F445280

General Info

Members Datasets Scaffolds Average Seq Length
444 292 888 291

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10060107|Ga0163162_100601072
Length 325
Sequence MAAGKELRRRQSRLAISQLEYAKEQSMNAATQSMPLSSDDLALVLALTRAPTLAEAGLRLGVDTSTVFRALQRVEKRLGRRLFERDRGGYRAGELALQLAGHAERIEAELEGARSQLATGEDRVSGRVRVTTTDTVLYGLVMPVLGELTARHPHLQLELDMSYELASLSRRDADIALRATRRPPGHLVGRRLGAVRVAVYAHRKLARSAASLDALASLPWAVPDAALPDHPSARWRRKHLPKVVPRLELHGVLAVMEAVAAGVAVGVVPIFLADAYADVLALTEPIDEAETDLWMLAHPESRHLRRIAVVAASLAENIRLDAAAA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
199 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
200 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
201 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
202 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
253 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
254 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
255 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
258 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
267 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
268 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
269 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
278 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
279 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
280 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
281 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
282 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
283 2643221556 Massilia sp. Root1485 Isolate Unclassified
284 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
285 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
286 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
287 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
288 2643221684 Massilia sp. Root133 Isolate Unclassified
289 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
290 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
291 2928058823 Ralstonia sp. 1138 Isolate Unclassified
292 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0.9
Isolates 3.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0
Rhizoplane 4.05
Rhizosphere 70.72
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10060107 3300013306 Bacteria 3834
2 JGI24741J21665_1000658 3300001915 Bacteria 10437
3 JGI24740J21852_10000209 3300001979 Bacteria 24451
4 JGI24740J21852_10001259 3300001979 Bacteria 11466
5 JGI25156J39149_1009475 3300002705 Bacteria 2360
6 JGI25156J39149_1014898 3300002705 Bacteria 1580
7 JGI25154J39366_1001487 3300002738 Bacteria 8248
8 JGI25153J46596_10002209 3300003215 Bacteria 11364
9 rootH1_10022645 3300003316 Bacteria 5044
10 rootH1_10116139 3300003316 Bacteria 1394
11 rootL2_10013604 3300003322 Bacteria 8555
12 rootL2_10055306 3300003322 Bacteria 5599
13 rootL2_10135496 3300003322 Bacteria 2639
14 rootL2_10167649 3300003322 Bacteria 6504
15 rootL2_10169292 3300003322 Bacteria 1934
16 rootH1_10032690 3300003323 Bacteria 7693
17 rootH1_10053051 3300003323 Bacteria 6212
18 rootH1_10057788 3300003323 Bacteria 2281
19 rootH1_10151567 3300003323 Bacteria 2915
20 Ga0006562J51391_1058405 3300003578 Bacteria 2840
21 Ga0055539_1000326 3300003752 Bacteria 24199
22 Ga0055532_1000149 3300003758 Bacteria 66954
23 Ga0055525_1000006 3300003759 Bacteria 642912
24 Ga0055525_1000417 3300003759 Bacteria 25804
25 Ga0055535_1000180 3300003761 Bacteria 66954
26 Ga0055542_1001946 3300003762 Bacteria 8054
27 Ga0055529_1000245 3300003763 Bacteria 66949
28 Ga0055526_1007354 3300003771 Bacteria 5746
29 Ga0055530_10001181 3300003791 Bacteria 20175
30 Ga0055541_1001682 3300003841 Bacteria 4669
31 Ga0065165_1000656 3300005262 Bacteria 49919
32 Ga0070658_10025320 3300005327 Bacteria 4757
33 Ga0070676_10124802 3300005328 Bacteria 1620
34 Ga0070683_100226592 3300005329 Bacteria 1776
35 Ga0070690_100082170 3300005330 Bacteria 2109
36 Ga0070690_100415113 3300005330 Bacteria 991
37 Ga0070670_100088066 3300005331 Bacteria 2669
38 Ga0070670_100151833 3300005331 Bacteria 2005
39 Ga0070670_100276248 3300005331 Bacteria 1467
40 Ga0070677_10070739 3300005333 Bacteria 1467
41 Ga0070677_10072089 3300005333 Bacteria 1456
42 Ga0070677_10155743 3300005333 Bacteria 1067
43 Ga0068869_100349390 3300005334 Unclassified 1205
44 Ga0068869_100383749 3300005334 Bacteria 1152
45 Ga0070666_10008268 3300005335 Bacteria 6452
46 Ga0070682_100050176 3300005337 Bacteria 2604
47 Ga0070682_100234702 3300005337 Bacteria 1313
48 Ga0068868_100002199 3300005338 Bacteria 13462
49 Ga0068868_100046638 3300005338 Bacteria 3393
50 Ga0068868_100075517 3300005338 Bacteria 2693
51 Ga0070660_100308910 3300005339 Bacteria 1297
52 Ga0070661_100001832 3300005344 Bacteria 14713
53 Ga0070661_100093752 3300005344 Bacteria 2224
54 Ga0070668_100028394 3300005347 Bacteria 4248
55 Ga0070669_100014650 3300005353 Bacteria 5581
56 Ga0070675_100001074 3300005354 Bacteria 19712
57 Ga0070675_100004321 3300005354 Bacteria 10834
58 Ga0070671_100007790 3300005355 Bacteria 8554
59 Ga0070671_100022571 3300005355 Bacteria 5140
60 Ga0070671_100083533 3300005355 Bacteria 2670
61 Ga0070671_100106024 3300005355 Bacteria 2359
62 Ga0070671_100252895 3300005355 Bacteria 1497
63 Ga0070674_100068989 3300005356 Bacteria 2493
64 Ga0070673_100009810 3300005364 Bacteria 6449
65 Ga0070673_100169161 3300005364 Bacteria 1864
66 Ga0070659_100002375 3300005366 Bacteria 13379
67 Ga0070659_100031493 3300005366 Bacteria 4108
68 Ga0070700_100008919 3300005441 Bacteria 5485
69 Ga0070663_100000001 3300005455 Bacteria 318372
70 Ga0070678_100179821 3300005456 Bacteria 1730
71 Ga0070662_100004399 3300005457 Bacteria 8907
72 Ga0070662_100006160 3300005457 Bacteria 7712
73 Ga0068853_100037433 3300005539 Bacteria 4128
74 Ga0068853_100546801 3300005539 Bacteria 1097
75 Ga0070672_100088590 3300005543 Bacteria 2492
76 Ga0070693_100061609 3300005547 Bacteria 2182
77 Ga0068855_100040196 3300005563 Bacteria 5551
78 Ga0070664_100000016 3300005564 Bacteria 128509
79 Ga0068854_100000124 3300005578 Bacteria 53140
80 Ga0068854_100014889 3300005578 Bacteria 5135
81 Ga0068856_100001285 3300005614 Bacteria 26413
82 Ga0068856_100203234 3300005614 Bacteria 1996
83 Ga0070702_100067783 3300005615 Bacteria 2098
84 Ga0068852_100086558 3300005616 Bacteria 2794
85 Ga0068852_100167513 3300005616 Bacteria 2057
86 Ga0068859_100010331 3300005617 Bacteria 9397
87 Ga0068864_100003722 3300005618 Bacteria 12592
88 Ga0068864_100016321 3300005618 Bacteria 6183
89 Ga0068864_100056096 3300005618 Bacteria 3404
90 Ga0068864_100203480 3300005618 Bacteria 1820
91 Ga0068866_10025814 3300005718 Bacteria 2767
92 Ga0068861_100005129 3300005719 Bacteria 8829
93 Ga0068861_100030007 3300005719 Bacteria 3982
94 Ga0068870_10084946 3300005840 Bacteria 1758
95 Ga0068870_10110975 3300005840 Bacteria 1566
96 Ga0068863_100011848 3300005841 Bacteria 8428
97 Ga0068863_100043122 3300005841 Bacteria 4283
98 Ga0068863_100096296 3300005841 Bacteria 2810
99 Ga0068863_100493133 3300005841 Bacteria 1206
100 Ga0068858_100002455 3300005842 Bacteria 18716
101 Ga0068858_100067199 3300005842 Bacteria 3320
102 Ga0068858_100459506 3300005842 Bacteria 1228
103 Ga0068860_100007353 3300005843 Bacteria 11010
104 Ga0068860_100018150 3300005843 Bacteria 6847
105 Ga0068860_100045308 3300005843 Bacteria 4194
106 Ga0068862_100064457 3300005844 Bacteria 3154
107 Ga0068862_100084487 3300005844 Bacteria 2758
108 Ga0068862_100104274 3300005844 Bacteria 2484
109 Ga0075365_10025135 3300006038 Bacteria 3768
110 Ga0075368_10021610 3300006042 Bacteria 2446
111 Ga0075363_100016344 3300006048 Bacteria 3665
112 Ga0075363_100054304 3300006048 Bacteria 2143
113 Ga0075362_10070702 3300006177 Bacteria 1593
114 Ga0075367_10007185 3300006178 Bacteria 5685
115 Ga0075366_10002438 3300006195 Bacteria 9526
116 Ga0075366_10144636 3300006195 Bacteria 1438
117 Ga0075366_10166983 3300006195 Bacteria 1335
118 Ga0097621_100006661 3300006237 Bacteria 8210
119 Ga0097621_100265849 3300006237 Bacteria 1506
120 Ga0097621_100403683 3300006237 Bacteria 1224
121 Ga0075370_10031343 3300006353 Bacteria 2968
122 Ga0068871_100011230 3300006358 Bacteria 6564
123 Ga0075430_100223991 3300006846 Bacteria 1560
124 Ga0075431_100302270 3300006847 Bacteria 1616
125 Ga0075429_100163605 3300006880 Bacteria 1949
126 Ga0097620_100010330 3300006931 Bacteria 9397
127 Ga0105240_10257633 3300009093 Bacteria 2014
128 Ga0105240_10770139 3300009093 Bacteria 1045
129 Ga0111539_10016994 3300009094 Bacteria 9005
130 Ga0111539_10393795 3300009094 Bacteria 1613
131 Ga0105245_10009658 3300009098 Bacteria 8413
132 Ga0105245_10299027 3300009098 Bacteria 1579
133 Ga0114129_10080975 3300009147 Bacteria 4514
134 Ga0105243_10157413 3300009148 Bacteria 1955
135 Ga0105241_10205886 3300009174 Bacteria 1646
136 Ga0105248_10018741 3300009177 Bacteria 7653
137 Ga0105237_10163016 3300009545 Bacteria 2228
138 Ga0105249_10235839 3300009553 Bacteria 1806
139 Ga0105239_10180719 3300010375 Bacteria 2360
140 Ga0157373_10137761 3300013100 Bacteria 1716
141 Ga0157371_10001722 3300013102 Bacteria 22211
142 Ga0157371_10050626 3300013102 Bacteria 2952
143 Ga0157370_10001175 3300013104 Bacteria 32662
144 Ga0157369_10205644 3300013105 Bacteria 2065
145 Ga0157374_10015418 3300013296 Bacteria 6703
146 Ga0157374_10310568 3300013296 Bacteria 1561
147 Ga0157378_10014200 3300013297 Bacteria 6970
148 Ga0157378_10247741 3300013297 Bacteria 1705
149 Ga0157378_10481873 3300013297 Bacteria 1236
150 Ga0163162_10012165 3300013306 Bacteria 8401
151 Ga0163162_10026322 3300013306 Bacteria 5749
152 Ga0157372_10005008 3300013307 Bacteria 14073
153 Ga0157372_10013706 3300013307 Bacteria 8665
154 Ga0157375_10043226 3300013308 Bacteria 4368
155 Ga0157375_10083172 3300013308 Bacteria 3245
156 Ga0157375_10083607 3300013308 Bacteria 3237
157 Ga0157375_10120230 3300013308 Bacteria 2735
158 Ga0163163_10061111 3300014325 Bacteria 3732
159 Ga0157380_10004965 3300014326 Bacteria 9269
160 Ga0157380_10136389 3300014326 Bacteria 2101
161 Ga0182008_10007906 3300014497 Bacteria 5834
162 Ga0157379_10008582 3300014968 Bacteria 8891
163 Ga0157379_10024519 3300014968 Bacteria 5354
164 Ga0157379_10077870 3300014968 Bacteria 2969
165 Ga0157379_10563313 3300014968 Bacteria 1061
166 Ga0157376_10006844 3300014969 Bacteria 8071
167 Ga0157376_10008302 3300014969 Bacteria 7486
168 Ga0157376_10517476 3300014969 Bacteria 1175
169 Ga0182006_1001760 3300015261 Bacteria 12555
170 Ga0182006_1006994 3300015261 Bacteria 5193
171 Ga0182007_10001066 3300015262 Bacteria 14961
172 Ga0163161_10044706 3300017792 Bacteria 3191
173 Ga0163161_10086947 3300017792 Bacteria 2308
174 Ga0197907_10652968 3300020069 Bacteria 1186
175 Ga0154015_1243737 3300020610 Bacteria 3624
176 Ga0209784_100006 3300025224 Bacteria 930704
177 Ga0209566_100002 3300025225 Bacteria 2614868
178 Ga0209566_100526 3300025225 Bacteria 26148
179 Ga0209566_100895 3300025225 Bacteria 14316
180 Ga0209674_100010 3300025226 Bacteria 1038638
181 Ga0209674_100176 3300025226 Bacteria 79399
182 Ga0209674_100430 3300025226 Bacteria 20230
183 Ga0209674_104368 3300025226 Bacteria 2314
184 Ga0209672_100110 3300025228 Bacteria 95441
185 Ga0209672_100785 3300025228 Bacteria 15134
186 Ga0209147_100018 3300025229 Bacteria 515719
187 Ga0209563_100022 3300025230 Bacteria 643318
188 Ga0209563_100041 3300025230 Bacteria 407467
189 Ga0209258_100028 3300025242 Bacteria 515719
190 Ga0207425_1000149 3300025245 Bacteria 59740
191 Ga0209646_1000043 3300025246 Bacteria 343652
192 Ga0209677_100007 3300025253 Bacteria 1021332
193 Ga0209677_104501 3300025253 Bacteria 3995
194 Ga0209148_1000151 3300025254 Bacteria 156553
195 Ga0209759_1002186 3300025256 Bacteria 8959
196 Ga0209759_1018681 3300025256 Bacteria 1670
197 Ga0209129_1000119 3300025258 Bacteria 138904
198 Ga0209455_1000065 3300025272 Bacteria 321272
199 Ga0209673_1003423 3300025273 Bacteria 9382
200 Ga0209673_1039283 3300025273 Bacteria 1368
201 Ga0209564_1000024 3300025295 Bacteria 535041
202 Ga0209758_1000194 3300025297 Bacteria 134196
203 Ga0209050_1000266 3300025298 Bacteria 111792
204 Ga0209257_1029495 3300025304 Bacteria 1786
205 Ga0207656_10048175 3300025321 Bacteria 1834
206 Ga0207682_10023179 3300025893 Bacteria 2450
207 Ga0207682_10037687 3300025893 Bacteria 1959
208 Ga0207682_10066524 3300025893 Bacteria 1519
209 Ga0207680_10002714 3300025903 Bacteria 8269
210 Ga0207645_10015601 3300025907 Bacteria 5043
211 Ga0207645_10017100 3300025907 Bacteria 4791
212 Ga0207705_10146773 3300025909 Bacteria 1765
213 Ga0207695_10000872 3300025913 Bacteria 54945
214 Ga0207671_10068920 3300025914 Bacteria 2636
215 Ga0207671_10193316 3300025914 Bacteria 1587
216 Ga0207657_10053791 3300025919 Bacteria 3485
217 Ga0207657_10293988 3300025919 Bacteria 1288
218 Ga0207649_10000200 3300025920 Bacteria 49831
219 Ga0207649_10110871 3300025920 Bacteria 1833
220 Ga0207681_10006634 3300025923 Bacteria 7107
221 Ga0207681_10016094 3300025923 Bacteria 4672
222 Ga0207650_10231980 3300025925 Bacteria 1489
223 Ga0207659_10098177 3300025926 Bacteria 2202
224 Ga0207687_10018242 3300025927 Bacteria 4629
225 Ga0207687_10103620 3300025927 Bacteria 2098
226 Ga0207644_10001367 3300025931 Bacteria 15702
227 Ga0207644_10033026 3300025931 Bacteria 3614
228 Ga0207644_10091296 3300025931 Bacteria 2271
229 Ga0207644_10106828 3300025931 Bacteria 2111
230 Ga0207690_10206451 3300025932 Bacteria 1495
231 Ga0207706_10003517 3300025933 Bacteria 14962
232 Ga0207706_10009137 3300025933 Bacteria 9111
233 Ga0207706_10180709 3300025933 Bacteria 1853
234 Ga0207669_10123832 3300025937 Bacteria 1761
235 Ga0207704_10126748 3300025938 Bacteria 1759
236 Ga0207691_10026183 3300025940 Bacteria 5473
237 Ga0207689_10000343 3300025942 Bacteria 43547
238 Ga0207689_10017611 3300025942 Bacteria 6040
239 Ga0207689_10174074 3300025942 Bacteria 1775
240 Ga0207689_10312423 3300025942 Unclassified 1303
241 Ga0207679_10000012 3300025945 Bacteria 339773
242 Ga0207651_10295450 3300025960 Bacteria 1345
243 Ga0207651_10486077 3300025960 Bacteria 1065
244 Ga0207712_10036885 3300025961 Bacteria 3332
245 Ga0207668_10030789 3300025972 Bacteria 3529
246 Ga0207640_10000047 3300025981 Bacteria 98563
247 Ga0207640_10004144 3300025981 Bacteria 7834
248 Ga0207677_10001571 3300026023 Bacteria 12081
249 Ga0207677_10012571 3300026023 Bacteria 4874
250 Ga0207677_10076892 3300026023 Bacteria 2378
251 Ga0207677_10078835 3300026023 Bacteria 2353
252 Ga0207703_10045971 3300026035 Bacteria 3514
253 Ga0207678_10000028 3300026067 Bacteria 115277
254 Ga0207678_10009061 3300026067 Bacteria 8760
255 Ga0207708_10021499 3300026075 Bacteria 4866
256 Ga0207702_10000255 3300026078 Bacteria 61384
257 Ga0207702_10076204 3300026078 Bacteria 2899
258 Ga0207641_10001478 3300026088 Bacteria 23038
259 Ga0207641_10053967 3300026088 Bacteria 3408
260 Ga0207648_10026019 3300026089 Bacteria 5203
261 Ga0207648_10072496 3300026089 Bacteria 3001
262 Ga0207676_10001292 3300026095 Bacteria 18629
263 Ga0207676_10133778 3300026095 Bacteria 2112
264 Ga0207674_10188463 3300026116 Bacteria 2013
265 Ga0207674_10421418 3300026116 Bacteria 1290
266 Ga0207675_100000232 3300026118 Bacteria 52682
267 Ga0207675_100008238 3300026118 Bacteria 9821
268 Ga0207683_10029719 3300026121 Bacteria 4732
269 Ga0207683_10054595 3300026121 Bacteria 3503
270 Ga0207683_10119217 3300026121 Bacteria 2368
271 Ga0207683_10126664 3300026121 Bacteria 2295
272 Ga0207683_10175336 3300026121 Bacteria 1943
273 Ga0207698_10122275 3300026142 Bacteria 2206
274 Ga0207698_10171800 3300026142 Bacteria 1910
275 Ga0209974_10020142 3300027876 Bacteria 2211
276 Ga0268265_10081797 3300028380 Bacteria 2551
277 Ga0268264_10013863 3300028381 Bacteria 6628
278 Ga0268264_10036237 3300028381 Bacteria 4063
279 Ga0268264_10040493 3300028381 Bacteria 3850
280 Ga0265336_10000024 3300028666 Bacteria 188787
281 Ga0307517_10049385 3300028786 Bacteria 4305
282 Ga0307515_10112219 3300028794 Bacteria 3172
283 Ga0265324_10032444 3300029957 Bacteria 1825
284 Ga0316182_1439953 3300030745 Bacteria 2500
285 Ga0307513_10000010 3300031456 Bacteria 360812
286 Ga0307513_10042652 3300031456 Bacteria 4992
287 Ga0307513_10052906 3300031456 Bacteria 4368
288 Ga0307509_10058508 3300031507 Bacteria 4081
289 Ga0307509_10121149 3300031507 Bacteria 2593
290 Ga0307408_100041393 3300031548 Bacteria 3266
291 Ga0307508_10001461 3300031616 Bacteria 26492
292 Ga0307508_10308208 3300031616 Bacteria 1176
293 Ga0307508_10372731 3300031616 Bacteria 1018
294 Ga0265314_10093394 3300031711 Bacteria 1953
295 Ga0307516_10053364 3300031730 Bacteria 3953
296 Ga0307516_10191657 3300031730 Bacteria 1770
297 Ga0307516_10308815 3300031730 Bacteria 1255
298 Ga0307413_10029599 3300031824 Bacteria 3066
299 Ga0307410_10045515 3300031852 Bacteria 2922
300 Ga0307406_10159044 3300031901 Bacteria 1621
301 Ga0307412_10097613 3300031911 Bacteria 2070
302 Ga0307414_10002937 3300032004 Bacteria 9009
303 Ga0307411_10000076 3300032005 Bacteria 30437
304 Ga0307411_10043852 3300032005 Bacteria 2864
305 Ga0307510_10058537 3300033180 Bacteria 3988
306 Ga0373929_0014296 3300035085 Bacteria 1532
307 Ga0373944_0015504 3300035089 Bacteria 2139
308 Ga0373952_0023028 3300035092 Bacteria 1328
309 Ga0373924_0070602 3300035410 Bacteria 1473
310 Ga0373931_0002401 3300035691 Bacteria 8289
311 Ga0373927_0289361 3300035695 Bacteria 1078
312 Ga0373925_0089346 3300037068 Bacteria 2353
313 Ga0373925_0599448 3300037068 Bacteria 907
314 Ga0395899_0010134 3300037312 Bacteria 7227
315 Ga0395900_0000600 3300037418 Bacteria 49320
316 Ga0395900_0003997 3300037418 Bacteria 15752
317 Ga0395900_0014004 3300037418 Bacteria 8188
318 Ga0395900_0136157 3300037418 Bacteria 2516
319 Ga0395905_0006486 3300037471 Bacteria 11773
320 Ga0395905_0064977 3300037471 Bacteria 3415
321 Ga0395905_0086939 3300037471 Bacteria 2930
322 Ga0395901_0038557 3300038443 Bacteria 4943
323 Ga0436361_0698521 3300039447 Bacteria 1322
324 Ga0436363_0253358 3300039450 Unclassified 969
325 Ga0439461_0035053 3300041410 Bacteria 1063
326 Ga0439465_0026811 3300041413 Bacteria 1824
327 Ga0439448_0074444 3300042005 Bacteria 1134
328 Ga0439449_0010795 3300042007 Bacteria 3448
329 Ga0439455_0005529 3300042012 Bacteria 2571
330 Ga0450912_000837 3300042116 Bacteria 1702
331 Ga0450891_001915 3300042129 Bacteria 2128
332 Ga0450903_010131 3300042138 Bacteria 1529
333 Ga0439459_0032400 3300042438 Unclassified 1071
334 Ga0466986_0013751 3300044650 Bacteria 5116
335 Ga0466969_0103507 3300044656 Bacteria 1338
336 Ga0466972_0007977 3300044658 Bacteria 5307
337 Ga0466972_0013531 3300044658 Bacteria 4096
338 Ga0466965_0008089 3300044683 Bacteria 4858
339 Ga0466966_0006300 3300044684 Bacteria 7851
340 Ga0466966_0019292 3300044684 Bacteria 4488
341 Ga0466966_0093297 3300044684 Bacteria 1867
342 Ga0466966_0094162 3300044684 Bacteria 1857
343 Ga0466961_0045161 3300044693 Bacteria 2819
344 Ga0466961_0105327 3300044693 Bacteria 1776
345 Ga0466964_0006808 3300044706 Bacteria 4263
346 Ga0466971_0054966 3300044719 Bacteria 1794
347 Ga0466968_0000848 3300044735 Bacteria 10694
348 Ga0466970_0041155 3300044765 Bacteria 2455
349 Ga0466957_0009294 3300044842 Bacteria 5608
350 Ga0466960_0008286 3300044901 Bacteria 4252
351 Ga0466959_0032214 3300045049 Bacteria 3880
352 Ga0466967_0072385 3300045976 Bacteria 3089
353 Ga0495592_0004992 3300046454 Bacteria 9767
354 Ga0495590_0019584 3300046457 Bacteria 2409
355 Ga0495638_0064419 3300046460 Bacteria 2258
356 Ga0495605_0000118 3300046474 Bacteria 102724
357 Ga0495584_0013018 3300046491 Bacteria 4244
358 Ga0495596_0009550 3300046500 Bacteria 4264
359 Ga0495607_0001981 3300046501 Bacteria 17244
360 Ga0495583_0025428 3300046506 Bacteria 2958
361 Ga0495616_0048893 3300046513 Bacteria 2122
362 Ga0495618_0035582 3300046514 Bacteria 3125
363 Ga0495632_0004148 3300046519 Bacteria 9948
364 Ga0495643_0001777 3300046522 Bacteria 18510
365 Ga0495666_0171012 3300046526 Bacteria 1005
366 Ga0495597_0012183 3300046542 Bacteria 4155
367 Ga0495597_0038654 3300046542 Unclassified 2138
368 Ga0495656_0003227 3300046615 Bacteria 5500
369 Ga0495661_0002001 3300046665 Bacteria 16085
370 Ga0495661_0020080 3300046665 Bacteria 4369
371 Ga0495661_0074424 3300046665 Bacteria 1976
372 Ga0495658_0018194 3300046683 Bacteria 3648
373 Ga0495589_0000136 3300046794 Bacteria 67764
374 Ga0495660_0000068 3300046810 Bacteria 119060
375 Ga0495660_0036972 3300046810 Bacteria 2721
376 Ga0495672_0000631 3300047320 Bacteria 39335
377 Ga0495687_001265 3300047443 Bacteria 23959
378 Ga0495687_006574 3300047443 Bacteria 7085
379 Ga0495677_0000754 3300047445 Bacteria 13058
380 Ga0495626_0000149 3300048091 Bacteria 86385
381 Ga0496100_0027388 3300048903 Bacteria 3505
382 Ga0496102_0339995 3300048905 Bacteria 1413
383 Ga0496104_0298525 3300048907 Bacteria 1523
384 Ga0496106_0040407 3300048909 Bacteria 3493
385 Ga0496107_0006210 3300048910 Bacteria 8212
386 Ga0496107_0092918 3300048910 Bacteria 2206
387 Ga0496108_0037801 3300048911 Bacteria 4022
388 Ga0496108_0057607 3300048911 Bacteria 3264
389 Ga0496108_0083318 3300048911 Bacteria 2713
390 Ga0496110_0022654 3300048913 Bacteria 5336
391 Ga0496111_0059683 3300048914 Bacteria 2764
392 Ga0496111_0212934 3300048914 Bacteria 1435
393 Ga0496113_0030977 3300048916 Bacteria 3877
394 Ga0496113_0100038 3300048916 Bacteria 2246
395 Ga0496113_0430127 3300048916 Bacteria 1060
396 Ga0496114_0016272 3300048917 Bacteria 5991
397 Ga0496114_0248020 3300048917 Bacteria 1567
398 Ga0496123_0004020 3300048926 Bacteria 15892
399 Ga0496124_0110431 3300048927 Bacteria 2214
400 Ga0496125_0025407 3300048928 Bacteria 5423
401 Ga0501300_013451 3300049523 Bacteria 1194
402 Ga0501222_008506 3300049662 Bacteria 1362
403 Ga0501227_011824 3300049665 Bacteria 1906
404 Ga0501235_002851 3300049669 Bacteria 3722
405 Ga0501221_000795 3300049704 Bacteria 5111
406 Ga0501229_000477 3300049706 Bacteria 4536
407 Ga0501265_003366 3300049762 Bacteria 1817
408 nmdc:mga03n38_26359_c1 3300050490 Bacteria 2399
409 nmdc:mga03n38_44796_c1 3300050490 Bacteria 1945
410 nmdc:mga0yw44_322788_c1 3300050492 Bacteria 1037
411 nmdc:mga06z11_195051_c1 3300050494 Bacteria 1174
412 nmdc:mga04h51_46468_c1 3300050495 Bacteria 1439
413 nmdc:mga07m45_121391_c1 3300050496 Bacteria 1509
414 nmdc:mga07m45_147590_c1 3300050496 Bacteria 1363
415 nmdc:mga07m45_38202_c1 3300050496 Bacteria 2679
416 nmdc:mga05p37_74162_c1 3300050507 Bacteria 4188
417 nmdc:mga0qj67_98805_c1 3300050509 Bacteria 2351
418 Ga0500578_0000057 3300053086 Bacteria 120178
419 Ga0500646_0041676 3300053090 Bacteria 1294
420 Ga0500583_0003246 3300053092 Bacteria 5073
421 Ga0500628_001630 3300053129 Bacteria 3800
422 Ga0500642_0000828 3300053130 Bacteria 9022
423 Ga0500652_000334 3300053131 Bacteria 16912
424 Ga0500559_0093630 3300053136 Bacteria 1378
425 Ga0500568_0023142 3300053139 Bacteria 2645
426 Ga0500590_003071 3300053148 Bacteria 7604
427 Ga0500622_0000081 3300053156 Bacteria 102191
428 Ga0587072_000642 3300059643 Bacteria 3728
429 2587728708 2585428057 Bacteria 6737412
430 2587732675 2585428058 Bacteria 6853932
431 2588290342 2588253510 Bacteria 6901809
432 2597029533 2596583598 Bacteria 5251611
433 2599448300 2599185178 Bacteria 5365746
434 2643743515 2643221544 Bacteria 5886209
435 2643796789 2643221556 Bacteria 7251154
436 2643967653 2643221592 Bacteria 6608788
437 2644140475 2643221625 Bacteria 6512927
438 2644220652 2643221639 Bacteria 6649903
439 2644273442 2643221648 Bacteria 6521465
440 2644470106 2643221684 Bacteria 7145183
441 2829750037 2829745981 Bacteria 5406054
442 2900578947 2900577576 Bacteria 5438534
443 2928060580 2928058823 Bacteria 5520022
444 8047676943 8047673197 Bacteria 7395230
445 Ga0163162_10060107
446 JGI24741J21665_1000658
447 JGI24740J21852_10000209
448 JGI24740J21852_10001259
449 JGI25156J39149_1009475
450 JGI25156J39149_1014898
451 JGI25154J39366_1001487
452 JGI25153J46596_10002209
453 rootH1_10022645
454 rootH1_10116139
455 rootL2_10013604
456 rootL2_10055306
457 rootL2_10135496
458 rootL2_10167649
459 rootL2_10169292
460 rootH1_10032690
461 rootH1_10053051
462 rootH1_10057788
463 rootH1_10151567
464 Ga0006562J51391_1058405
465 Ga0055539_1000326
466 Ga0055532_1000149
467 Ga0055525_1000006
468 Ga0055525_1000417
469 Ga0055535_1000180
470 Ga0055542_1001946
471 Ga0055529_1000245
472 Ga0055526_1007354
473 Ga0055530_10001181
474 Ga0055541_1001682
475 Ga0065165_1000656
476 Ga0070658_10025320
477 Ga0070676_10124802
478 Ga0070683_100226592
479 Ga0070690_100082170
480 Ga0070690_100415113
481 Ga0070670_100088066
482 Ga0070670_100151833
483 Ga0070670_100276248
484 Ga0070677_10070739
485 Ga0070677_10072089
486 Ga0070677_10155743
487 Ga0068869_100349390
488 Ga0068869_100383749
489 Ga0070666_10008268
490 Ga0070682_100050176
491 Ga0070682_100234702
492 Ga0068868_100002199
493 Ga0068868_100046638
494 Ga0068868_100075517
495 Ga0070660_100308910
496 Ga0070661_100001832
497 Ga0070661_100093752
498 Ga0070668_100028394
499 Ga0070669_100014650
500 Ga0070675_100001074
501 Ga0070675_100004321
502 Ga0070671_100007790
503 Ga0070671_100022571
504 Ga0070671_100083533
505 Ga0070671_100106024
506 Ga0070671_100252895
507 Ga0070674_100068989
508 Ga0070673_100009810
509 Ga0070673_100169161
510 Ga0070659_100002375
511 Ga0070659_100031493
512 Ga0070700_100008919
513 Ga0070663_100000001
514 Ga0070678_100179821
515 Ga0070662_100004399
516 Ga0070662_100006160
517 Ga0068853_100037433
518 Ga0068853_100546801
519 Ga0070672_100088590
520 Ga0070693_100061609
521 Ga0068855_100040196
522 Ga0070664_100000016
523 Ga0068854_100000124
524 Ga0068854_100014889
525 Ga0068856_100001285
526 Ga0068856_100203234
527 Ga0070702_100067783
528 Ga0068852_100086558
529 Ga0068852_100167513
530 Ga0068859_100010331
531 Ga0068864_100003722
532 Ga0068864_100016321
533 Ga0068864_100056096
534 Ga0068864_100203480
535 Ga0068866_10025814
536 Ga0068861_100005129
537 Ga0068861_100030007
538 Ga0068870_10084946
539 Ga0068870_10110975
540 Ga0068863_100011848
541 Ga0068863_100043122
542 Ga0068863_100096296
543 Ga0068863_100493133
544 Ga0068858_100002455
545 Ga0068858_100067199
546 Ga0068858_100459506
547 Ga0068860_100007353
548 Ga0068860_100018150
549 Ga0068860_100045308
550 Ga0068862_100064457
551 Ga0068862_100084487
552 Ga0068862_100104274
553 Ga0075365_10025135
554 Ga0075368_10021610
555 Ga0075363_100016344
556 Ga0075363_100054304
557 Ga0075362_10070702
558 Ga0075367_10007185
559 Ga0075366_10002438
560 Ga0075366_10144636
561 Ga0075366_10166983
562 Ga0097621_100006661
563 Ga0097621_100265849
564 Ga0097621_100403683
565 Ga0075370_10031343
566 Ga0068871_100011230
567 Ga0075430_100223991
568 Ga0075431_100302270
569 Ga0075429_100163605
570 Ga0097620_100010330
571 Ga0105240_10257633
572 Ga0105240_10770139
573 Ga0111539_10016994
574 Ga0111539_10393795
575 Ga0105245_10009658
576 Ga0105245_10299027
577 Ga0114129_10080975
578 Ga0105243_10157413
579 Ga0105241_10205886
580 Ga0105248_10018741
581 Ga0105237_10163016
582 Ga0105249_10235839
583 Ga0105239_10180719
584 Ga0157373_10137761
585 Ga0157371_10001722
586 Ga0157371_10050626
587 Ga0157370_10001175
588 Ga0157369_10205644
589 Ga0157374_10015418
590 Ga0157374_10310568
591 Ga0157378_10014200
592 Ga0157378_10247741
593 Ga0157378_10481873
594 Ga0163162_10012165
595 Ga0163162_10026322
596 Ga0157372_10005008
597 Ga0157372_10013706
598 Ga0157375_10043226
599 Ga0157375_10083172
600 Ga0157375_10083607
601 Ga0157375_10120230
602 Ga0163163_10061111
603 Ga0157380_10004965
604 Ga0157380_10136389
605 Ga0182008_10007906
606 Ga0157379_10008582
607 Ga0157379_10024519
608 Ga0157379_10077870
609 Ga0157379_10563313
610 Ga0157376_10006844
611 Ga0157376_10008302
612 Ga0157376_10517476
613 Ga0182006_1001760
614 Ga0182006_1006994
615 Ga0182007_10001066
616 Ga0163161_10044706
617 Ga0163161_10086947
618 Ga0197907_10652968
619 Ga0154015_1243737
620 Ga0209784_100006
621 Ga0209566_100002
622 Ga0209566_100526
623 Ga0209566_100895
624 Ga0209674_100010
625 Ga0209674_100176
626 Ga0209674_100430
627 Ga0209674_104368
628 Ga0209672_100110
629 Ga0209672_100785
630 Ga0209147_100018
631 Ga0209563_100022
632 Ga0209563_100041
633 Ga0209258_100028
634 Ga0207425_1000149
635 Ga0209646_1000043
636 Ga0209677_100007
637 Ga0209677_104501
638 Ga0209148_1000151
639 Ga0209759_1002186
640 Ga0209759_1018681
641 Ga0209129_1000119
642 Ga0209455_1000065
643 Ga0209673_1003423
644 Ga0209673_1039283
645 Ga0209564_1000024
646 Ga0209758_1000194
647 Ga0209050_1000266
648 Ga0209257_1029495
649 Ga0207656_10048175
650 Ga0207682_10023179
651 Ga0207682_10037687
652 Ga0207682_10066524
653 Ga0207680_10002714
654 Ga0207645_10015601
655 Ga0207645_10017100
656 Ga0207705_10146773
657 Ga0207695_10000872
658 Ga0207671_10068920
659 Ga0207671_10193316
660 Ga0207657_10053791
661 Ga0207657_10293988
662 Ga0207649_10000200
663 Ga0207649_10110871
664 Ga0207681_10006634
665 Ga0207681_10016094
666 Ga0207650_10231980
667 Ga0207659_10098177
668 Ga0207687_10018242
669 Ga0207687_10103620
670 Ga0207644_10001367
671 Ga0207644_10033026
672 Ga0207644_10091296
673 Ga0207644_10106828
674 Ga0207690_10206451
675 Ga0207706_10003517
676 Ga0207706_10009137
677 Ga0207706_10180709
678 Ga0207669_10123832
679 Ga0207704_10126748
680 Ga0207691_10026183
681 Ga0207689_10000343
682 Ga0207689_10017611
683 Ga0207689_10174074
684 Ga0207689_10312423
685 Ga0207679_10000012
686 Ga0207651_10295450
687 Ga0207651_10486077
688 Ga0207712_10036885
689 Ga0207668_10030789
690 Ga0207640_10000047
691 Ga0207640_10004144
692 Ga0207677_10001571
693 Ga0207677_10012571
694 Ga0207677_10076892
695 Ga0207677_10078835
696 Ga0207703_10045971
697 Ga0207678_10000028
698 Ga0207678_10009061
699 Ga0207708_10021499
700 Ga0207702_10000255
701 Ga0207702_10076204
702 Ga0207641_10001478
703 Ga0207641_10053967
704 Ga0207648_10026019
705 Ga0207648_10072496
706 Ga0207676_10001292
707 Ga0207676_10133778
708 Ga0207674_10188463
709 Ga0207674_10421418
710 Ga0207675_100000232
711 Ga0207675_100008238
712 Ga0207683_10029719
713 Ga0207683_10054595
714 Ga0207683_10119217
715 Ga0207683_10126664
716 Ga0207683_10175336
717 Ga0207698_10122275
718 Ga0207698_10171800
719 Ga0209974_10020142
720 Ga0268265_10081797
721 Ga0268264_10013863
722 Ga0268264_10036237
723 Ga0268264_10040493
724 Ga0265336_10000024
725 Ga0307517_10049385
726 Ga0307515_10112219
727 Ga0265324_10032444
728 Ga0316182_1439953
729 Ga0307513_10000010
730 Ga0307513_10042652
731 Ga0307513_10052906
732 Ga0307509_10058508
733 Ga0307509_10121149
734 Ga0307408_100041393
735 Ga0307508_10001461
736 Ga0307508_10308208
737 Ga0307508_10372731
738 Ga0265314_10093394
739 Ga0307516_10053364
740 Ga0307516_10191657
741 Ga0307516_10308815
742 Ga0307413_10029599
743 Ga0307410_10045515
744 Ga0307406_10159044
745 Ga0307412_10097613
746 Ga0307414_10002937
747 Ga0307411_10000076
748 Ga0307411_10043852
749 Ga0307510_10058537
750 Ga0373929_0014296
751 Ga0373944_0015504
752 Ga0373952_0023028
753 Ga0373924_0070602
754 Ga0373931_0002401
755 Ga0373927_0289361
756 Ga0373925_0089346
757 Ga0373925_0599448
758 Ga0395899_0010134
759 Ga0395900_0000600
760 Ga0395900_0003997
761 Ga0395900_0014004
762 Ga0395900_0136157
763 Ga0395905_0006486
764 Ga0395905_0064977
765 Ga0395905_0086939
766 Ga0395901_0038557
767 Ga0436361_0698521
768 Ga0436363_0253358
769 Ga0439461_0035053
770 Ga0439465_0026811
771 Ga0439448_0074444
772 Ga0439449_0010795
773 Ga0439455_0005529
774 Ga0450912_000837
775 Ga0450891_001915
776 Ga0450903_010131
777 Ga0439459_0032400
778 Ga0466986_0013751
779 Ga0466969_0103507
780 Ga0466972_0007977
781 Ga0466972_0013531
782 Ga0466965_0008089
783 Ga0466966_0006300
784 Ga0466966_0019292
785 Ga0466966_0093297
786 Ga0466966_0094162
787 Ga0466961_0045161
788 Ga0466961_0105327
789 Ga0466964_0006808
790 Ga0466971_0054966
791 Ga0466968_0000848
792 Ga0466970_0041155
793 Ga0466957_0009294
794 Ga0466960_0008286
795 Ga0466959_0032214
796 Ga0466967_0072385
797 Ga0495592_0004992
798 Ga0495590_0019584
799 Ga0495638_0064419
800 Ga0495605_0000118
801 Ga0495584_0013018
802 Ga0495596_0009550
803 Ga0495607_0001981
804 Ga0495583_0025428
805 Ga0495616_0048893
806 Ga0495618_0035582
807 Ga0495632_0004148
808 Ga0495643_0001777
809 Ga0495666_0171012
810 Ga0495597_0012183
811 Ga0495597_0038654
812 Ga0495656_0003227
813 Ga0495661_0002001
814 Ga0495661_0020080
815 Ga0495661_0074424
816 Ga0495658_0018194
817 Ga0495589_0000136
818 Ga0495660_0000068
819 Ga0495660_0036972
820 Ga0495672_0000631
821 Ga0495687_001265
822 Ga0495687_006574
823 Ga0495677_0000754
824 Ga0495626_0000149
825 Ga0496100_0027388
826 Ga0496102_0339995
827 Ga0496104_0298525
828 Ga0496106_0040407
829 Ga0496107_0006210
830 Ga0496107_0092918
831 Ga0496108_0037801
832 Ga0496108_0057607
833 Ga0496108_0083318
834 Ga0496110_0022654
835 Ga0496111_0059683
836 Ga0496111_0212934
837 Ga0496113_0030977
838 Ga0496113_0100038
839 Ga0496113_0430127
840 Ga0496114_0016272
841 Ga0496114_0248020
842 Ga0496123_0004020
843 Ga0496124_0110431
844 Ga0496125_0025407
845 Ga0501300_013451
846 Ga0501222_008506
847 Ga0501227_011824
848 Ga0501235_002851
849 Ga0501221_000795
850 Ga0501229_000477
851 Ga0501265_003366
852 nmdc:mga03n38_26359_c1
853 nmdc:mga03n38_44796_c1
854 nmdc:mga0yw44_322788_c1
855 nmdc:mga06z11_195051_c1
856 nmdc:mga04h51_46468_c1
857 nmdc:mga07m45_121391_c1
858 nmdc:mga07m45_147590_c1
859 nmdc:mga07m45_38202_c1
860 nmdc:mga05p37_74162_c1
861 nmdc:mga0qj67_98805_c1
862 Ga0500578_0000057
863 Ga0500646_0041676
864 Ga0500583_0003246
865 Ga0500628_001630
866 Ga0500642_0000828
867 Ga0500652_000334
868 Ga0500559_0093630
869 Ga0500568_0023142
870 Ga0500590_003071
871 Ga0500622_0000081
872 Ga0587072_000642
873 2587728708
874 2587732675
875 2588290342
876 2597029533
877 2599448300
878 2643743515
879 2643796789
880 2643967653
881 2644140475
882 2644220652
883 2644273442
884 2644470106
885 2829750037
886 2900578947
887 2928060580
888 8047676943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

38

97

0.93

PF03466

LysR_substrate

LysR substrate binding domain

121

319

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.9063 9 76
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9061 9 76
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9055 9 76
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9028 9 76
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.899 9 76
ID Description Score Start End Superfamily
af_P9WMF3_10_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9373 12 76 1.10.10.10
af_Q58520_10_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9302 7 75 1.10.10.10
af_P0ACR0_3_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9272 10 76 1.10.10.10
af_Q2G0C6_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9237 9 76 1.10.10.10
af_Q2G1Q6_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9191 9 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A833N481-F1-model_v4 deleted 0.9394 9 76
AF-A0A2Y6EL52-F1-model_v4 LYSR-type transcriptional regulator 0.9098 7 76 GO:0003700
GO:0006351
GO:0043565
AF-A0A7Y8B7Z0-F1-model_v4 deleted 0.9075 5 76
AF-A0A418R260-F1-model_v4 LysR family transcriptional regulator 0.8919 1 76 GO:0003700
AF-A0A377TUX1-F1-model_v4 DNA-binding transcriptional activator TdcA 0.8799 5 76 GO:0003677
GO:0003700
GO:0005829

Map