteria 2428
138 Ga0105248_10706632 3300009177 Bacteria 1137
139 Ga0105248_11002378 3300009177 Bacteria 943
140 Ga0105248_11161215 3300009177 Unclassified 873
141 Ga0105237_10781244 3300009545 Bacteria 962
142 Ga0105237_10888532 3300009545 Bacteria 898
143 Ga0105237_12031278 3300009545 Bacteria 584
144 Ga0105249_10009688 3300009553 Bacteria 8442
145 Ga0105249_10046046 3300009553 Bacteria 3970
146 Ga0105249_10374673 3300009553 Bacteria 1448
147 Ga0105249_11124433 3300009553 Unclassified 856
148 Ga0105249_11132352 3300009553 Bacteria 853
149 Ga0105239_10925372 3300010375 Bacteria 1001
150 Ga0105239_13572151 3300010375 Bacteria 505
151 Ga0105246_10208820 3300011119 Bacteria 1523
152 Ga0105246_10291260 3300011119 Bacteria 1314
153 Ga0157374_10644410 3300013296 Bacteria 1071
154 Ga0157374_12546831 3300013296 Bacteria 539
155 Ga0157378_10017525 3300013297 Bacteria 6287
156 Ga0163162_10300057 3300013306 Bacteria 1738
157 Ga0163162_10343823 3300013306 Bacteria 1624
158 Ga0163162_10385727 3300013306 Bacteria 1534
159 Ga0163162_10651073 3300013306 Bacteria 1177
160 Ga0157375_10125540 3300013308 Bacteria 2680
161 Ga0157375_10789359 3300013308 Bacteria 1099
162 Ga0163163_10198344 3300014325 Bacteria 2055
163 Ga0163163_11197820 3300014325 Bacteria 822
164 Ga0157377_10332173 3300014745 Bacteria 1014
165 Ga0157379_10014819 3300014968 Bacteria 6837
166 Ga0157379_10081052 3300014968 Bacteria 2907
167 Ga0157379_10083867 3300014968 Bacteria 2856
168 Ga0157379_10168646 3300014968 Bacteria 1976
169 Ga0157379_11409071 3300014968 Bacteria 676
170 Ga0157376_10015638 3300014969 Bacteria 5738
171 Ga0157376_10124066 3300014969 Bacteria 2293
172 Ga0157376_11569743 3300014969 Bacteria 692
173 Ga0163161_10402478 3300017792 Bacteria 1098
174 Ga0197907_10839519 3300020069 Bacteria 603
175 Ga0206353_11203514 3300020082 Bacteria 538
176 Ga0206353_11396395 3300020082 Bacteria 1045
177 Ga0207692_10000001 3300025898 Bacteria 558345
178 Ga0207710_10030591 3300025900 Bacteria 2350
179 Ga0207688_10060546 3300025901 Bacteria 2133
180 Ga0207688_10427282 3300025901 Bacteria 824
181 Ga0207680_10524552 3300025903 Unclassified 845
182 Ga0207680_10570621 3300025903 Bacteria 808
183 Ga0207685_10088053 3300025905 Bacteria 1301
184 Ga0207654_10194733 3300025911 Bacteria 1331
185 Ga0207707_10451870 3300025912 Bacteria 1099
186 Ga0207695_10071930 3300025913 Bacteria 3531
187 Ga0207693_10000001 3300025915 Bacteria 469535
188 Ga0207693_11289123 3300025915 Bacteria 547
189 Ga0207663_11466721 3300025916 Unclassified 549
190 Ga0207657_10003214 3300025919 Bacteria 17495
191 Ga0207657_10031545 3300025919 Bacteria 4799
192 Ga0207652_10013428 3300025921 Bacteria 6629
193 Ga0207681_10031503 3300025923 Bacteria 3464
194 Ga0207694_10484464 3300025924 Bacteria 1035
195 Ga0207650_10295567 3300025925 Bacteria 1322
196 Ga0207659_10110258 3300025926 Bacteria 2091
197 Ga0207687_10426742 3300025927 Bacteria 1095
198 Ga0207687_10758591 3300025927 Bacteria 826
199 Ga0207687_10823910 3300025927 Bacteria 792
200 Ga0207687_10976364 3300025927 Bacteria 726
201 Ga0207687_11159299 3300025927 Bacteria 664
202 Ga0207664_10000008 3300025929 Bacteria 309301
203 Ga0207664_10020219 3300025929 Bacteria 4931
204 Ga0207664_10086187 3300025929 Bacteria 2565
205 Ga0207644_10202348 3300025931 Bacteria 1567
206 Ga0207690_10000084 3300025932 Bacteria 78461
207 Ga0207706_10103906 3300025933 Bacteria 2499
208 Ga0207686_10057572 3300025934 Bacteria 2447
209 Ga0207686_10514137 3300025934 Bacteria 931
210 Ga0207686_11337021 3300025934 Unclassified 589
211 Ga0207709_10033109 3300025935 Bacteria 3032
212 Ga0207709_10044144 3300025935 Bacteria 2692
213 Ga0207669_10211956 3300025937 Bacteria 1415
214 Ga0207704_10087123 3300025938 Bacteria 2038
215 Ga0207691_10018508 3300025940 Bacteria 6602
216 Ga0207691_10388933 3300025940 Bacteria 1190
217 Ga0207711_10089128 3300025941 Bacteria 2709
218 Ga0207689_10222822 3300025942 Bacteria 1558
219 Ga0207661_10282053 3300025944 Bacteria 1485
220 Ga0207661_10441727 3300025944 Bacteria 1184
221 Ga0207661_10447380 3300025944 Bacteria 1176
222 Ga0207679_11390401 3300025945 Bacteria 644
223 Ga0207651_11986416 3300025960 Bacteria 523
224 Ga0207712_10180090 3300025961 Bacteria 1659
225 Ga0207712_10447226 3300025961 Bacteria 1095
226 Ga0207712_10767291 3300025961 Unclassified 846
227 Ga0207668_10044993 3300025972 Bacteria 3007
228 Ga0207668_11720231 3300025972 Bacteria 566
229 Ga0207640_10214322 3300025981 Bacteria 1469
230 Ga0207658_10102136 3300025986 Bacteria 2248
231 Ga0207658_10657042 3300025986 Bacteria 945
232 Ga0207658_11068574 3300025986 Unclassified 737
233 Ga0207677_10329290 3300026023 Bacteria 1272
234 Ga0207677_11274150 3300026023 Bacteria 674
235 Ga0207677_11302927 3300026023 Bacteria 667
236 Ga0207703_10247429 3300026035 Unclassified 1605
237 Ga0207703_10905658 3300026035 Bacteria 844
238 Ga0207678_10006290 3300026067 Bacteria 10544
239 Ga0207678_10011151 3300026067 Bacteria 7894
240 Ga0207678_10013279 3300026067 Bacteria 7227
241 Ga0207708_10644636 3300026075 Bacteria 901
242 Ga0207708_11050657 3300026075 Unclassified 709
243 Ga0207702_10893764 3300026078 Bacteria 880
244 Ga0207641_11118550 3300026088 Unclassified 786
245 Ga0207648_10025922 3300026089 Bacteria 5215
246 Ga0207648_10208211 3300026089 Bacteria 1735
247 Ga0207648_10910676 3300026089 Unclassified 822
248 Ga0207648_11430989 3300026089 Bacteria 650
249 Ga0207674_11406136 3300026116 Bacteria 667
250 Ga0207674_11844935 3300026116 Unclassified 571
251 Ga0207674_12306008 3300026116 Unclassified 500
252 Ga0207675_100498634 3300026118 Bacteria 1212
253 Ga0207683_10000215 3300026121 Bacteria 50395
254 Ga0207683_11027270 3300026121 Unclassified 765
255 Ga0207698_10066052 3300026142 Bacteria 2845
256 Ga0268266_10186772 3300028379 Bacteria 1890
257 Ga0268266_10253266 3300028379 Bacteria 1629
258 Ga0268266_10384740 3300028379 Bacteria 1324
259 Ga0268266_11298463 3300028379 Unclassified 703
260 Ga0268265_10001017 3300028380 Bacteria 25271
261 Ga0268265_10784067 3300028380 Bacteria 928
262 Ga0268264_10121568 3300028381 Bacteria 2302
263 Ga0268264_10420432 3300028381 Bacteria 1289
264 Ga0265326_10000004 3300028558 Bacteria 283947
265 Ga0265319_1000519 3300028563 Bacteria 26557
266 Ga0265334_10000282 3300028573 Bacteria 28726
267 Ga0265322_10091819 3300028654 Bacteria 863
268 Ga0265336_10004696 3300028666 Bacteria 5128
269 Ga0265338_10005056 3300028800 Bacteria 17400
270 Ga0265338_10189827 3300028800 Bacteria 1559
271 Ga0265324_10002234 3300029957 Bacteria 10096
272 Ga0265320_10073350 3300031240 Bacteria 1608
273 Ga0307408_100909621 3300031548 Unclassified 806
274 Ga0265314_10322234 3300031711 Unclassified 859
275 Ga0307410_10560822 3300031852 Bacteria 948
276 Ga0307406_10495572 3300031901 Unclassified 989
277 Ga0307407_10319840 3300031903 Bacteria 1089
278 Ga0307409_102100315 3300031995 Unclassified 595
279 Ga0307414_11767273 3300032004 Bacteria 577
280 Ga0373939_0355118 3300035114 Bacteria 598
281 Ga0373925_0248675 3300037068 Bacteria 1426
282 Ga0395898_0245874 3300037466 Bacteria 1706
283 Ga0395898_0879477 3300037466 Bacteria 835
284 Ga0395905_0515652 3300037471 Bacteria 1096
285 Ga0395901_0059613 3300038443 Bacteria 3971
286 Ga0395901_1120257 3300038443 Bacteria 757
287 Ga0451795_0830578 3300041456 Bacteria 561
288 Ga0451800_0594759 3300041459 Bacteria 1250
289 Ga0466965_0675718 3300044683 Bacteria 591
290 Ga0466966_0641020 3300044684 Unclassified 640
291 Ga0466963_0001131 3300044694 Bacteria 13925
292 Ga0466963_0004184 3300044694 Bacteria 8355
293 Ga0466963_0361888 3300044694 Bacteria 1022
294 Ga0466963_0480216 3300044694 Bacteria 877
295 Ga0466964_0232709 3300044706 Bacteria 900
296 Ga0466971_0009087 3300044719 Bacteria 4345
297 Ga0466971_0040713 3300044719 Bacteria 2087
298 Ga0466971_0171738 3300044719 Bacteria 1018
299 Ga0466971_0310204 3300044719 Unclassified 759
300 Ga0466968_0066559 3300044735 Bacteria 1561
301 Ga0466957_0000287 3300044842 Bacteria 24631
302 Ga0466957_0002680 3300044842 Bacteria 9618
303 Ga0466957_0250995 3300044842 Bacteria 1176
304 Ga0466960_0001868 3300044901 Bacteria 7734
305 Ga0466958_0014385 3300045836 Bacteria 4519
306 Ga0466958_0062418 3300045836 Bacteria 2272
307 Ga0466967_0001876 3300045976 Bacteria 12681
308 Ga0466967_0002562 3300045976 Bacteria 11400
309 Ga0466967_0061766 3300045976 Bacteria 3324
310 Ga0466967_0587651 3300045976 Bacteria 1098
311 Ga0495629_0091566 3300046459 Bacteria 2122
312 Ga0495650_0000104 3300046471 Bacteria 208976
313 Ga0495605_0481084 3300046474 Bacteria 509
314 Ga0495584_0504360 3300046491 Bacteria 616
315 Ga0495616_0286663 3300046513 Bacteria 699
316 Ga0495643_0420951 3300046522 Bacteria 586
317 Ga0495663_0189179 3300046525 Bacteria 715
318 Ga0495635_0653786 3300046663 Bacteria 684
319 Ga0495623_0715276 3300046679 Bacteria 512
320 Ga0495658_0101903 3300046683 Bacteria 1715
321 Ga0495613_0027025 3300046689 Bacteria 4272
322 Ga0495649_0305220 3300046694 Unclassified 810
323 Ga0495660_0344616 3300046810 Bacteria 664
324 Ga0495676_0451705 3300047321 Unclassified 848
325 Ga0496100_0000397 3300048903 Bacteria 21034
326 Ga0496100_0024546 3300048903 Bacteria 3678
327 Ga0496100_0110814 3300048903 Bacteria 1906
328 Ga0496100_0161329 3300048903 Bacteria 1607
329 Ga0496100_0570643 3300048903 Bacteria 877
330 Ga0496101_0003708 3300048904 Bacteria 9527
331 Ga0496101_0005856 3300048904 Bacteria 7867
332 Ga0496101_0605961 3300048904 Bacteria 866
333 Ga0496102_0010088 3300048905 Bacteria 8127
334 Ga0496102_0166308 3300048905 Bacteria 2075
335 Ga0496102_0274620 3300048905 Bacteria 1589
336 Ga0496102_0355491 3300048905 Bacteria 1379
337 Ga0496102_0454666 3300048905 Bacteria 1201
338 Ga0496103_0047708 3300048906 Bacteria 2647
339 Ga0496104_0060692 3300048907 Bacteria 3582
340 Ga0496104_0073095 3300048907 Bacteria 3262
341 Ga0496104_0535920 3300048907 Bacteria 1081
342 Ga0496105_0077664 3300048908 Bacteria 2742
343 Ga0496105_0083082 3300048908 Bacteria 2645
344 Ga0496105_1120112 3300048908 Unclassified 583
345 Ga0496106_0000412 3300048909 Bacteria 30346
346 Ga0496106_0021704 3300048909 Bacteria 4768
347 Ga0496106_0260040 3300048909 Bacteria 1389
348 Ga0496106_0898260 3300048909 Bacteria 700
349 Ga0496107_0006072 3300048910 Bacteria 8292
350 Ga0496107_0049793 3300048910 Bacteria 3019
351 Ga0496107_0144661 3300048910 Bacteria 1758
352 Ga0496107_0170927 3300048910 Bacteria 1613
353 Ga0496108_0082188 3300048911 Bacteria 2731
354 Ga0496108_0426069 3300048911 Bacteria 1159
355 Ga0496108_0955607 3300048911 Bacteria 733
356 Ga0496109_0149477 3300048912 Bacteria 2187
357 Ga0496109_0755039 3300048912 Unclassified 910
358 Ga0496110_0298769 3300048913 Bacteria 1467
359 Ga0496110_0380638 3300048913 Bacteria 1286
360 Ga0496112_0007598 3300048915 Bacteria 9633
361 Ga0496112_0031245 3300048915 Bacteria 5163
362 Ga0496112_0329859 3300048915 Bacteria 1470
363 Ga0496112_0724935 3300048915 Bacteria 921
364 Ga0496113_0119833 3300048916 Bacteria 2056
365 Ga0496113_0442270 3300048916 Bacteria 1044
366 Ga0496113_0643209 3300048916 Bacteria 848
367 Ga0496113_0671632 3300048916 Bacteria 828
368 Ga0496114_0006059 3300048917 Bacteria 9517
369 Ga0496114_0089435 3300048917 Bacteria 2613
370 Ga0496114_0286398 3300048917 Bacteria 1453
371 Ga0496114_0568317 3300048917 Bacteria 1001
372 Ga0496115_0092409 3300048918 Bacteria 2474
373 Ga0496115_0253248 3300048918 Unclassified 1449
374 Ga0496116_0000680 3300048919 Bacteria 44185
375 Ga0496117_0013137 3300048920 Bacteria 7246
376 Ga0496117_0520305 3300048920 Bacteria 573
377 Ga0496118_0002923 3300048921 Bacteria 22202
378 Ga0496118_0087519 3300048921 Bacteria 2160
379 Ga0496119_0001947 3300048922 Bacteria 23515
380 Ga0496119_0003306 3300048922 Bacteria 16825
381 Ga0496119_0056416 3300048922 Bacteria 2380
382 Ga0496119_0115785 3300048922 Bacteria 1480
383 Ga0496120_0019823 3300048923 Bacteria 4290
384 Ga0496121_0007532 3300048924 Bacteria 13127
385 Ga0496121_0009601 3300048924 Bacteria 11085
386 Ga0496121_0036962 3300048924 Bacteria 4344
387 Ga0496121_0196112 3300048924 Bacteria 1443
388 Ga0496125_0018848 3300048928 Bacteria 6534
389 Ga0496125_0104226 3300048928 Bacteria 2078
390 Ga0496126_0010538 3300048929 Bacteria 9679
391 Ga0496126_0355099 3300048929 Bacteria 1198
392 Ga0496126_0601036 3300048929 Bacteria 867
393 Ga0501032_0049869 3300049569 Bacteria 2824
394 Ga0501034_0965382 3300049571 Bacteria 737
395 Ga0501038_1108678 3300049574 Bacteria 577
396 Ga0501042_0016287 3300049578 Bacteria 5102
397 Ga0501043_0085155 3300049579 Bacteria 2484
398 Ga0501043_0589376 3300049579 Bacteria 822
399 Ga0501046_0446878 3300049580 Bacteria 930
400 Ga0501047_0009158 3300049581 Bacteria 9347
401 Ga0501047_0062439 3300049581 Bacteria 3593
402 Ga0501047_0217732 3300049581 Bacteria 1766
403 Ga0501047_0384296 3300049581 Bacteria 1238
404 Ga0501048_0116210 3300049582 Bacteria 1890
405 Ga0501067_0071139 3300049583 Bacteria 1926
406 Ga0501068_0603748 3300049584 Bacteria 715
407 Ga0501069_0000775 3300049585 Bacteria 14978
408 Ga0501069_0041583 3300049585 Bacteria 2541
409 Ga0501070_0088397 3300049586 Bacteria 2564
410 Ga0501071_0357513 3300049587 Bacteria 1112
411 Ga0501071_0824567 3300049587 Bacteria 715
412 Ga0501073_1062185 3300049589 Bacteria 557
413 Ga0501074_0008780 3300049590 Bacteria 7325
414 Ga0501074_0073952 3300049590 Bacteria 2447
415 Ga0501074_0242679 3300049590 Bacteria 1281
416 Ga0501074_0303801 3300049590 Bacteria 1133
417 Ga0501075_1255439 3300049591 Bacteria 562
418 Ga0501079_0252115 3300049741 Bacteria 1380
419 Ga0501079_0334240 3300049741 Bacteria 1186
420 Ga0501080_0014295 3300049742 Bacteria 7310
421 Ga0501080_0573795 3300049742 Bacteria 1003
422 Ga0501081_1473811 3300049743 Bacteria 517
423 Ga0501083_0012471 3300049744 Bacteria 5944
424 Ga0501083_0348049 3300049744 Bacteria 963
425 Ga0501044_0025020 3300049823 Bacteria 6330
426 Ga0501044_0349581 3300049823 Bacteria 1398
427 Ga0501044_0403518 3300049823 Bacteria 1279
428 Ga0501045_0141614 3300049824 Bacteria 1788
429 nmdc:mga03n38_10496_c1 3300050490 Bacteria 3411
430 nmdc:mga03n38_300978_c1 3300050490 Bacteria 861
431 nmdc:mga00v17_136025_c1 3300050491 Bacteria 1573
432 nmdc:mga00v17_30675_c1 3300050491 Bacteria 3164
433 nmdc:mga00v17_42485_c1 3300050491 Bacteria 2734
434 nmdc:mga0yw44_9966_c1 3300050492 Bacteria 4832
435 nmdc:mga05p37_1754588_c1 3300050507 Bacteria 602
436 nmdc:mga05p37_336123_c1 3300050507 Bacteria 1782
437 nmdc:mga09592_15860_c1 3300050508 Bacteria 6157
438 nmdc:mga06r32_1598317_c1 3300050510 Unclassified 590
439 nmdc:mga08y16_289928_c1 3300050511 Bacteria 1687
440 nmdc:mga0n895_268617_c1 3300050512 Unclassified 1730
441 nmdc:mga08x19_22180_c1 3300050514 Bacteria 3930
442 nmdc:mga0a205_157587_c1 3300050515 Bacteria 2168
443 Ga0500566_0163386 3300053094 Bacteria 1158
444 Ga0500595_022768 3300053119 Bacteria 2211
445 Ga0500595_036750 3300053119 Bacteria 1602
446 Ga0500616_0008864 3300053153 Bacteria 6181
447 Ga0068867_100042973
448 JGI25406J46586_10156739
449 Ga0070658_10200971
450 Ga0070683_100078165
451 Ga0070683_101311408
452 Ga0070683_102173699
453 Ga0070690_100110612
454 Ga0070670_101052986
455 Ga0068869_100611243
456 Ga0070666_10149693
457 Ga0070680_100112135
458 Ga0070680_100361886
459 Ga0070682_100255700
460 Ga0070682_100409970
461 Ga0070682_100413382
462 Ga0070682_100548084
463 Ga0070682_100548372
464 Ga0068868_100403050
465 Ga0068868_100587807
466 Ga0070660_100008604
467 Ga0070660_100040429
468 Ga0070691_10000824
469 Ga0070691_10951437
470 Ga0070687_100422763
471 Ga0070692_10059517
472 Ga0070692_10113159
473 Ga0070692_10850714
474 Ga0070668_100021542
475 Ga0070668_101062128
476 Ga0070669_100008017
477 Ga0070675_100050924
478 Ga0070671_100214226
479 Ga0070674_100396921
480 Ga0070674_101047882
481 Ga0070673_102205220
482 Ga0070659_100000002
483 Ga0070667_100006509
484 Ga0070667_100148292
485 Ga0070667_100767275
486 Ga0070714_100000019
487 Ga0070714_100023720
488 Ga0070714_100096074
489 Ga0070710_10000007
490 Ga0070711_101898744
491 Ga0070705_100004940
492 Ga0070700_100117524
493 Ga0070708_100559823
494 Ga0070663_100002486
495 Ga0070663_100026248
496 Ga0070663_100055169
497 Ga0070678_100030315
498 Ga0070662_101003083
499 Ga0068867_101949241
500 Ga0070685_10324181
501 Ga0070685_10397386
502 Ga0070707_100746381
503 Ga0070698_100040172
504 Ga0070679_100007097
505 Ga0070684_100125081
506 Ga0070684_102337184
507 Ga0070697_100186564
508 Ga0068853_100521932
509 Ga0068853_102054508
510 Ga0070672_100026614
511 Ga0070672_100479543
512 Ga0070686_100511601
513 Ga0070695_101253429
514 Ga0070696_100509959
515 Ga0070693_100556106
516 Ga0070665_100071875
517 Ga0070665_100106782
518 Ga0070665_100213235
519 Ga0070665_101164734
520 Ga0070665_102106537
521 Ga0070664_100551384
522 Ga0070664_101755088
523 Ga0068857_101582269
524 Ga0068857_102099282
525 Ga0068857_102569737
526 Ga0068854_100516893
527 Ga0070702_100079970
528 Ga0068852_100020851
529 Ga0068859_101274260
530 Ga0068864_100385592
531 Ga0068866_10033866
532 Ga0068866_10150189
533 Ga0068861_100289454
534 Ga0068863_101881991
535 Ga0068858_100199442
536 Ga0068860_100054163
537 Ga0068862_100000973
538 Ga0081455_10094209
539 Ga0081538_10001862
540 Ga0081539_10008758
541 Ga0081539_10212997
542 Ga0070717_10000024
543 Ga0075365_10102336
544 Ga0075365_10356239
545 Ga0075363_100010556
546 Ga0075364_10146758
547 Ga0075364_10183198
548 Ga0070715_10110225
549 Ga0075367_10294583
550 Ga0097621_100023075
551 Ga0068871_100023688
552 Ga0075428_101373434
553 Ga0075433_10443165
554 Ga0075434_100165621
555 Ga0075434_100324856
556 Ga0075429_100017685
557 Ga0068865_100060954
558 Ga0068865_100540582
559 Ga0075436_100023778
560 Ga0097620_101274256
561 Ga0105240_10093725
562 Ga0111539_10692947
563 Ga0111539_11326877
564 Ga0105245_10096829
565 Ga0105245_10190978
566 Ga0105245_10202102
567 Ga0105245_10612152
568 Ga0105247_10025061
569 Ga0105247_10132996
570 Ga0105247_10745169
571 Ga0105247_11009470
572 Ga0105247_11662543
573 Ga0105247_11834536
574 Ga0114129_10196032
575 Ga0114129_10907205
576 Ga0105243_10003804
577 Ga0105243_10335182
578 Ga0105241_10013007
579 Ga0105241_11915294
580 Ga0105242_10005984
581 Ga0105242_10890769
582 Ga0105242_12015931
583 Ga0105248_10173797
584 Ga0105248_10706632
585 Ga0105248_11002378
586 Ga0105248_11161215
587 Ga0105237_10781244
588 Ga0105237_10888532
589 Ga0105237_12031278
590 Ga0105249_10009688
591 Ga0105249_10046046
592 Ga0105249_10374673
593 Ga0105249_11124433
594 Ga0105249_11132352
595 Ga0105239_10925372
596 Ga0105239_13572151
597 Ga0105246_10208820
598 Ga0105246_10291260
599 Ga0157374_10644410
600 Ga0157374_12546831
601 Ga0157378_10017525
602 Ga0163162_10300057
603 Ga0163162_10343823
604 Ga0163162_10385727
605 Ga0163162_10651073
606 Ga0157375_10125540
607 Ga0157375_10789359
608 Ga0163163_10198344
609 Ga0163163_11197820
610 Ga0157377_10332173
611 Ga0157379_10014819
612 Ga0157379_10081052
613 Ga0157379_10083867
614 Ga0157379_10168646
615 Ga0157379_11409071
616 Ga0157376_10015638
617 Ga0157376_10124066
618 Ga0157376_11569743
619 Ga0163161_10402478
620 Ga0197907_10839519
621 Ga0206353_11203514
622 Ga0206353_11396395
623 Ga0207692_10000001
624 Ga0207710_10030591
625 Ga0207688_10060546
626 Ga0207688_10427282
627 Ga0207680_10524552
628 Ga0207680_10570621
629 Ga0207685_10088053
630 Ga0207654_10194733
631 Ga0207707_10451870
632 Ga0207695_10071930
633 Ga0207693_10000001
634 Ga0207693_11289123
635 Ga0207663_11466721
636 Ga0207657_10003214
637 Ga0207657_10031545
638 Ga0207652_10013428
639 Ga0207681_10031503
640 Ga0207694_10484464
641 Ga0207650_10295567
642 Ga0207659_10110258
643 Ga0207687_10426742
644 Ga0207687_10758591
645 Ga0207687_10823910
646 Ga0207687_10976364
647 Ga0207687_11159299
648 Ga0207664_10000008
649 Ga0207664_10020219
650 Ga0207664_10086187
651 Ga0207644_10202348
652 Ga0207690_10000084
653 Ga0207706_10103906
654 Ga0207686_10057572
655 Ga0207686_10514137
656 Ga0207686_11337021
657 Ga0207709_10033109
658 Ga0207709_10044144
659 Ga0207669_10211956
660 Ga0207704_10087123
661 Ga0207691_10018508
662 Ga0207691_10388933
663 Ga0207711_10089128
664 Ga0207689_10222822
665 Ga0207661_10282053
666 Ga0207661_10441727
667 Ga0207661_10447380
668 Ga0207679_11390401
669 Ga0207651_11986416
670 Ga0207712_10180090
671 Ga0207712_10447226
672 Ga0207712_10767291
673 Ga0207668_10044993
674 Ga0207668_11720231
675 Ga0207640_10214322
676 Ga0207658_10102136
677 Ga0207658_10657042
678 Ga0207658_11068574
679 Ga0207677_10329290
680 Ga0207677_11274150
681 Ga0207677_11302927
682 Ga0207703_10247429
683 Ga0207703_10905658
684 Ga0207678_10006290
685 Ga0207678_10011151
686 Ga0207678_10013279
687 Ga0207708_10644636
688 Ga0207708_11050657
689 Ga0207702_10893764
690 Ga0207641_11118550
691 Ga0207648_10025922
692 Ga0207648_10208211
693 Ga0207648_10910676
694 Ga0207648_11430989
695 Ga0207674_11406136
696 Ga0207674_11844935
697 Ga0207674_12306008
698 Ga0207675_100498634
699 Ga0207683_10000215
700 Ga0207683_11027270
701 Ga0207698_10066052
702 Ga0268266_10186772
703 Ga0268266_10253266
704 Ga0268266_10384740
705 Ga0268266_11298463
706 Ga0268265_10001017
707 Ga0268265_10784067
708 Ga0268264_10121568
709 Ga0268264_10420432
710 Ga0265326_10000004
711 Ga0265319_1000519
712 Ga0265334_10000282
713 Ga0265322_10091819
714 Ga0265336_10004696
715 Ga0265338_10005056
716 Ga0265338_10189827
717 Ga0265324_10002234
718 Ga0265320_10073350
719 Ga0307408_100909621
720 Ga0265314_10322234
721 Ga0307410_10560822
722 Ga0307406_10495572
723 Ga0307407_10319840
724 Ga0307409_102100315
725 Ga0307414_11767273
726 Ga0373939_0355118
727 Ga0373925_0248675
728 Ga0395898_0245874
729 Ga0395898_0879477
730 Ga0395905_0515652
731 Ga0395901_0059613
732 Ga0395901_1120257
733 Ga0451795_0830578
734 Ga0451800_0594759
735 Ga0466965_0675718
736 Ga0466966_0641020
737 Ga0466963_0001131
738 Ga0466963_0004184
739 Ga0466963_0361888
740 Ga0466963_0480216
741 Ga0466964_0232709
742 Ga0466971_0009087
743 Ga0466971_0040713
744 Ga0466971_0171738
745 Ga0466971_0310204
746 Ga0466968_0066559
747 Ga0466957_0000287
748 Ga0466957_0002680
749 Ga0466957_0250995
750 Ga0466960_0001868
751 Ga0466958_0014385
752 Ga0466958_0062418
753 Ga0466967_0001876
754 Ga0466967_0002562
755 Ga0466967_0061766
756 Ga0466967_0587651
757 Ga0495629_0091566
758 Ga0495650_0000104
759 Ga0495605_0481084
760 Ga0495584_0504360
761 Ga0495616_0286663
762 Ga0495643_0420951
763 Ga0495663_0189179
764 Ga0495635_0653786
765 Ga0495623_0715276
766 Ga0495658_0101903
767 Ga0495613_0027025
768 Ga0495649_0305220
769 Ga0495660_0344616
770 Ga0495676_0451705
771 Ga0496100_0000397
772 Ga0496100_0024546
773 Ga0496100_0110814
774 Ga0496100_0161329
775 Ga0496100_0570643
776 Ga0496101_0003708
777 Ga0496101_0005856
778 Ga0496101_0605961
779 Ga0496102_0010088
780 Ga0496102_0166308
781 Ga0496102_0274620
782 Ga0496102_0355491
783 Ga0496102_0454666
784 Ga0496103_0047708
785 Ga0496104_0060692
786 Ga0496104_0073095
787 Ga0496104_0535920
788 Ga0496105_0077664
789 Ga0496105_0083082
790 Ga0496105_1120112
791 Ga0496106_0000412
792 Ga0496106_0021704
793 Ga0496106_0260040
794 Ga0496106_0898260
795 Ga0496107_0006072
796 Ga0496107_0049793
797 Ga0496107_0144661
798 Ga0496107_0170927
799 Ga0496108_0082188
800 Ga0496108_0426069
801 Ga0496108_0955607
802 Ga0496109_0149477
803 Ga0496109_0755039
804 Ga0496110_0298769
805 Ga0496110_0380638
806 Ga0496112_0007598
807 Ga0496112_0031245
808 Ga0496112_0329859
809 Ga0496112_0724935
810 Ga0496113_0119833
811 Ga0496113_0442270
812 Ga0496113_0643209
813 Ga0496113_0671632
814 Ga0496114_0006059
815 Ga0496114_0089435
816 Ga0496114_0286398
817 Ga0496114_0568317
818 Ga0496115_0092409
819 Ga0496115_0253248
820 Ga0496116_0000680
821 Ga0496117_0013137
822 Ga0496117_0520305
823 Ga0496118_0002923
824 Ga0496118_0087519
825 Ga0496119_0001947
826 Ga0496119_0003306
827 Ga0496119_0056416
828 Ga0496119_0115785
829 Ga0496120_0019823
830 Ga0496121_0007532
831 Ga0496121_0009601
832 Ga0496121_0036962
833 Ga0496121_0196112
834 Ga0496125_0018848
835 Ga0496125_0104226
836 Ga0496126_0010538
837 Ga0496126_0355099
838 Ga0496126_0601036
839 Ga0501032_0049869
840 Ga0501034_0965382
841 Ga0501038_1108678
842 Ga0501042_0016287
843 Ga0501043_0085155
844 Ga0501043_0589376
845 Ga0501046_0446878
846 Ga0501047_0009158
847 Ga0501047_0062439
848 Ga0501047_0217732
849 Ga0501047_0384296
850 Ga0501048_0116210
851 Ga0501067_0071139
852 Ga0501068_0603748
853 Ga0501069_0000775
854 Ga0501069_0041583
855 Ga0501070_0088397
856 Ga0501071_0357513
857 Ga0501071_0824567
858 Ga0501073_1062185
859 Ga0501074_0008780
860 Ga0501074_0073952
861 Ga0501074_0242679
862 Ga0501074_0303801
863 Ga0501075_1255439
864 Ga0501079_0252115
865 Ga0501079_0334240
866 Ga0501080_0014295
867 Ga0501080_0573795
868 Ga0501081_1473811
869 Ga0501083_0012471
870 Ga0501083_0348049
871 Ga0501044_0025020
872 Ga0501044_0349581
873 Ga0501044_0403518
874 Ga0501045_0141614
875 nmdc:mga03n38_10496_c1
876 nmdc:mga03n38_300978_c1
877 nmdc:mga00v17_136025_c1
878 nmdc:mga00v17_30675_c1
879 nmdc:mga00v17_42485_c1
880 nmdc:mga0yw44_9966_c1
881 nmdc:mga05p37_1754588_c1
882 nmdc:mga05p37_336123_c1
883 nmdc:mga09592_15860_c1
884 nmdc:mga06r32_1598317_c1
885 nmdc:mga08y16_289928_c1
886 nmdc:mga0n895_268617_c1
887 nmdc:mga08x19_22180_c1
888 nmdc:mga0a205_157587_c1
889 Ga0500566_0163386
890 Ga0500595_022768
891 Ga0500595_036750
892 Ga0500616_0008864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.9221 40 113
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.8985 39 114
2e9q-assembly1.cif.gz_A recombinant pro-11s globulin of pumpkin 0.8897 25 113
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8855 40 113
3cew-assembly1.cif.gz_A crystal structure of a cupin protein (bf4112) from bacteroides fragilis. northeast structural genomics consortium target bfr205 0.8774 4 118
ID Description Score Start End Superfamily
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9126 40 117 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8985 39 114 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8858 41 114 2.60.120.10
af_O43014_313_412_2.60.110.10 Mainly Beta;Sandwich;Thaumatin;Thaumatin 0.8858 25 116 2.60.110.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8839 25 115 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V9EEY1-F1-model_v4 Cupin domain-containing protein 0.9894 13 129
AF-A0A7V9ADJ5-F1-model_v4 Cupin domain-containing protein 0.9878 1 129
AF-H0E766-F1-model_v4 ABM domain-containing protein 0.9872 4 129
AF-A0A537XIP7-F1-model_v4 Cupin domain-containing protein 0.9864 23 129
AF-A0A5B8U0S8-F1-model_v4 Cupin domain-containing protein 0.9859 4 128 GO:0046872

Map