F445585

General Info

Members Datasets Scaffolds Average Seq Length
445 272 890 227

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0220547|Ga0495656_0220547_20_838
Length 272
Sequence MGRARRDGFLPDSVSSDRYDELYDHYTTLHDRFGRRSPMMHQLRKPTGHRRPERVGAVAALRSELARLHAELPRHGLVSWTSGNISARVPGEELMVIKASGVPFDELTPETMVVCDLAGNVVEGDLAASSDAATHGYVYRHRLDVGGVAHTHSPYATAFAARGEPIPCVLTAMADEFGGEIPVGPFARIGDDEIGRGIVDLMAEHRSPAMLMQNHGVFTVGGTARDAVKAAVMCEDVARTVHLARALGEPVPLTRKDIDALFDRYHTVYGQR

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
126 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
127 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
264 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
271 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
272 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 1.8
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 10.34
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0220547 3300046615 Bacteria 948
2 Ga0070658_10131139 3300005327 Bacteria 2089
3 Ga0070658_10200135 3300005327 Bacteria 1685
4 Ga0070658_10433691 3300005327 Bacteria 1131
5 Ga0070683_100095001 3300005329 Bacteria 2802
6 Ga0070683_100285216 3300005329 Bacteria 1571
7 Ga0068869_100921606 3300005334 Bacteria 757
8 Ga0070680_100594876 3300005336 Bacteria 949
9 Ga0070660_100009579 3300005339 Bacteria 6822
10 Ga0070709_10323063 3300005434 Bacteria 1133
11 Ga0070714_100020864 3300005435 Bacteria 5355
12 Ga0070714_100033687 3300005435 Bacteria 4284
13 Ga0070714_100062648 3300005435 Bacteria 3196
14 Ga0070714_100110703 3300005435 Bacteria 2431
15 Ga0070714_100116206 3300005435 Bacteria 2375
16 Ga0070713_100026753 3300005436 Bacteria 4534
17 Ga0070713_100075993 3300005436 Bacteria 2851
18 Ga0070713_100238197 3300005436 Bacteria 1656
19 Ga0070710_10007530 3300005437 Bacteria 5274
20 Ga0070710_10353139 3300005437 Bacteria 974
21 Ga0070711_100039050 3300005439 Bacteria 3195
22 Ga0070700_100238947 3300005441 Bacteria 1297
23 Ga0070708_100006734 3300005445 Bacteria 9153
24 Ga0070708_100285133 3300005445 Bacteria 1554
25 Ga0070663_100204123 3300005455 Bacteria 1544
26 Ga0070706_100024852 3300005467 Bacteria 5515
27 Ga0070707_100005989 3300005468 Bacteria 11344
28 Ga0070707_100061522 3300005468 Bacteria 3601
29 Ga0070698_100179048 3300005471 Bacteria 2058
30 Ga0070699_100031330 3300005518 Bacteria 4590
31 Ga0070679_100022060 3300005530 Bacteria 6220
32 Ga0070679_100039211 3300005530 Bacteria 4709
33 Ga0070679_100059556 3300005530 Bacteria 3806
34 Ga0070684_100039897 3300005535 Bacteria 4040
35 Ga0070684_100049243 3300005535 Bacteria 3656
36 Ga0070684_100353346 3300005535 Bacteria 1352
37 Ga0070697_100027959 3300005536 Bacteria 4514
38 Ga0070672_100662201 3300005543 Bacteria 912
39 Ga0068855_100006784 3300005563 Bacteria 13888
40 Ga0068857_100175480 3300005577 Bacteria 1949
41 Ga0068857_100205786 3300005577 Bacteria 1795
42 Ga0068854_100304713 3300005578 Bacteria 1290
43 Ga0068854_100522572 3300005578 Bacteria 1003
44 Ga0068856_100268622 3300005614 Bacteria 1721
45 Ga0068852_100363506 3300005616 Bacteria 1416
46 Ga0068852_101066470 3300005616 Bacteria 828
47 Ga0068859_100237610 3300005617 Bacteria 1911
48 Ga0068864_100597099 3300005618 Bacteria 1071
49 Ga0068861_100234448 3300005719 Bacteria 1558
50 Ga0068861_100292555 3300005719 Bacteria 1407
51 Ga0068858_100235352 3300005842 Bacteria 1737
52 Ga0081455_10003941 3300005937 Bacteria 16879
53 Ga0081455_10041117 3300005937 Bacteria 4070
54 Ga0081540_1000481 3300005983 Bacteria 39044
55 Ga0081540_1014586 3300005983 Bacteria 5025
56 Ga0081539_10185824 3300005985 Bacteria 971
57 Ga0070717_10003281 3300006028 Bacteria 11574
58 Ga0070717_10019203 3300006028 Bacteria 5357
59 Ga0070717_10046670 3300006028 Bacteria 3545
60 Ga0070717_10083206 3300006028 Bacteria 2690
61 Ga0070715_10055078 3300006163 Bacteria 1725
62 Ga0070716_100032197 3300006173 Bacteria 2858
63 Ga0070716_100124371 3300006173 Bacteria 1620
64 Ga0070716_100225917 3300006173 Bacteria 1261
65 Ga0070712_100056342 3300006175 Bacteria 2757
66 Ga0070712_100204301 3300006175 Bacteria 1554
67 Ga0070712_100335738 3300006175 Bacteria 1233
68 Ga0075428_100234948 3300006844 Bacteria 1978
69 Ga0075431_100083192 3300006847 Bacteria 3304
70 Ga0075433_10014412 3300006852 Bacteria 6457
71 Ga0075434_100390563 3300006871 Bacteria 1412
72 Ga0075429_100876067 3300006880 Bacteria 786
73 Ga0075436_100107961 3300006914 Bacteria 1941
74 Ga0097620_100237615 3300006931 Bacteria 1911
75 Ga0105240_10001343 3300009093 Bacteria 42182
76 Ga0111539_10076053 3300009094 Bacteria 3954
77 Ga0105245_10145190 3300009098 Bacteria 2238
78 Ga0105245_11153001 3300009098 Bacteria 822
79 Ga0114129_10005099 3300009147 Bacteria 18498
80 Ga0105246_10215780 3300011119 Bacteria 1501
81 Ga0157370_10008057 3300013104 Bacteria 11408
82 Ga0157369_10011665 3300013105 Bacteria 9980
83 Ga0157369_10462380 3300013105 Bacteria 1314
84 Ga0163162_10646077 3300013306 Bacteria 1182
85 Ga0163162_10648529 3300013306 Bacteria 1179
86 Ga0163163_10181268 3300014325 Bacteria 2153
87 Ga0157380_10883972 3300014326 Bacteria 918
88 Ga0157379_10263095 3300014968 Bacteria 1568
89 Ga0157379_10783096 3300014968 Bacteria 899
90 Ga0157376_10146132 3300014969 Bacteria 2127
91 Ga0157376_10676510 3300014969 Bacteria 1035
92 Ga0163161_10165458 3300017792 Bacteria 1688
93 Ga0197907_11372245 3300020069 Bacteria 2360
94 Ga0206356_11008897 3300020070 Bacteria 2143
95 Ga0206351_10737524 3300020077 Bacteria 2654
96 Ga0206350_11032748 3300020080 Bacteria 1684
97 Ga0206354_11421964 3300020081 Bacteria 1741
98 Ga0206353_11375294 3300020082 Bacteria 3230
99 Ga0154015_1539000 3300020610 Bacteria 1305
100 Ga0213874_10125495 3300021377 Bacteria 876
101 Ga0213876_10003619 3300021384 Bacteria 8788
102 Ga0213875_10000398 3300021388 Bacteria 38328
103 Ga0213875_10002644 3300021388 Bacteria 10597
104 Ga0224712_10006049 3300022467 Bacteria 3420
105 Ga0207692_10001157 3300025898 Bacteria 9740
106 Ga0207692_10005655 3300025898 Bacteria 5019
107 Ga0207699_10003373 3300025906 Bacteria 7615
108 Ga0207699_10382506 3300025906 Bacteria 999
109 Ga0207705_10161636 3300025909 Bacteria 1683
110 Ga0207684_10010445 3300025910 Bacteria 8174
111 Ga0207684_10010882 3300025910 Bacteria 7979
112 Ga0207684_10039723 3300025910 Bacteria 3990
113 Ga0207684_10231423 3300025910 Bacteria 1595
114 Ga0207695_10480415 3300025913 Bacteria 1125
115 Ga0207693_10014369 3300025915 Bacteria 6368
116 Ga0207693_10059586 3300025915 Bacteria 2990
117 Ga0207693_10185131 3300025915 Bacteria 1639
118 Ga0207693_10484680 3300025915 Bacteria 966
119 Ga0207663_10011215 3300025916 Bacteria 4805
120 Ga0207663_10077701 3300025916 Bacteria 2162
121 Ga0207660_10092553 3300025917 Bacteria 2244
122 Ga0207660_10445518 3300025917 Bacteria 1047
123 Ga0207662_10623317 3300025918 Bacteria 752
124 Ga0207657_10066853 3300025919 Bacteria 3058
125 Ga0207652_10019574 3300025921 Bacteria 5569
126 Ga0207652_10023938 3300025921 Bacteria 5065
127 Ga0207646_10025380 3300025922 Bacteria 5421
128 Ga0207646_10122863 3300025922 Bacteria 2333
129 Ga0207687_10242562 3300025927 Bacteria 1429
130 Ga0207700_10002282 3300025928 Bacteria 11008
131 Ga0207700_10010741 3300025928 Bacteria 5799
132 Ga0207700_10025382 3300025928 Bacteria 4113
133 Ga0207700_10073314 3300025928 Bacteria 2643
134 Ga0207700_10151544 3300025928 Bacteria 1916
135 Ga0207664_10004113 3300025929 Bacteria 9823
136 Ga0207664_10005852 3300025929 Bacteria 8410
137 Ga0207664_10013666 3300025929 Bacteria 5835
138 Ga0207664_10028353 3300025929 Bacteria 4254
139 Ga0207664_10082571 3300025929 Bacteria 2617
140 Ga0207670_10214966 3300025936 Bacteria 1468
141 Ga0207669_10448339 3300025937 Bacteria 1022
142 Ga0207665_10002597 3300025939 Bacteria 12146
143 Ga0207665_10015147 3300025939 Bacteria 5064
144 Ga0207665_10078225 3300025939 Bacteria 2271
145 Ga0207665_10145795 3300025939 Bacteria 1692
146 Ga0207661_10082434 3300025944 Bacteria 2659
147 Ga0207679_10017043 3300025945 Bacteria 4834
148 Ga0207677_10287253 3300026023 Bacteria 1353
149 Ga0207703_10323180 3300026035 Bacteria 1413
150 Ga0207678_10006092 3300026067 Bacteria 10728
151 Ga0207678_10110117 3300026067 Bacteria 2349
152 Ga0207678_10193946 3300026067 Bacteria 1736
153 Ga0207702_10071894 3300026078 Bacteria 2980
154 Ga0207676_10110121 3300026095 Bacteria 2303
155 Ga0207676_10986354 3300026095 Bacteria 830
156 Ga0207674_10048404 3300026116 Bacteria 4351
157 Ga0207675_100119644 3300026118 Bacteria 2491
158 Ga0207698_10306386 3300026142 Bacteria 1481
159 Ga0207428_10042830 3300027907 Bacteria 3660
160 Ga0268266_10167422 3300028379 Bacteria 1992
161 Ga0307517_10027818 3300028786 Bacteria 6771
162 Ga0307515_10018371 3300028794 Bacteria 12663
163 Ga0307515_10043688 3300028794 Bacteria 6956
164 Ga0307515_10092892 3300028794 Bacteria 3749
165 Ga0265338_10049548 3300028800 Bacteria 3807
166 Ga0265338_10383744 3300028800 Bacteria 1004
167 Ga0307512_10003183 3300030522 Bacteria 19471
168 Ga0307512_10003501 3300030522 Bacteria 18159
169 Ga0307512_10016971 3300030522 Bacteria 6704
170 Ga0265340_10094260 3300031247 Bacteria 1396
171 Ga0265339_10319076 3300031249 Bacteria 737
172 Ga0265331_10140741 3300031250 Bacteria 1098
173 Ga0265316_10292998 3300031344 Bacteria 1187
174 Ga0307513_10026149 3300031456 Bacteria 6738
175 Ga0307513_10125349 3300031456 Bacteria 2525
176 Ga0307408_100012422 3300031548 Bacteria 5642
177 Ga0265313_10077860 3300031595 Bacteria 1513
178 Ga0307508_10013184 3300031616 Bacteria 7564
179 Ga0307508_10185930 3300031616 Bacteria 1679
180 Ga0307514_10004145 3300031649 Bacteria 13433
181 Ga0265314_10370996 3300031711 Bacteria 782
182 Ga0307516_10032411 3300031730 Bacteria 5263
183 Ga0307413_10173196 3300031824 Bacteria 1530
184 Ga0307410_10056881 3300031852 Bacteria 2661
185 Ga0307406_10001653 3300031901 Bacteria 12258
186 Ga0307407_10006669 3300031903 Bacteria 5159
187 Ga0307412_10145700 3300031911 Bacteria 1740
188 Ga0307409_100000234 3300031995 Bacteria 22466
189 Ga0307409_100765071 3300031995 Bacteria 971
190 Ga0307409_100909180 3300031995 Bacteria 894
191 Ga0307416_100030008 3300032002 Bacteria 4073
192 Ga0307416_100318115 3300032002 Bacteria 1557
193 Ga0307411_10936963 3300032005 Bacteria 772
194 Ga0307415_100000003 3300032126 Bacteria 116928
195 Ga0307415_100317107 3300032126 Bacteria 1298
196 Ga0307510_10072652 3300033180 Bacteria 3416
197 Ga0316215_1007398 3300033544 Bacteria 1070
198 Ga0316214_1007871 3300033545 Bacteria 1429
199 Ga0316212_1008863 3300033547 Bacteria 1444
200 Ga0373926_0187599 3300035083 Bacteria 794
201 Ga0373934_0000165 3300035086 Bacteria 24127
202 Ga0373934_0003259 3300035086 Bacteria 5935
203 Ga0373951_0073979 3300035091 Bacteria 872
204 Ga0373923_0133210 3300035111 Bacteria 1118
205 Ga0373953_0000062 3300035117 Bacteria 27440
206 Ga0373953_0081416 3300035117 Bacteria 1346
207 Ga0373954_0000701 3300035118 Bacteria 12867
208 Ga0373954_0046584 3300035118 Bacteria 2027
209 Ga0373956_0000061 3300035119 Bacteria 37279
210 Ga0373956_0100601 3300035119 Bacteria 1340
211 Ga0373957_0000042 3300035120 Bacteria 33397
212 Ga0373955_0000106 3300035172 Bacteria 33578
213 Ga0373955_0004596 3300035172 Bacteria 6116
214 Ga0373962_0056692 3300035242 Bacteria 1141
215 Ga0373924_0000421 3300035410 Bacteria 12962
216 Ga0373924_0009928 3300035410 Bacteria 3502
217 Ga0373931_0217184 3300035691 Bacteria 1150
218 Ga0373933_0000046 3300035724 Bacteria 76647
219 Ga0373933_0000989 3300035724 Bacteria 17354
220 Ga0373937_0000115 3300036401 Bacteria 76660
221 Ga0373937_0005878 3300036401 Bacteria 10555
222 Ga0373925_0056404 3300037068 Bacteria 2943
223 Ga0373925_0384291 3300037068 Bacteria 1143
224 Ga0395900_0370347 3300037418 Bacteria 1402
225 Ga0395898_0134814 3300037466 Bacteria 2364
226 Ga0436364_0331782 3300037853 Bacteria 57289
227 Ga0436364_0395778 3300037853 Bacteria 30492
228 Ga0436364_0923878 3300037853 Bacteria 7239
229 Ga0395901_0094095 3300038443 Bacteria 3138
230 Ga0436365_0727080 3300039437 Bacteria 13899
231 Ga0436361_0459143 3300039447 Bacteria 827
232 Ga0436361_0543946 3300039447 Bacteria 794
233 Ga0436363_0182131 3300039450 Bacteria 1666
234 Ga0436363_0777590 3300039450 Bacteria 1085
235 Ga0451789_0260510 3300041443 Bacteria 2258
236 Ga0451791_0029453 3300041451 Bacteria 10881
237 Ga0451793_0934301 3300041452 Bacteria 39444
238 Ga0451797_0325178 3300041453 Bacteria 1193
239 Ga0451807_1335412 3300041486 Bacteria 1998
240 Ga0451837_0809089 3300041494 Bacteria 1969
241 Ga0451837_0896682 3300041494 Bacteria 1986
242 Ga0451843_0667147 3300041509 Bacteria 4487
243 Ga0466961_0062102 3300044693 Bacteria 2374
244 Ga0466961_0118215 3300044693 Bacteria 1665
245 Ga0466963_0109134 3300044694 Bacteria 1898
246 Ga0466963_0600762 3300044694 Bacteria 777
247 Ga0466964_0225731 3300044706 Bacteria 912
248 Ga0466971_0212175 3300044719 Bacteria 916
249 Ga0466959_0267881 3300045049 Bacteria 1175
250 Ga0466958_0086823 3300045836 Bacteria 1931
251 Ga0466967_0039464 3300045976 Bacteria 4059
252 Ga0466967_0119549 3300045976 Bacteria 2432
253 Ga0466967_0213333 3300045976 Bacteria 1832
254 Ga0466967_0304017 3300045976 Bacteria 1535
255 Ga0466967_0333563 3300045976 Bacteria 1465
256 Ga0466967_0603462 3300045976 Bacteria 1083
257 Ga0495592_0000166 3300046454 Bacteria 58865
258 Ga0495592_0007703 3300046454 Bacteria 8061
259 Ga0495603_0046084 3300046455 Bacteria 2599
260 Ga0495603_0154806 3300046455 Bacteria 1330
261 Ga0495629_0018306 3300046459 Bacteria 5015
262 Ga0495629_0166113 3300046459 Bacteria 1532
263 Ga0495651_0000067 3300046462 Bacteria 76665
264 Ga0495651_0004738 3300046462 Bacteria 10409
265 Ga0495653_0004436 3300046463 Bacteria 11334
266 Ga0495653_0012153 3300046463 Bacteria 7026
267 Ga0495653_0023951 3300046463 Bacteria 4925
268 Ga0495582_0003242 3300046473 Bacteria 9138
269 Ga0495582_0272429 3300046473 Bacteria 971
270 Ga0495662_0047396 3300046476 Bacteria 2074
271 Ga0495664_0010346 3300046477 Bacteria 5233
272 Ga0495664_0160579 3300046477 Bacteria 1363
273 Ga0495584_0118309 3300046491 Bacteria 1342
274 Ga0495585_0082142 3300046492 Bacteria 1745
275 Ga0495594_0204801 3300046499 Bacteria 1125
276 Ga0495607_0164158 3300046501 Bacteria 1126
277 Ga0495608_0000850 3300046511 Bacteria 21361
278 Ga0495608_0008580 3300046511 Bacteria 7157
279 Ga0495618_0094297 3300046514 Bacteria 1914
280 Ga0495628_0000916 3300046516 Bacteria 27072
281 Ga0495628_0023934 3300046516 Bacteria 5006
282 Ga0495628_0502562 3300046516 Bacteria 875
283 Ga0495630_0073219 3300046517 Bacteria 2580
284 Ga0495632_0162991 3300046519 Bacteria 1026
285 Ga0495666_0041431 3300046526 Bacteria 2230
286 Ga0495652_0002074 3300046529 Bacteria 21194
287 Ga0495652_0231549 3300046529 Bacteria 1381
288 Ga0495665_0110528 3300046531 Bacteria 1441
289 Ga0495640_0074721 3300046533 Bacteria 2265
290 Ga0495640_0237453 3300046533 Bacteria 1145
291 Ga0495586_0175082 3300046535 Bacteria 1213
292 Ga0495587_0000078 3300046536 Bacteria 76639
293 Ga0495667_0000122 3300046559 Bacteria 56141
294 Ga0495667_0003302 3300046559 Bacteria 10816
295 Ga0495656_0269259 3300046615 Bacteria 865
296 Ga0495634_0084428 3300046642 Bacteria 2070
297 Ga0495634_0087718 3300046642 Bacteria 2024
298 Ga0495625_0328021 3300046660 Bacteria 973
299 Ga0495635_0088982 3300046663 Bacteria 2112
300 Ga0495635_0166659 3300046663 Bacteria 1499
301 Ga0495657_0000098 3300046675 Bacteria 76618
302 Ga0495599_0000115 3300046678 Bacteria 53313
303 Ga0495599_0005086 3300046678 Bacteria 7829
304 Ga0495599_0060173 3300046678 Bacteria 2375
305 Ga0495623_0000184 3300046679 Bacteria 39482
306 Ga0495623_0005936 3300046679 Bacteria 7959
307 Ga0495623_0021018 3300046679 Bacteria 4217
308 Ga0495646_0022662 3300046680 Bacteria 3959
309 Ga0495646_0040998 3300046680 Bacteria 2847
310 Ga0495646_0331142 3300046680 Bacteria 800
311 Ga0495647_0164366 3300046681 Bacteria 958
312 Ga0495624_0118456 3300046690 Bacteria 1627
313 Ga0495624_0174586 3300046690 Bacteria 1310
314 Ga0495671_0140940 3300046692 Bacteria 1175
315 Ga0495600_0029048 3300046809 Bacteria 3580
316 Ga0495600_0106109 3300046809 Bacteria 1830
317 Ga0495581_0051503 3300047315 Bacteria 2377
318 Ga0495581_0087424 3300047315 Bacteria 1807
319 Ga0495581_0101376 3300047315 Bacteria 1672
320 Ga0495581_0194440 3300047315 Bacteria 1187
321 Ga0495604_0000142 3300047317 Bacteria 61620
322 Ga0495604_0004926 3300047317 Bacteria 10585
323 Ga0495674_0066823 3300047319 Bacteria 3117
324 Ga0495674_0149182 3300047319 Bacteria 1961
325 Ga0495676_0117565 3300047321 Bacteria 1939
326 Ga0495680_0000111 3300047322 Bacteria 76638
327 Ga0495680_0019144 3300047322 Bacteria 5791
328 Ga0495675_0001489 3300047444 Bacteria 14176
329 Ga0495675_0005280 3300047444 Bacteria 7868
330 Ga0495684_0016548 3300047471 Bacteria 5680
331 Ga0495593_0016425 3300047673 Bacteria 4176
332 Ga0495602_0000820 3300048088 Bacteria 29788
333 Ga0495602_0021321 3300048088 Bacteria 6381
334 Ga0495602_0174954 3300048088 Bacteria 1662
335 Ga0495602_0610173 3300048088 Bacteria 749
336 Ga0496100_0014597 3300048903 Bacteria 4565
337 Ga0496100_0417458 3300048903 Bacteria 1024
338 Ga0496100_0528372 3300048903 Bacteria 911
339 Ga0496101_0096242 3300048904 Bacteria 2210
340 Ga0496102_0235643 3300048905 Bacteria 1726
341 Ga0496102_0458968 3300048905 Bacteria 1195
342 Ga0496103_0059062 3300048906 Bacteria 2383
343 Ga0496104_0040555 3300048907 Bacteria 4364
344 Ga0496104_0054839 3300048907 Bacteria 3768
345 Ga0496104_0082484 3300048907 Bacteria 3066
346 Ga0496105_0028585 3300048908 Bacteria 4559
347 Ga0496105_0148833 3300048908 Bacteria 1925
348 Ga0496105_0158588 3300048908 Bacteria 1858
349 Ga0496105_0205594 3300048908 Bacteria 1606
350 Ga0496105_0219951 3300048908 Bacteria 1546
351 Ga0496106_0053038 3300048909 Bacteria 3061
352 Ga0496106_0057691 3300048909 Bacteria 2936
353 Ga0496107_0047426 3300048910 Bacteria 3094
354 Ga0496108_0002572 3300048911 Bacteria 14535
355 Ga0496108_0011152 3300048911 Bacteria 7304
356 Ga0496108_0124387 3300048911 Bacteria 2214
357 Ga0496108_0142620 3300048911 Bacteria 2064
358 Ga0496109_0005577 3300048912 Bacteria 10536
359 Ga0496109_0715362 3300048912 Bacteria 939
360 Ga0496109_0821464 3300048912 Bacteria 867
361 Ga0496110_0018284 3300048913 Bacteria 5876
362 Ga0496110_0020392 3300048913 Bacteria 5598
363 Ga0496110_0139204 3300048913 Bacteria 2194
364 Ga0496110_0178157 3300048913 Bacteria 1930
365 Ga0496110_0507278 3300048913 Bacteria 1098
366 Ga0496110_0577659 3300048913 Bacteria 1021
367 Ga0496111_0004122 3300048914 Bacteria 9127
368 Ga0496111_0028242 3300048914 Bacteria 3975
369 Ga0496112_0024424 3300048915 Bacteria 5787
370 Ga0496113_0072762 3300048916 Bacteria 2617
371 Ga0496113_0136940 3300048916 Bacteria 1924
372 Ga0496114_0011245 3300048917 Bacteria 7146
373 Ga0496114_0064033 3300048917 Bacteria 3079
374 Ga0496114_0068056 3300048917 Bacteria 2989
375 Ga0496114_0628737 3300048917 Bacteria 945
376 Ga0496115_0061301 3300048918 Bacteria 3033
377 Ga0496118_0061638 3300048921 Bacteria 2776
378 Ga0496119_0025506 3300048922 Bacteria 4127
379 Ga0496126_0052990 3300048929 Bacteria 3683
380 Ga0501031_0214504 3300049568 Bacteria 1254
381 Ga0501032_0118255 3300049569 Bacteria 1752
382 Ga0501033_0020916 3300049570 Bacteria 4939
383 Ga0501033_0022013 3300049570 Bacteria 4808
384 Ga0501034_0070903 3300049571 Bacteria 3495
385 Ga0501036_0031767 3300049572 Bacteria 4461
386 Ga0501037_0604102 3300049573 Bacteria 736
387 Ga0501039_0392106 3300049575 Bacteria 1090
388 Ga0501040_0035766 3300049576 Bacteria 3369
389 Ga0501043_0118492 3300049579 Bacteria 2076
390 Ga0501047_0110503 3300049581 Bacteria 2631
391 Ga0501047_0320675 3300049581 Bacteria 1389
392 Ga0501048_0112588 3300049582 Bacteria 1922
393 Ga0501048_0184180 3300049582 Bacteria 1480
394 Ga0501069_0068588 3300049585 Bacteria 1984
395 Ga0501070_0013936 3300049586 Bacteria 6768
396 Ga0501070_0631421 3300049586 Bacteria 852
397 Ga0501071_0117297 3300049587 Bacteria 1971
398 Ga0501071_0197773 3300049587 Bacteria 1509
399 Ga0501072_0048027 3300049588 Bacteria 3361
400 Ga0501072_0059631 3300049588 Bacteria 3009
401 Ga0501072_0208752 3300049588 Bacteria 1556
402 Ga0501074_0074292 3300049590 Bacteria 2441
403 Ga0501074_0202570 3300049590 Bacteria 1414
404 Ga0501075_0040511 3300049591 Bacteria 3489
405 Ga0501075_0086698 3300049591 Bacteria 2372
406 Ga0501076_0004747 3300049592 Bacteria 9700
407 Ga0501076_0012113 3300049592 Bacteria 6447
408 Ga0501077_0207197 3300049593 Bacteria 1246
409 Ga0501079_0103520 3300049741 Bacteria 2208
410 Ga0501080_0040444 3300049742 Bacteria 4349
411 Ga0501080_0207998 3300049742 Bacteria 1794
412 Ga0501081_0160759 3300049743 Bacteria 1618
413 Ga0501044_0229420 3300049823 Bacteria 1805
414 Ga0501045_0023028 3300049824 Bacteria 4463
415 Ga0501045_0108233 3300049824 Bacteria 2060
416 nmdc:mga05p37_71119_c1 3300050507 Bacteria 4280
417 nmdc:mga09592_689158_c1 3300050508 Bacteria 870
418 nmdc:mga06r32_612736_c1 3300050510 Bacteria 1059
419 nmdc:mga08y16_523075_c1 3300050511 Bacteria 1203
420 nmdc:mga0n895_437108_c1 3300050512 Bacteria 1322
421 Ga0495601_0003491 3300053077 Bacteria 9024
422 Ga0495601_0137126 3300053077 Bacteria 1595
423 Ga0495601_0137795 3300053077 Bacteria 1591
424 Ga0495601_0364152 3300053077 Bacteria 939
425 Ga0495612_0029333 3300053078 Bacteria 2216
426 Ga0495612_0112517 3300053078 Bacteria 1166
427 Ga0495595_0007699 3300053084 Bacteria 4413
428 Ga0495595_0016962 3300053084 Bacteria 3125
429 Ga0495619_0045257 3300053085 Bacteria 2891
430 Ga0495619_0141192 3300053085 Bacteria 1659
431 Ga0500644_0010670 3300053088 Bacteria 2491
432 Ga0500651_0027845 3300053093 Bacteria 3554
433 Ga0500641_0008959 3300053096 Bacteria 3586
434 Ga0500641_0108467 3300053096 Bacteria 1194
435 Ga0500650_0029329 3300053098 Bacteria 2490
436 Ga0500569_003285 3300053109 Bacteria 3287
437 Ga0500652_017426 3300053131 Bacteria 2633
438 Ga0501084_0042768 3300054114 Bacteria 3790
439 Ga0501082_0087192 3300060353 Bacteria 2693
440 Ga0501082_0109309 3300060353 Bacteria 2393
441 Ga0466962_0026578 3300061719 Bacteria 2778
442 Ga0530510_0062088 3300061734 Bacteria 2705
443 2645722230 2643221961 Bacteria 3919167
444 2645725100 2643221962 Bacteria 3874254
445 2857737681 2857737099 Bacteria 3104305
446 Ga0495656_0220547
447 Ga0070658_10131139
448 Ga0070658_10200135
449 Ga0070658_10433691
450 Ga0070683_100095001
451 Ga0070683_100285216
452 Ga0068869_100921606
453 Ga0070680_100594876
454 Ga0070660_100009579
455 Ga0070709_10323063
456 Ga0070714_100020864
457 Ga0070714_100033687
458 Ga0070714_100062648
459 Ga0070714_100110703
460 Ga0070714_100116206
461 Ga0070713_100026753
462 Ga0070713_100075993
463 Ga0070713_100238197
464 Ga0070710_10007530
465 Ga0070710_10353139
466 Ga0070711_100039050
467 Ga0070700_100238947
468 Ga0070708_100006734
469 Ga0070708_100285133
470 Ga0070663_100204123
471 Ga0070706_100024852
472 Ga0070707_100005989
473 Ga0070707_100061522
474 Ga0070698_100179048
475 Ga0070699_100031330
476 Ga0070679_100022060
477 Ga0070679_100039211
478 Ga0070679_100059556
479 Ga0070684_100039897
480 Ga0070684_100049243
481 Ga0070684_100353346
482 Ga0070697_100027959
483 Ga0070672_100662201
484 Ga0068855_100006784
485 Ga0068857_100175480
486 Ga0068857_100205786
487 Ga0068854_100304713
488 Ga0068854_100522572
489 Ga0068856_100268622
490 Ga0068852_100363506
491 Ga0068852_101066470
492 Ga0068859_100237610
493 Ga0068864_100597099
494 Ga0068861_100234448
495 Ga0068861_100292555
496 Ga0068858_100235352
497 Ga0081455_10003941
498 Ga0081455_10041117
499 Ga0081540_1000481
500 Ga0081540_1014586
501 Ga0081539_10185824
502 Ga0070717_10003281
503 Ga0070717_10019203
504 Ga0070717_10046670
505 Ga0070717_10083206
506 Ga0070715_10055078
507 Ga0070716_100032197
508 Ga0070716_100124371
509 Ga0070716_100225917
510 Ga0070712_100056342
511 Ga0070712_100204301
512 Ga0070712_100335738
513 Ga0075428_100234948
514 Ga0075431_100083192
515 Ga0075433_10014412
516 Ga0075434_100390563
517 Ga0075429_100876067
518 Ga0075436_100107961
519 Ga0097620_100237615
520 Ga0105240_10001343
521 Ga0111539_10076053
522 Ga0105245_10145190
523 Ga0105245_11153001
524 Ga0114129_10005099
525 Ga0105246_10215780
526 Ga0157370_10008057
527 Ga0157369_10011665
528 Ga0157369_10462380
529 Ga0163162_10646077
530 Ga0163162_10648529
531 Ga0163163_10181268
532 Ga0157380_10883972
533 Ga0157379_10263095
534 Ga0157379_10783096
535 Ga0157376_10146132
536 Ga0157376_10676510
537 Ga0163161_10165458
538 Ga0197907_11372245
539 Ga0206356_11008897
540 Ga0206351_10737524
541 Ga0206350_11032748
542 Ga0206354_11421964
543 Ga0206353_11375294
544 Ga0154015_1539000
545 Ga0213874_10125495
546 Ga0213876_10003619
547 Ga0213875_10000398
548 Ga0213875_10002644
549 Ga0224712_10006049
550 Ga0207692_10001157
551 Ga0207692_10005655
552 Ga0207699_10003373
553 Ga0207699_10382506
554 Ga0207705_10161636
555 Ga0207684_10010445
556 Ga0207684_10010882
557 Ga0207684_10039723
558 Ga0207684_10231423
559 Ga0207695_10480415
560 Ga0207693_10014369
561 Ga0207693_10059586
562 Ga0207693_10185131
563 Ga0207693_10484680
564 Ga0207663_10011215
565 Ga0207663_10077701
566 Ga0207660_10092553
567 Ga0207660_10445518
568 Ga0207662_10623317
569 Ga0207657_10066853
570 Ga0207652_10019574
571 Ga0207652_10023938
572 Ga0207646_10025380
573 Ga0207646_10122863
574 Ga0207687_10242562
575 Ga0207700_10002282
576 Ga0207700_10010741
577 Ga0207700_10025382
578 Ga0207700_10073314
579 Ga0207700_10151544
580 Ga0207664_10004113
581 Ga0207664_10005852
582 Ga0207664_10013666
583 Ga0207664_10028353
584 Ga0207664_10082571
585 Ga0207670_10214966
586 Ga0207669_10448339
587 Ga0207665_10002597
588 Ga0207665_10015147
589 Ga0207665_10078225
590 Ga0207665_10145795
591 Ga0207661_10082434
592 Ga0207679_10017043
593 Ga0207677_10287253
594 Ga0207703_10323180
595 Ga0207678_10006092
596 Ga0207678_10110117
597 Ga0207678_10193946
598 Ga0207702_10071894
599 Ga0207676_10110121
600 Ga0207676_10986354
601 Ga0207674_10048404
602 Ga0207675_100119644
603 Ga0207698_10306386
604 Ga0207428_10042830
605 Ga0268266_10167422
606 Ga0307517_10027818
607 Ga0307515_10018371
608 Ga0307515_10043688
609 Ga0307515_10092892
610 Ga0265338_10049548
611 Ga0265338_10383744
612 Ga0307512_10003183
613 Ga0307512_10003501
614 Ga0307512_10016971
615 Ga0265340_10094260
616 Ga0265339_10319076
617 Ga0265331_10140741
618 Ga0265316_10292998
619 Ga0307513_10026149
620 Ga0307513_10125349
621 Ga0307408_100012422
622 Ga0265313_10077860
623 Ga0307508_10013184
624 Ga0307508_10185930
625 Ga0307514_10004145
626 Ga0265314_10370996
627 Ga0307516_10032411
628 Ga0307413_10173196
629 Ga0307410_10056881
630 Ga0307406_10001653
631 Ga0307407_10006669
632 Ga0307412_10145700
633 Ga0307409_100000234
634 Ga0307409_100765071
635 Ga0307409_100909180
636 Ga0307416_100030008
637 Ga0307416_100318115
638 Ga0307411_10936963
639 Ga0307415_100000003
640 Ga0307415_100317107
641 Ga0307510_10072652
642 Ga0316215_1007398
643 Ga0316214_1007871
644 Ga0316212_1008863
645 Ga0373926_0187599
646 Ga0373934_0000165
647 Ga0373934_0003259
648 Ga0373951_0073979
649 Ga0373923_0133210
650 Ga0373953_0000062
651 Ga0373953_0081416
652 Ga0373954_0000701
653 Ga0373954_0046584
654 Ga0373956_0000061
655 Ga0373956_0100601
656 Ga0373957_0000042
657 Ga0373955_0000106
658 Ga0373955_0004596
659 Ga0373962_0056692
660 Ga0373924_0000421
661 Ga0373924_0009928
662 Ga0373931_0217184
663 Ga0373933_0000046
664 Ga0373933_0000989
665 Ga0373937_0000115
666 Ga0373937_0005878
667 Ga0373925_0056404
668 Ga0373925_0384291
669 Ga0395900_0370347
670 Ga0395898_0134814
671 Ga0436364_0331782
672 Ga0436364_0395778
673 Ga0436364_0923878
674 Ga0395901_0094095
675 Ga0436365_0727080
676 Ga0436361_0459143
677 Ga0436361_0543946
678 Ga0436363_0182131
679 Ga0436363_0777590
680 Ga0451789_0260510
681 Ga0451791_0029453
682 Ga0451793_0934301
683 Ga0451797_0325178
684 Ga0451807_1335412
685 Ga0451837_0809089
686 Ga0451837_0896682
687 Ga0451843_0667147
688 Ga0466961_0062102
689 Ga0466961_0118215
690 Ga0466963_0109134
691 Ga0466963_0600762
692 Ga0466964_0225731
693 Ga0466971_0212175
694 Ga0466959_0267881
695 Ga0466958_0086823
696 Ga0466967_0039464
697 Ga0466967_0119549
698 Ga0466967_0213333
699 Ga0466967_0304017
700 Ga0466967_0333563
701 Ga0466967_0603462
702 Ga0495592_0000166
703 Ga0495592_0007703
704 Ga0495603_0046084
705 Ga0495603_0154806
706 Ga0495629_0018306
707 Ga0495629_0166113
708 Ga0495651_0000067
709 Ga0495651_0004738
710 Ga0495653_0004436
711 Ga0495653_0012153
712 Ga0495653_0023951
713 Ga0495582_0003242
714 Ga0495582_0272429
715 Ga0495662_0047396
716 Ga0495664_0010346
717 Ga0495664_0160579
718 Ga0495584_0118309
719 Ga0495585_0082142
720 Ga0495594_0204801
721 Ga0495607_0164158
722 Ga0495608_0000850
723 Ga0495608_0008580
724 Ga0495618_0094297
725 Ga0495628_0000916
726 Ga0495628_0023934
727 Ga0495628_0502562
728 Ga0495630_0073219
729 Ga0495632_0162991
730 Ga0495666_0041431
731 Ga0495652_0002074
732 Ga0495652_0231549
733 Ga0495665_0110528
734 Ga0495640_0074721
735 Ga0495640_0237453
736 Ga0495586_0175082
737 Ga0495587_0000078
738 Ga0495667_0000122
739 Ga0495667_0003302
740 Ga0495656_0269259
741 Ga0495634_0084428
742 Ga0495634_0087718
743 Ga0495625_0328021
744 Ga0495635_0088982
745 Ga0495635_0166659
746 Ga0495657_0000098
747 Ga0495599_0000115
748 Ga0495599_0005086
749 Ga0495599_0060173
750 Ga0495623_0000184
751 Ga0495623_0005936
752 Ga0495623_0021018
753 Ga0495646_0022662
754 Ga0495646_0040998
755 Ga0495646_0331142
756 Ga0495647_0164366
757 Ga0495624_0118456
758 Ga0495624_0174586
759 Ga0495671_0140940
760 Ga0495600_0029048
761 Ga0495600_0106109
762 Ga0495581_0051503
763 Ga0495581_0087424
764 Ga0495581_0101376
765 Ga0495581_0194440
766 Ga0495604_0000142
767 Ga0495604_0004926
768 Ga0495674_0066823
769 Ga0495674_0149182
770 Ga0495676_0117565
771 Ga0495680_0000111
772 Ga0495680_0019144
773 Ga0495675_0001489
774 Ga0495675_0005280
775 Ga0495684_0016548
776 Ga0495593_0016425
777 Ga0495602_0000820
778 Ga0495602_0021321
779 Ga0495602_0174954
780 Ga0495602_0610173
781 Ga0496100_0014597
782 Ga0496100_0417458
783 Ga0496100_0528372
784 Ga0496101_0096242
785 Ga0496102_0235643
786 Ga0496102_0458968
787 Ga0496103_0059062
788 Ga0496104_0040555
789 Ga0496104_0054839
790 Ga0496104_0082484
791 Ga0496105_0028585
792 Ga0496105_0148833
793 Ga0496105_0158588
794 Ga0496105_0205594
795 Ga0496105_0219951
796 Ga0496106_0053038
797 Ga0496106_0057691
798 Ga0496107_0047426
799 Ga0496108_0002572
800 Ga0496108_0011152
801 Ga0496108_0124387
802 Ga0496108_0142620
803 Ga0496109_0005577
804 Ga0496109_0715362
805 Ga0496109_0821464
806 Ga0496110_0018284
807 Ga0496110_0020392
808 Ga0496110_0139204
809 Ga0496110_0178157
810 Ga0496110_0507278
811 Ga0496110_0577659
812 Ga0496111_0004122
813 Ga0496111_0028242
814 Ga0496112_0024424
815 Ga0496113_0072762
816 Ga0496113_0136940
817 Ga0496114_0011245
818 Ga0496114_0064033
819 Ga0496114_0068056
820 Ga0496114_0628737
821 Ga0496115_0061301
822 Ga0496118_0061638
823 Ga0496119_0025506
824 Ga0496126_0052990
825 Ga0501031_0214504
826 Ga0501032_0118255
827 Ga0501033_0020916
828 Ga0501033_0022013
829 Ga0501034_0070903
830 Ga0501036_0031767
831 Ga0501037_0604102
832 Ga0501039_0392106
833 Ga0501040_0035766
834 Ga0501043_0118492
835 Ga0501047_0110503
836 Ga0501047_0320675
837 Ga0501048_0112588
838 Ga0501048_0184180
839 Ga0501069_0068588
840 Ga0501070_0013936
841 Ga0501070_0631421
842 Ga0501071_0117297
843 Ga0501071_0197773
844 Ga0501072_0048027
845 Ga0501072_0059631
846 Ga0501072_0208752
847 Ga0501074_0074292
848 Ga0501074_0202570
849 Ga0501075_0040511
850 Ga0501075_0086698
851 Ga0501076_0004747
852 Ga0501076_0012113
853 Ga0501077_0207197
854 Ga0501079_0103520
855 Ga0501080_0040444
856 Ga0501080_0207998
857 Ga0501081_0160759
858 Ga0501044_0229420
859 Ga0501045_0023028
860 Ga0501045_0108233
861 nmdc:mga05p37_71119_c1
862 nmdc:mga09592_689158_c1
863 nmdc:mga06r32_612736_c1
864 nmdc:mga08y16_523075_c1
865 nmdc:mga0n895_437108_c1
866 Ga0495601_0003491
867 Ga0495601_0137126
868 Ga0495601_0137795
869 Ga0495601_0364152
870 Ga0495612_0029333
871 Ga0495612_0112517
872 Ga0495595_0007699
873 Ga0495595_0016962
874 Ga0495619_0045257
875 Ga0495619_0141192
876 Ga0500644_0010670
877 Ga0500651_0027845
878 Ga0500641_0008959
879 Ga0500641_0108467
880 Ga0500650_0029329
881 Ga0500569_003285
882 Ga0500652_017426
883 Ga0501084_0042768
884 Ga0501082_0087192
885 Ga0501082_0109309
886 Ga0466962_0026578
887 Ga0530510_0062088
888 2645722230
889 2645725100
890 2857737681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

63

242

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.9605 12 217
1jdi-assembly1.cif.gz_A crystal structure of l-ribulose-5-phosphate 4-epimerase 0.9425 11 217
1dzz-assembly1.cif.gz_P l-fuculose-1-phosphate aldolase from escherichia coli mutant y113f 0.9392 11 220
1e46-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant e73s 0.9385 11 217
1e4a-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant del(27) 0.938 11 217
ID Description Score Start End Superfamily
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9605 12 217 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9561 15 215 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9424 15 215 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9381 12 217 3.40.225.10
2fuaA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9299 11 223 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A6N9XRW3-F1-model_v4 deleted 0.9861 90 225
AF-A0A2N2M7S7-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.9854 87 224 GO:0005829
GO:0008742
GO:0016832
GO:0019323
GO:0046872
AF-A0A1M6VDD8-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.9851 7 224 GO:0005829
GO:0016832
GO:0016853
GO:0019323
GO:0046872
AF-A0A2W2D586-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.984 11 225 GO:0005829
GO:0016832
GO:0016853
GO:0019323
GO:0046872
AF-A0A7J5BNE1-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.9796 9 224 GO:0005829
GO:0016832
GO:0016853
GO:0019323
GO:0046872

Map