F445230

General Info

Members Datasets Scaffolds Average Seq Length
444 229 888 150

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100012578|Ga0070669_1000125785
Length 166
Sequence VVPPERDLFANFDRMRREMDELFGDVFHRSGIAPRKRAGFSPAVDVSYADDPPRAIVTAELAGIDADRLGLEIQGRELVLSGERHAIEREGRVYQQVEIEHGPFRRVVQLGADVRAEEARAVYEDGLLRVELPLAQPETRRHSVPIEVLHPDASDDLTDDPNASRE

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 1.35
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100012578 3300005353 Bacteria 6003
2 LJQas_1002679 3300000549 Bacteria 2454
3 JGI25407J50210_10003586 3300003373 Bacteria 3727
4 JGI25407J50210_10004636 3300003373 Bacteria 3347
5 JGI25407J50210_10010473 3300003373 Bacteria 2360
6 Ga0070676_10075902 3300005328 Bacteria 2028
7 Ga0070683_100086327 3300005329 Bacteria 2942
8 Ga0070683_100115799 3300005329 Bacteria 2530
9 Ga0068869_101249700 3300005334 Bacteria 654
10 Ga0070680_100002005 3300005336 Bacteria 14996
11 Ga0070682_100282285 3300005337 Bacteria 1211
12 Ga0070660_100034501 3300005339 Bacteria 3823
13 Ga0070660_100090768 3300005339 Bacteria 2409
14 Ga0070691_10043420 3300005341 Bacteria 2130
15 Ga0070691_10389156 3300005341 Bacteria 783
16 Ga0070687_100265109 3300005343 Bacteria 1074
17 Ga0070687_100513529 3300005343 Bacteria 809
18 Ga0070661_100376188 3300005344 Unclassified 1119
19 Ga0070692_10000906 3300005345 Bacteria 10033
20 Ga0070692_10240352 3300005345 Unclassified 1079
21 Ga0070668_100122665 3300005347 Bacteria 2078
22 Ga0070668_100685081 3300005347 Bacteria 903
23 Ga0070671_101231450 3300005355 Bacteria 659
24 Ga0070673_101208692 3300005364 Bacteria 708
25 Ga0070659_100000071 3300005366 Bacteria 79797
26 Ga0070659_100007306 3300005366 Bacteria 8020
27 Ga0070714_100004952 3300005435 Bacteria 10123
28 Ga0070714_100089304 3300005435 Bacteria 2698
29 Ga0070714_100258243 3300005435 Bacteria 1613
30 Ga0070713_100391290 3300005436 Bacteria 1297
31 Ga0070713_100424499 3300005436 Bacteria 1245
32 Ga0070710_10000001 3300005437 Bacteria 552187
33 Ga0070705_100000442 3300005440 Bacteria 23776
34 Ga0070694_101139023 3300005444 Bacteria 652
35 Ga0070662_100012617 3300005457 Bacteria 5606
36 Ga0070681_10006184 3300005458 Bacteria 11633
37 Ga0070679_100044333 3300005530 Bacteria 4431
38 Ga0070684_100078977 3300005535 Bacteria 2908
39 Ga0068853_100235916 3300005539 Bacteria 1675
40 Ga0068853_100327116 3300005539 Unclassified 1422
41 Ga0070696_100047909 3300005546 Bacteria 2967
42 Ga0068855_100087615 3300005563 Bacteria 3598
43 Ga0070664_100504256 3300005564 Bacteria 1116
44 Ga0068854_100119221 3300005578 Bacteria 2001
45 Ga0068854_101104448 3300005578 Bacteria 707
46 Ga0068856_100011930 3300005614 Bacteria 8415
47 Ga0068852_100001803 3300005616 Bacteria 14538
48 Ga0068852_100781901 3300005616 Archaea 968
49 Ga0068859_103120067 3300005617 Bacteria 505
50 Ga0068861_100050890 3300005719 Bacteria 3143
51 Ga0068861_100916637 3300005719 Bacteria 831
52 Ga0068870_10382934 3300005840 Bacteria 911
53 Ga0068870_10935514 3300005840 Bacteria 614
54 Ga0068862_100404967 3300005844 Bacteria 1277
55 Ga0068862_101589286 3300005844 Bacteria 661
56 Ga0081455_10090935 3300005937 Bacteria 2473
57 Ga0081455_10350676 3300005937 Bacteria 1041
58 Ga0081538_10000117 3300005981 Bacteria 79475
59 Ga0081538_10000299 3300005981 Bacteria 57017
60 Ga0081538_10000369 3300005981 Bacteria 51269
61 Ga0081538_10001315 3300005981 Bacteria 25654
62 Ga0081538_10004390 3300005981 Bacteria 13024
63 Ga0081538_10006091 3300005981 Bacteria 10716
64 Ga0081538_10006312 3300005981 Bacteria 10470
65 Ga0081538_10009063 3300005981 Bacteria 8351
66 Ga0081538_10009608 3300005981 Bacteria 8046
67 Ga0081538_10010451 3300005981 Bacteria 7610
68 Ga0081538_10013180 3300005981 Bacteria 6562
69 Ga0081538_10013697 3300005981 Bacteria 6408
70 Ga0081538_10036505 3300005981 Bacteria 3205
71 Ga0081538_10063701 3300005981 Bacteria 2091
72 Ga0081538_10105127 3300005981 Bacteria 1406
73 Ga0081539_10082716 3300005985 Bacteria 1682
74 Ga0070717_10000010 3300006028 Bacteria 283501
75 Ga0070717_10029066 3300006028 Bacteria 4432
76 Ga0075365_10045985 3300006038 Bacteria 2866
77 Ga0075363_100481170 3300006048 Unclassified 736
78 Ga0075364_10866650 3300006051 Bacteria 615
79 Ga0075432_10005746 3300006058 Bacteria 4221
80 Ga0075432_10170139 3300006058 Bacteria 847
81 Ga0070716_100922114 3300006173 Bacteria 685
82 Ga0068871_101204833 3300006358 Bacteria 710
83 Ga0075428_100013317 3300006844 Bacteria 9149
84 Ga0075428_100254525 3300006844 Bacteria 1891
85 Ga0075428_100256766 3300006844 Bacteria 1883
86 Ga0075430_100000288 3300006846 Bacteria 35424
87 Ga0075430_100014319 3300006846 Bacteria 6759
88 Ga0075430_100385526 3300006846 Bacteria 1156
89 Ga0075430_101579412 3300006846 Bacteria 539
90 Ga0075431_100024925 3300006847 Bacteria 6132
91 Ga0075431_100026819 3300006847 Bacteria 5908
92 Ga0075431_100333480 3300006847 Bacteria 1527
93 Ga0075431_100676775 3300006847 Bacteria 1011
94 Ga0075433_10048727 3300006852 Bacteria 3685
95 Ga0075434_100728197 3300006871 Bacteria 1009
96 Ga0075429_100019721 3300006880 Bacteria 5845
97 Ga0075429_100303031 3300006880 Bacteria 1399
98 Ga0075429_100632419 3300006880 Bacteria 938
99 Ga0068865_100427159 3300006881 Bacteria 1091
100 Ga0097620_103120503 3300006931 Bacteria 505
101 Ga0105240_10031681 3300009093 Bacteria 6852
102 Ga0105240_10086198 3300009093 Bacteria 3846
103 Ga0111539_10007468 3300009094 Bacteria 14001
104 Ga0111539_10010512 3300009094 Bacteria 11649
105 Ga0111539_10321897 3300009094 Bacteria 1799
106 Ga0111539_10508999 3300009094 Bacteria 1402
107 Ga0111539_10916583 3300009094 Bacteria 1019
108 Ga0105245_10005790 3300009098 Bacteria 10843
109 Ga0114129_10014159 3300009147 Bacteria 11362
110 Ga0114129_10014877 3300009147 Bacteria 11085
111 Ga0114129_10174639 3300009147 Bacteria 2927
112 Ga0114129_10506857 3300009147 Bacteria 1575
113 Ga0114129_10602799 3300009147 Bacteria 1423
114 Ga0114129_10732426 3300009147 Bacteria 1267
115 Ga0114129_11499951 3300009147 Bacteria 828
116 Ga0114129_11550108 3300009147 Bacteria 813
117 Ga0114129_11640731 3300009147 Bacteria 786
118 Ga0105243_10538551 3300009148 Bacteria 1113
119 Ga0105243_10714143 3300009148 Unclassified 979
120 Ga0105237_10061781 3300009545 Bacteria 3745
121 Ga0105238_10088739 3300009551 Bacteria 3078
122 Ga0105249_10247138 3300009553 Bacteria 1767
123 Ga0105249_10899127 3300009553 Bacteria 952
124 Ga0105239_10096613 3300010375 Bacteria 3264
125 Ga0105246_10033428 3300011119 Bacteria 3418
126 Ga0157371_10098979 3300013102 Bacteria 2068
127 Ga0157370_10006987 3300013104 Bacteria 12330
128 Ga0157369_10055044 3300013105 Bacteria 4295
129 Ga0163162_11977416 3300013306 Bacteria 668
130 Ga0157372_10058747 3300013307 Bacteria 4300
131 Ga0157372_10287952 3300013307 Bacteria 1910
132 Ga0157372_10983178 3300013307 Bacteria 978
133 Ga0157375_11205807 3300013308 Bacteria 888
134 Ga0157375_11268423 3300013308 Bacteria 865
135 Ga0157380_10601373 3300014326 Bacteria 1088
136 Ga0157377_10179744 3300014745 Bacteria 1329
137 Ga0157376_10038629 3300014969 Bacteria 3886
138 Ga0163161_10729607 3300017792 Bacteria 827
139 Ga0206356_10422037 3300020070 Bacteria 1379
140 Ga0206354_10917454 3300020081 Bacteria 782
141 Ga0206353_10230645 3300020082 Bacteria 2700
142 Ga0213876_10012583 3300021384 Bacteria 4501
143 Ga0213876_10034583 3300021384 Bacteria 2665
144 Ga0213876_10395629 3300021384 Bacteria 735
145 Ga0213875_10001188 3300021388 Bacteria 17818
146 Ga0213875_10014234 3300021388 Bacteria 3884
147 Ga0213875_10026583 3300021388 Bacteria 2753
148 Ga0207692_10000004 3300025898 Bacteria 413600
149 Ga0207688_10058709 3300025901 Bacteria 2165
150 Ga0207645_10392570 3300025907 Unclassified 932
151 Ga0207707_10002279 3300025912 Bacteria 17329
152 Ga0207695_10074129 3300025913 Bacteria 3465
153 Ga0207695_10132582 3300025913 Bacteria 2448
154 Ga0207671_10116742 3300025914 Bacteria 2036
155 Ga0207660_10144036 3300025917 Bacteria 1824
156 Ga0207660_10756393 3300025917 Bacteria 793
157 Ga0207662_10136241 3300025918 Bacteria 1552
158 Ga0207657_10013809 3300025919 Bacteria 7906
159 Ga0207657_10097959 3300025919 Bacteria 2437
160 Ga0207649_10313973 3300025920 Unclassified 1150
161 Ga0207652_10122206 3300025921 Bacteria 2317
162 Ga0207652_10278802 3300025921 Bacteria 1508
163 Ga0207681_10004093 3300025923 Bacteria 9033
164 Ga0207681_10305667 3300025923 Bacteria 1260
165 Ga0207694_10086364 3300025924 Bacteria 2470
166 Ga0207694_10885640 3300025924 Bacteria 755
167 Ga0207687_10110757 3300025927 Bacteria 2037
168 Ga0207700_10255324 3300025928 Bacteria 1499
169 Ga0207664_10000040 3300025929 Bacteria 158895
170 Ga0207664_10001652 3300025929 Bacteria 14689
171 Ga0207664_10007343 3300025929 Bacteria 7639
172 Ga0207664_10043439 3300025929 Bacteria 3515
173 Ga0207664_10193979 3300025929 Bacteria 1750
174 Ga0207644_10908997 3300025931 Bacteria 738
175 Ga0207690_10000093 3300025932 Bacteria 74491
176 Ga0207690_10308595 3300025932 Bacteria 1240
177 Ga0207706_10007927 3300025933 Bacteria 9801
178 Ga0207706_10921119 3300025933 Bacteria 737
179 Ga0207686_10368551 3300025934 Bacteria 1086
180 Ga0207709_10988436 3300025935 Unclassified 687
181 Ga0207670_10940069 3300025936 Bacteria 725
182 Ga0207670_11172755 3300025936 Unclassified 650
183 Ga0207665_10602605 3300025939 Bacteria 858
184 Ga0207661_10002384 3300025944 Bacteria 12937
185 Ga0207661_10364020 3300025944 Bacteria 1307
186 Ga0207661_10959700 3300025944 Bacteria 787
187 Ga0207679_10385573 3300025945 Bacteria 1229
188 Ga0207712_10010794 3300025961 Bacteria 5809
189 Ga0207712_10613062 3300025961 Bacteria 942
190 Ga0207668_10042702 3300025972 Bacteria 3072
191 Ga0207668_10901012 3300025972 Bacteria 787
192 Ga0207640_10235222 3300025981 Bacteria 1412
193 Ga0207640_10608405 3300025981 Bacteria 926
194 Ga0207639_10170298 3300026041 Bacteria 1844
195 Ga0207639_10607640 3300026041 Bacteria 1009
196 Ga0207678_10346363 3300026067 Bacteria 1281
197 Ga0207708_10151343 3300026075 Bacteria 1827
198 Ga0207708_10800387 3300026075 Bacteria 811
199 Ga0207702_10939317 3300026078 Unclassified 857
200 Ga0207648_11395553 3300026089 Bacteria 658
201 Ga0207675_100017924 3300026118 Bacteria 6604
202 Ga0207675_100451373 3300026118 Bacteria 1274
203 Ga0207698_10174934 3300026142 Bacteria 1894
204 Ga0207698_11091055 3300026142 Bacteria 811
205 Ga0207428_10020435 3300027907 Bacteria 5625
206 Ga0207428_10052181 3300027907 Bacteria 3267
207 Ga0207428_10434800 3300027907 Bacteria 958
208 Ga0268265_10644169 3300028380 Bacteria 1018
209 Ga0268265_11227541 3300028380 Bacteria 748
210 Ga0268264_10570237 3300028381 Unclassified 1112
211 Ga0265326_10000008 3300028558 Bacteria 210923
212 Ga0265319_1003947 3300028563 Bacteria 7529
213 Ga0265334_10000062 3300028573 Bacteria 78710
214 Ga0265336_10002129 3300028666 Bacteria 8380
215 Ga0265338_10022597 3300028800 Bacteria 6503
216 Ga0265338_10261353 3300028800 Bacteria 1272
217 Ga0265324_10001970 3300029957 Bacteria 11006
218 Ga0265340_10042414 3300031247 Bacteria 2234
219 Ga0265327_10051070 3300031251 Bacteria 2160
220 Ga0307408_100094310 3300031548 Bacteria 2266
221 Ga0307408_100707442 3300031548 Bacteria 906
222 Ga0307405_10022657 3300031731 Bacteria 3555
223 Ga0307405_10210772 3300031731 Bacteria 1418
224 Ga0307405_10386919 3300031731 Bacteria 1091
225 Ga0307413_10076263 3300031824 Bacteria 2130
226 Ga0307413_10181807 3300031824 Bacteria 1500
227 Ga0307410_10041284 3300031852 Bacteria 3041
228 Ga0307410_10058396 3300031852 Bacteria 2630
229 Ga0307410_10148992 3300031852 Bacteria 1740
230 Ga0307410_10242889 3300031852 Bacteria 1396
231 Ga0307410_10517401 3300031852 Bacteria 984
232 Ga0307410_10784874 3300031852 Bacteria 809
233 Ga0307406_10001806 3300031901 Bacteria 11697
234 Ga0307406_10058397 3300031901 Bacteria 2479
235 Ga0307406_10163984 3300031901 Unclassified 1601
236 Ga0307406_11060564 3300031901 Bacteria 698
237 Ga0307407_10019022 3300031903 Bacteria 3489
238 Ga0307407_10125254 3300031903 Bacteria 1635
239 Ga0307407_10525266 3300031903 Bacteria 871
240 Ga0307412_10166750 3300031911 Bacteria 1643
241 Ga0307412_10753065 3300031911 Bacteria 841
242 Ga0307409_100019028 3300031995 Bacteria 4637
243 Ga0307409_100127295 3300031995 Bacteria 2169
244 Ga0307409_100379457 3300031995 Bacteria 1343
245 Ga0307416_100056074 3300032002 Bacteria 3177
246 Ga0307416_100156018 3300032002 Bacteria 2102
247 Ga0307416_100788669 3300032002 Bacteria 1045
248 Ga0307416_101527290 3300032002 Unclassified 773
249 Ga0307414_10091843 3300032004 Bacteria 2258
250 Ga0307414_10623471 3300032004 Bacteria 970
251 Ga0307414_10892267 3300032004 Unclassified 815
252 Ga0307411_10137385 3300032005 Bacteria 1797
253 Ga0307411_10425604 3300032005 Bacteria 1104
254 Ga0307415_100002263 3300032126 Bacteria 9538
255 Ga0307415_100017267 3300032126 Bacteria 4323
256 Ga0307415_100225212 3300032126 Bacteria 1506
257 Ga0307415_101143742 3300032126 Bacteria 731
258 Ga0307415_101605405 3300032126 Bacteria 625
259 Ga0373951_0091383 3300035091 Bacteria 799
260 Ga0373939_0048533 3300035114 Bacteria 1309
261 Ga0373962_0098432 3300035242 Bacteria 910
262 Ga0395900_0389484 3300037418 Unclassified 1360
263 Ga0395898_0218298 3300037466 Bacteria 1819
264 Ga0395905_0466893 3300037471 Bacteria 1161
265 Ga0436364_0029417 3300037853 Bacteria 3233
266 Ga0436364_0062618 3300037853 Bacteria 23174
267 Ga0436364_0494622 3300037853 Unclassified 1566
268 Ga0436364_0910337 3300037853 Bacteria 32364
269 Ga0436364_1190767 3300037853 Bacteria 525
270 Ga0436364_1363582 3300037853 Bacteria 10004
271 Ga0436364_1415818 3300037853 Archaea 950
272 Ga0395901_0383471 3300038443 Bacteria 1446
273 Ga0395901_0680077 3300038443 Bacteria 1029
274 Ga0395901_0703318 3300038443 Bacteria 1008
275 Ga0395901_1561260 3300038443 Bacteria 614
276 Ga0436365_0319668 3300039437 Bacteria 2691
277 Ga0436365_0600308 3300039437 Bacteria 916
278 Ga0436365_1033267 3300039437 Bacteria 2225
279 Ga0436365_1048502 3300039437 Unclassified 1358
280 Ga0436365_1627114 3300039437 Bacteria 4447
281 Ga0436360_0863555 3300039438 Bacteria 849
282 Ga0436361_0187644 3300039447 Bacteria 1333
283 Ga0436363_0052387 3300039450 Unclassified 574
284 Ga0436363_0311469 3300039450 Bacteria 928
285 Ga0436363_0667075 3300039450 Bacteria 1599
286 Ga0436363_0884660 3300039450 Bacteria 26785
287 Ga0436363_1005851 3300039450 Bacteria 1384
288 Ga0436362_0425500 3300039453 Unclassified 551
289 Ga0436362_0631632 3300039453 Bacteria 1407
290 Ga0436362_0777928 3300039453 Bacteria 4744
291 Ga0436362_0817764 3300039453 Bacteria 949
292 Ga0436362_0859709 3300039453 Unclassified 937
293 Ga0436362_1050798 3300039453 Bacteria 7740
294 Ga0451847_0982243 3300041503 Bacteria 563
295 Ga0439448_0235878 3300042005 Bacteria 644
296 Ga0439435_0280112 3300042436 Bacteria 567
297 Ga0439460_0208468 3300042461 Bacteria 667
298 Ga0439440_0003319 3300042993 Bacteria 3096
299 Ga0466969_0260915 3300044656 Bacteria 785
300 Ga0466965_0365959 3300044683 Bacteria 792
301 Ga0466966_0053181 3300044684 Bacteria 2569
302 Ga0466966_0163923 3300044684 Bacteria 1353
303 Ga0466966_0237189 3300044684 Bacteria 1100
304 Ga0466961_0008918 3300044693 Bacteria 6399
305 Ga0466961_0045959 3300044693 Bacteria 2793
306 Ga0466961_0508622 3300044693 Bacteria 727
307 Ga0466963_0010064 3300044694 Bacteria 5719
308 Ga0466963_0021369 3300044694 Bacteria 4082
309 Ga0466963_0199656 3300044694 Bacteria 1399
310 Ga0466963_0576919 3300044694 Bacteria 794
311 Ga0466963_1158765 3300044694 Bacteria 543
312 Ga0466964_0339007 3300044706 Bacteria 769
313 Ga0466971_0020921 3300044719 Bacteria 2908
314 Ga0466971_0051774 3300044719 Bacteria 1849
315 Ga0466971_0178889 3300044719 Bacteria 997
316 Ga0466970_0019746 3300044765 Bacteria 3497
317 Ga0466970_0629088 3300044765 Bacteria 624
318 Ga0466957_0125547 3300044842 Bacteria 1639
319 Ga0466957_0586961 3300044842 Bacteria 779
320 Ga0466959_0019217 3300045049 Bacteria 5024
321 Ga0466959_0055129 3300045049 Bacteria 2903
322 Ga0466959_0100183 3300045049 Bacteria 2074
323 Ga0466959_0118169 3300045049 Bacteria 1887
324 Ga0466959_0139499 3300045049 Bacteria 1714
325 Ga0466959_0194639 3300045049 Bacteria 1414
326 Ga0466959_0344745 3300045049 Bacteria 1016
327 Ga0466958_0004702 3300045836 Bacteria 7247
328 Ga0466958_0013104 3300045836 Bacteria 4713
329 Ga0466958_0049676 3300045836 Bacteria 2538
330 Ga0466958_0114804 3300045836 Bacteria 1682
331 Ga0466958_0168562 3300045836 Bacteria 1386
332 Ga0466958_0207385 3300045836 Bacteria 1248
333 Ga0466958_0374091 3300045836 Bacteria 918
334 Ga0466967_0113160 3300045976 Bacteria 2496
335 Ga0466967_0166842 3300045976 Bacteria 2070
336 Ga0495596_0042401 3300046500 Bacteria 1793
337 Ga0495596_0086183 3300046500 Bacteria 1219
338 Ga0495616_0079885 3300046513 Bacteria 1567
339 Ga0495616_0350189 3300046513 Bacteria 615
340 Ga0495620_0318042 3300046515 Bacteria 591
341 Ga0495668_0289417 3300046616 Bacteria 898
342 Ga0495589_0354108 3300046794 Bacteria 676
343 Ga0495604_0365069 3300047317 Unclassified 957
344 Ga0495672_0064596 3300047320 Bacteria 2095
345 Ga0495680_0837027 3300047322 Unclassified 599
346 Ga0496100_0241861 3300048903 Bacteria 1332
347 Ga0496106_1047241 3300048909 Unclassified 641
348 Ga0496108_0233006 3300048911 Bacteria 1601
349 Ga0496112_0000280 3300048915 Bacteria 33010
350 Ga0496112_0674982 3300048915 Bacteria 962
351 Ga0496113_0017619 3300048916 Bacteria 4963
352 Ga0496124_0046270 3300048927 Bacteria 3728
353 Ga0501031_0112438 3300049568 Bacteria 1778
354 Ga0501032_0039602 3300049569 Bacteria 3205
355 Ga0501033_0022754 3300049570 Bacteria 4725
356 Ga0501034_0126492 3300049571 Bacteria 2540
357 Ga0501036_0018031 3300049572 Bacteria 5909
358 Ga0501036_0097175 3300049572 Bacteria 2490
359 Ga0501036_0331308 3300049572 Bacteria 1272
360 Ga0501036_1016789 3300049572 Bacteria 678
361 Ga0501037_0030262 3300049573 Bacteria 4001
362 Ga0501038_0004990 3300049574 Bacteria 12323
363 Ga0501039_0014323 3300049575 Bacteria 6072
364 Ga0501039_0379794 3300049575 Bacteria 1110
365 Ga0501039_0737454 3300049575 Bacteria 770
366 Ga0501040_0397075 3300049576 Unclassified 990
367 Ga0501040_0480854 3300049576 Bacteria 895
368 Ga0501041_0684616 3300049577 Bacteria 656
369 Ga0501042_0057115 3300049578 Bacteria 2785
370 Ga0501042_0188155 3300049578 Bacteria 1489
371 Ga0501042_0254807 3300049578 Unclassified 1266
372 Ga0501042_0375255 3300049578 Bacteria 1029
373 Ga0501043_0005348 3300049579 Bacteria 10372
374 Ga0501046_0017256 3300049580 Bacteria 6028
375 Ga0501048_0004677 3300049582 Bacteria 10422
376 Ga0501048_0086701 3300049582 Bacteria 2208
377 Ga0501048_0093331 3300049582 Bacteria 2123
378 Ga0501048_0270060 3300049582 Bacteria 1209
379 Ga0501067_0015461 3300049583 Bacteria 4225
380 Ga0501067_0536041 3300049583 Bacteria 655
381 Ga0501068_0042974 3300049584 Bacteria 2717
382 Ga0501069_0031618 3300049585 Bacteria 2912
383 Ga0501070_0019473 3300049586 Bacteria 5691
384 Ga0501071_0204307 3300049587 Bacteria 1485
385 Ga0501071_0775376 3300049587 Bacteria 739
386 Ga0501071_0997325 3300049587 Bacteria 647
387 Ga0501072_0023098 3300049588 Bacteria 4829
388 Ga0501072_0065436 3300049588 Bacteria 2867
389 Ga0501073_0055033 3300049589 Bacteria 2784
390 Ga0501074_0003141 3300049590 Bacteria 11651
391 Ga0501074_0952113 3300049590 Bacteria 604
392 Ga0501075_0235944 3300049591 Bacteria 1394
393 Ga0501075_0784378 3300049591 Unclassified 725
394 Ga0501076_0310106 3300049592 Bacteria 1294
395 Ga0501076_0356529 3300049592 Bacteria 1201
396 Ga0501076_0607650 3300049592 Bacteria 902
397 Ga0501221_091744 3300049704 Unclassified 744
398 Ga0501079_0051483 3300049741 Bacteria 3180
399 Ga0501079_0532793 3300049741 Bacteria 923
400 Ga0501080_0066536 3300049742 Bacteria 3351
401 Ga0501080_0437190 3300049742 Bacteria 1174
402 Ga0501081_0021402 3300049743 Bacteria 4316
403 Ga0501081_0155083 3300049743 Bacteria 1647
404 Ga0501083_0071126 3300049744 Bacteria 2313
405 Ga0501035_0029695 3300049822 Bacteria 4985
406 Ga0501045_0428467 3300049824 Bacteria 984
407 nmdc:mga0yw44_379133_c1 3300050492 Unclassified 955
408 nmdc:mga0yw44_44134_c1 3300050492 Bacteria 2665
409 nmdc:mga05p37_147406_c1 3300050507 Bacteria 2880
410 nmdc:mga05p37_188571_c1 3300050507 Bacteria 2505
411 nmdc:mga05p37_526487_c1 3300050507 Bacteria 1351
412 nmdc:mga05p37_8959_c1 3300050507 Bacteria 11834
413 nmdc:mga05p37_9700_c1 3300050507 Bacteria 11413
414 nmdc:mga09592_119678_c1 3300050508 Bacteria 2261
415 nmdc:mga09592_19715_c1 3300050508 Bacteria 5539
416 nmdc:mga09592_246720_c1 3300050508 Bacteria 1547
417 nmdc:mga09592_58400_c1 3300050508 Bacteria 3262
418 nmdc:mga0qj67_101244_c1 3300050509 Bacteria 2322
419 nmdc:mga0qj67_1034306_c1 3300050509 Bacteria 643
420 nmdc:mga0qj67_12293_c1 3300050509 Bacteria 6446
421 nmdc:mga0qj67_31003_c1 3300050509 Bacteria 4164
422 nmdc:mga0qj67_660835_c1 3300050509 Bacteria 833
423 nmdc:mga06r32_1037172_c1 3300050510 Bacteria 771
424 nmdc:mga06r32_14328_c1 3300050510 Bacteria 7193
425 nmdc:mga06r32_238937_c1 3300050510 Bacteria 1804
426 nmdc:mga06r32_487190_c1 3300050510 Bacteria 1211
427 nmdc:mga06r32_500983_c1 3300050510 Bacteria 1191
428 nmdc:mga06r32_558130_c1 3300050510 Bacteria 1118
429 nmdc:mga06r32_849473_c1 3300050510 Bacteria 871
430 nmdc:mga08y16_256807_c1 3300050511 Bacteria 1805
431 nmdc:mga08y16_584033_c1 3300050511 Bacteria 1128
432 nmdc:mga08y16_6781_c1 3300050511 Bacteria 12017
433 nmdc:mga0n895_1098233_c1 3300050512 Bacteria 773
434 nmdc:mga0n895_1906187_c1 3300050512 Bacteria 553
435 nmdc:mga0a205_72585_c1 3300050515 Bacteria 3325
436 Ga0495655_0247359 3300053083 Bacteria 598
437 Ga0500556_0002090 3300053104 Bacteria 6855
438 Ga0500616_0007095 3300053153 Bacteria 7184
439 Ga0501084_0191827 3300054114 Bacteria 1724
440 Ga0590077_058539 3300059426 Bacteria 872
441 Ga0501082_0058561 3300060353 Bacteria 3319
442 Ga0501082_0119629 3300060353 Bacteria 2282
443 Ga0466962_0018673 3300061719 Bacteria 3334
444 Ga0530510_0134408 3300061734 Bacteria 1820
445 Ga0070669_100012578
446 LJQas_1002679
447 JGI25407J50210_10003586
448 JGI25407J50210_10004636
449 JGI25407J50210_10010473
450 Ga0070676_10075902
451 Ga0070683_100086327
452 Ga0070683_100115799
453 Ga0068869_101249700
454 Ga0070680_100002005
455 Ga0070682_100282285
456 Ga0070660_100034501
457 Ga0070660_100090768
458 Ga0070691_10043420
459 Ga0070691_10389156
460 Ga0070687_100265109
461 Ga0070687_100513529
462 Ga0070661_100376188
463 Ga0070692_10000906
464 Ga0070692_10240352
465 Ga0070668_100122665
466 Ga0070668_100685081
467 Ga0070671_101231450
468 Ga0070673_101208692
469 Ga0070659_100000071
470 Ga0070659_100007306
471 Ga0070714_100004952
472 Ga0070714_100089304
473 Ga0070714_100258243
474 Ga0070713_100391290
475 Ga0070713_100424499
476 Ga0070710_10000001
477 Ga0070705_100000442
478 Ga0070694_101139023
479 Ga0070662_100012617
480 Ga0070681_10006184
481 Ga0070679_100044333
482 Ga0070684_100078977
483 Ga0068853_100235916
484 Ga0068853_100327116
485 Ga0070696_100047909
486 Ga0068855_100087615
487 Ga0070664_100504256
488 Ga0068854_100119221
489 Ga0068854_101104448
490 Ga0068856_100011930
491 Ga0068852_100001803
492 Ga0068852_100781901
493 Ga0068859_103120067
494 Ga0068861_100050890
495 Ga0068861_100916637
496 Ga0068870_10382934
497 Ga0068870_10935514
498 Ga0068862_100404967
499 Ga0068862_101589286
500 Ga0081455_10090935
501 Ga0081455_10350676
502 Ga0081538_10000117
503 Ga0081538_10000299
504 Ga0081538_10000369
505 Ga0081538_10001315
506 Ga0081538_10004390
507 Ga0081538_10006091
508 Ga0081538_10006312
509 Ga0081538_10009063
510 Ga0081538_10009608
511 Ga0081538_10010451
512 Ga0081538_10013180
513 Ga0081538_10013697
514 Ga0081538_10036505
515 Ga0081538_10063701
516 Ga0081538_10105127
517 Ga0081539_10082716
518 Ga0070717_10000010
519 Ga0070717_10029066
520 Ga0075365_10045985
521 Ga0075363_100481170
522 Ga0075364_10866650
523 Ga0075432_10005746
524 Ga0075432_10170139
525 Ga0070716_100922114
526 Ga0068871_101204833
527 Ga0075428_100013317
528 Ga0075428_100254525
529 Ga0075428_100256766
530 Ga0075430_100000288
531 Ga0075430_100014319
532 Ga0075430_100385526
533 Ga0075430_101579412
534 Ga0075431_100024925
535 Ga0075431_100026819
536 Ga0075431_100333480
537 Ga0075431_100676775
538 Ga0075433_10048727
539 Ga0075434_100728197
540 Ga0075429_100019721
541 Ga0075429_100303031
542 Ga0075429_100632419
543 Ga0068865_100427159
544 Ga0097620_103120503
545 Ga0105240_10031681
546 Ga0105240_10086198
547 Ga0111539_10007468
548 Ga0111539_10010512
549 Ga0111539_10321897
550 Ga0111539_10508999
551 Ga0111539_10916583
552 Ga0105245_10005790
553 Ga0114129_10014159
554 Ga0114129_10014877
555 Ga0114129_10174639
556 Ga0114129_10506857
557 Ga0114129_10602799
558 Ga0114129_10732426
559 Ga0114129_11499951
560 Ga0114129_11550108
561 Ga0114129_11640731
562 Ga0105243_10538551
563 Ga0105243_10714143
564 Ga0105237_10061781
565 Ga0105238_10088739
566 Ga0105249_10247138
567 Ga0105249_10899127
568 Ga0105239_10096613
569 Ga0105246_10033428
570 Ga0157371_10098979
571 Ga0157370_10006987
572 Ga0157369_10055044
573 Ga0163162_11977416
574 Ga0157372_10058747
575 Ga0157372_10287952
576 Ga0157372_10983178
577 Ga0157375_11205807
578 Ga0157375_11268423
579 Ga0157380_10601373
580 Ga0157377_10179744
581 Ga0157376_10038629
582 Ga0163161_10729607
583 Ga0206356_10422037
584 Ga0206354_10917454
585 Ga0206353_10230645
586 Ga0213876_10012583
587 Ga0213876_10034583
588 Ga0213876_10395629
589 Ga0213875_10001188
590 Ga0213875_10014234
591 Ga0213875_10026583
592 Ga0207692_10000004
593 Ga0207688_10058709
594 Ga0207645_10392570
595 Ga0207707_10002279
596 Ga0207695_10074129
597 Ga0207695_10132582
598 Ga0207671_10116742
599 Ga0207660_10144036
600 Ga0207660_10756393
601 Ga0207662_10136241
602 Ga0207657_10013809
603 Ga0207657_10097959
604 Ga0207649_10313973
605 Ga0207652_10122206
606 Ga0207652_10278802
607 Ga0207681_10004093
608 Ga0207681_10305667
609 Ga0207694_10086364
610 Ga0207694_10885640
611 Ga0207687_10110757
612 Ga0207700_10255324
613 Ga0207664_10000040
614 Ga0207664_10001652
615 Ga0207664_10007343
616 Ga0207664_10043439
617 Ga0207664_10193979
618 Ga0207644_10908997
619 Ga0207690_10000093
620 Ga0207690_10308595
621 Ga0207706_10007927
622 Ga0207706_10921119
623 Ga0207686_10368551
624 Ga0207709_10988436
625 Ga0207670_10940069
626 Ga0207670_11172755
627 Ga0207665_10602605
628 Ga0207661_10002384
629 Ga0207661_10364020
630 Ga0207661_10959700
631 Ga0207679_10385573
632 Ga0207712_10010794
633 Ga0207712_10613062
634 Ga0207668_10042702
635 Ga0207668_10901012
636 Ga0207640_10235222
637 Ga0207640_10608405
638 Ga0207639_10170298
639 Ga0207639_10607640
640 Ga0207678_10346363
641 Ga0207708_10151343
642 Ga0207708_10800387
643 Ga0207702_10939317
644 Ga0207648_11395553
645 Ga0207675_100017924
646 Ga0207675_100451373
647 Ga0207698_10174934
648 Ga0207698_11091055
649 Ga0207428_10020435
650 Ga0207428_10052181
651 Ga0207428_10434800
652 Ga0268265_10644169
653 Ga0268265_11227541
654 Ga0268264_10570237
655 Ga0265326_10000008
656 Ga0265319_1003947
657 Ga0265334_10000062
658 Ga0265336_10002129
659 Ga0265338_10022597
660 Ga0265338_10261353
661 Ga0265324_10001970
662 Ga0265340_10042414
663 Ga0265327_10051070
664 Ga0307408_100094310
665 Ga0307408_100707442
666 Ga0307405_10022657
667 Ga0307405_10210772
668 Ga0307405_10386919
669 Ga0307413_10076263
670 Ga0307413_10181807
671 Ga0307410_10041284
672 Ga0307410_10058396
673 Ga0307410_10148992
674 Ga0307410_10242889
675 Ga0307410_10517401
676 Ga0307410_10784874
677 Ga0307406_10001806
678 Ga0307406_10058397
679 Ga0307406_10163984
680 Ga0307406_11060564
681 Ga0307407_10019022
682 Ga0307407_10125254
683 Ga0307407_10525266
684 Ga0307412_10166750
685 Ga0307412_10753065
686 Ga0307409_100019028
687 Ga0307409_100127295
688 Ga0307409_100379457
689 Ga0307416_100056074
690 Ga0307416_100156018
691 Ga0307416_100788669
692 Ga0307416_101527290
693 Ga0307414_10091843
694 Ga0307414_10623471
695 Ga0307414_10892267
696 Ga0307411_10137385
697 Ga0307411_10425604
698 Ga0307415_100002263
699 Ga0307415_100017267
700 Ga0307415_100225212
701 Ga0307415_101143742
702 Ga0307415_101605405
703 Ga0373951_0091383
704 Ga0373939_0048533
705 Ga0373962_0098432
706 Ga0395900_0389484
707 Ga0395898_0218298
708 Ga0395905_0466893
709 Ga0436364_0029417
710 Ga0436364_0062618
711 Ga0436364_0494622
712 Ga0436364_0910337
713 Ga0436364_1190767
714 Ga0436364_1363582
715 Ga0436364_1415818
716 Ga0395901_0383471
717 Ga0395901_0680077
718 Ga0395901_0703318
719 Ga0395901_1561260
720 Ga0436365_0319668
721 Ga0436365_0600308
722 Ga0436365_1033267
723 Ga0436365_1048502
724 Ga0436365_1627114
725 Ga0436360_0863555
726 Ga0436361_0187644
727 Ga0436363_0052387
728 Ga0436363_0311469
729 Ga0436363_0667075
730 Ga0436363_0884660
731 Ga0436363_1005851
732 Ga0436362_0425500
733 Ga0436362_0631632
734 Ga0436362_0777928
735 Ga0436362_0817764
736 Ga0436362_0859709
737 Ga0436362_1050798
738 Ga0451847_0982243
739 Ga0439448_0235878
740 Ga0439435_0280112
741 Ga0439460_0208468
742 Ga0439440_0003319
743 Ga0466969_0260915
744 Ga0466965_0365959
745 Ga0466966_0053181
746 Ga0466966_0163923
747 Ga0466966_0237189
748 Ga0466961_0008918
749 Ga0466961_0045959
750 Ga0466961_0508622
751 Ga0466963_0010064
752 Ga0466963_0021369
753 Ga0466963_0199656
754 Ga0466963_0576919
755 Ga0466963_1158765
756 Ga0466964_0339007
757 Ga0466971_0020921
758 Ga0466971_0051774
759 Ga0466971_0178889
760 Ga0466970_0019746
761 Ga0466970_0629088
762 Ga0466957_0125547
763 Ga0466957_0586961
764 Ga0466959_0019217
765 Ga0466959_0055129
766 Ga0466959_0100183
767 Ga0466959_0118169
768 Ga0466959_0139499
769 Ga0466959_0194639
770 Ga0466959_0344745
771 Ga0466958_0004702
772 Ga0466958_0013104
773 Ga0466958_0049676
774 Ga0466958_0114804
775 Ga0466958_0168562
776 Ga0466958_0207385
777 Ga0466958_0374091
778 Ga0466967_0113160
779 Ga0466967_0166842
780 Ga0495596_0042401
781 Ga0495596_0086183
782 Ga0495616_0079885
783 Ga0495616_0350189
784 Ga0495620_0318042
785 Ga0495668_0289417
786 Ga0495589_0354108
787 Ga0495604_0365069
788 Ga0495672_0064596
789 Ga0495680_0837027
790 Ga0496100_0241861
791 Ga0496106_1047241
792 Ga0496108_0233006
793 Ga0496112_0000280
794 Ga0496112_0674982
795 Ga0496113_0017619
796 Ga0496124_0046270
797 Ga0501031_0112438
798 Ga0501032_0039602
799 Ga0501033_0022754
800 Ga0501034_0126492
801 Ga0501036_0018031
802 Ga0501036_0097175
803 Ga0501036_0331308
804 Ga0501036_1016789
805 Ga0501037_0030262
806 Ga0501038_0004990
807 Ga0501039_0014323
808 Ga0501039_0379794
809 Ga0501039_0737454
810 Ga0501040_0397075
811 Ga0501040_0480854
812 Ga0501041_0684616
813 Ga0501042_0057115
814 Ga0501042_0188155
815 Ga0501042_0254807
816 Ga0501042_0375255
817 Ga0501043_0005348
818 Ga0501046_0017256
819 Ga0501048_0004677
820 Ga0501048_0086701
821 Ga0501048_0093331
822 Ga0501048_0270060
823 Ga0501067_0015461
824 Ga0501067_0536041
825 Ga0501068_0042974
826 Ga0501069_0031618
827 Ga0501070_0019473
828 Ga0501071_0204307
829 Ga0501071_0775376
830 Ga0501071_0997325
831 Ga0501072_0023098
832 Ga0501072_0065436
833 Ga0501073_0055033
834 Ga0501074_0003141
835 Ga0501074_0952113
836 Ga0501075_0235944
837 Ga0501075_0784378
838 Ga0501076_0310106
839 Ga0501076_0356529
840 Ga0501076_0607650
841 Ga0501221_091744
842 Ga0501079_0051483
843 Ga0501079_0532793
844 Ga0501080_0066536
845 Ga0501080_0437190
846 Ga0501081_0021402
847 Ga0501081_0155083
848 Ga0501083_0071126
849 Ga0501035_0029695
850 Ga0501045_0428467
851 nmdc:mga0yw44_379133_c1
852 nmdc:mga0yw44_44134_c1
853 nmdc:mga05p37_147406_c1
854 nmdc:mga05p37_188571_c1
855 nmdc:mga05p37_526487_c1
856 nmdc:mga05p37_8959_c1
857 nmdc:mga05p37_9700_c1
858 nmdc:mga09592_119678_c1
859 nmdc:mga09592_19715_c1
860 nmdc:mga09592_246720_c1
861 nmdc:mga09592_58400_c1
862 nmdc:mga0qj67_101244_c1
863 nmdc:mga0qj67_1034306_c1
864 nmdc:mga0qj67_12293_c1
865 nmdc:mga0qj67_31003_c1
866 nmdc:mga0qj67_660835_c1
867 nmdc:mga06r32_1037172_c1
868 nmdc:mga06r32_14328_c1
869 nmdc:mga06r32_238937_c1
870 nmdc:mga06r32_487190_c1
871 nmdc:mga06r32_500983_c1
872 nmdc:mga06r32_558130_c1
873 nmdc:mga06r32_849473_c1
874 nmdc:mga08y16_256807_c1
875 nmdc:mga08y16_584033_c1
876 nmdc:mga08y16_6781_c1
877 nmdc:mga0n895_1098233_c1
878 nmdc:mga0n895_1906187_c1
879 nmdc:mga0a205_72585_c1
880 Ga0495655_0247359
881 Ga0500556_0002090
882 Ga0500616_0007095
883 Ga0501084_0191827
884 Ga0590077_058539
885 Ga0501082_0058561
886 Ga0501082_0119629
887 Ga0466962_0018673
888 Ga0530510_0134408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

48

148

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3guf-assembly1.cif.gz_B crystal structure of the hspa from xanthomonas axonopodis 0.8463 36 133
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8411 39 129
4fei-assembly1.cif.gz_A-2 hsp17.7 from deinococcus radiodurans 0.8356 32 133
2jki-assembly3.cif.gz_U complex of hsp90 n-terminal and sgt1 cs domain 0.8337 37 131
3vql-assembly1.cif.gz_A small heat shock protein hsp14.0 of c-terminal deletion variant 0.8282 38 131
ID Description Score Start End Superfamily
3glaB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8497 36 132 2.60.40.790
4feiA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8356 32 133 2.60.40.790
af_A4HT71_133_218_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8281 36 131 2.60.40.790
3glaB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8184 36 132 2.60.40.790
af_Q208N7_181_285_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8181 33 131 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A3N5JS88-F1-model_v4 Hsp20/alpha crystallin family protein 0.8541 28 132
AF-A0A1G1H965-F1-model_v4 SHSP domain-containing protein 0.8538 28 131
AF-X1IJ14-F1-model_v4 SHSP domain-containing protein 0.8368 28 145
AF-A0A7W0LX40-F1-model_v4 Hsp20/alpha crystallin family protein 0.8343 15 147
AF-A0A2V9JXJ1-F1-model_v4 SHSP domain-containing protein 0.8242 28 136

Map