F445123

General Info

Members Datasets Scaffolds Average Seq Length
443 205 886 116

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0991256|Ga0373925_0991256_228_644
Length 138
Sequence MGGCIGSRGLATAAGMTQRGTMHKRSNEPFVWLLFSAGGVVAALLIPIHLFLFGLAFPLGWLNAPTYDSVRALAGSPIGRIYLFVLCMLPLFHWAHRFRYTLYDGLQIKHLDELVNTLCYGGAIVGTIIAGYLIWRIP

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
185 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
186 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
187 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
188 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
189 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
190 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 27.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0991256 3300037068 Unclassified 692
2 SwRhRL3b_contig_1413738 2162886006 Bacteria 1262
3 SwRhRL2b_contig_1700974 2162886007 Bacteria 1617
4 JGI24740J21852_10013119 3300001979 Bacteria 3104
5 JGI24739J22299_10019462 3300001989 Bacteria 2430
6 JGI24737J22298_10005357 3300001990 Bacteria 4434
7 JGI24735J21928_10089000 3300002067 Bacteria 885
8 JGI24738J21930_10017897 3300002075 Bacteria 1485
9 Ga0065704_10110570 3300005289 Bacteria 1947
10 Ga0065704_10308146 3300005289 Bacteria 873
11 Ga0065704_10451153 3300005289 Unclassified 705
12 Ga0065707_10011416 3300005295 Bacteria 2028
13 Ga0070676_10288566 3300005328 Unclassified 1108
14 Ga0070676_11167477 3300005328 Unclassified 584
15 Ga0070683_100325669 3300005329 Bacteria 1463
16 Ga0070670_100027666 3300005331 Bacteria 4877
17 Ga0070670_100185956 3300005331 Bacteria 1804
18 Ga0070670_102245241 3300005331 Unclassified 503
19 Ga0070677_10038688 3300005333 Bacteria 1868
20 Ga0068869_100181253 3300005334 Bacteria 1651
21 Ga0068869_101765803 3300005334 Unclassified 553
22 Ga0070682_101726763 3300005337 Bacteria 544
23 Ga0070660_100193037 3300005339 Bacteria 1650
24 Ga0070668_100012784 3300005347 Bacteria 6250
25 Ga0070669_100002826 3300005353 Bacteria 12540
26 Ga0070669_100130986 3300005353 Bacteria 1924
27 Ga0070675_100553304 3300005354 Bacteria 1041
28 Ga0070673_101530350 3300005364 Unclassified 629
29 Ga0070688_101173847 3300005365 Bacteria 616
30 Ga0070659_100583789 3300005366 Bacteria 959
31 Ga0070667_100210960 3300005367 Bacteria 1726
32 Ga0070667_100374937 3300005367 Bacteria 1292
33 Ga0070709_10684334 3300005434 Unclassified 797
34 Ga0070714_100054855 3300005435 Unclassified 3405
35 Ga0070713_100000605 3300005436 Bacteria 22815
36 Ga0070713_100758136 3300005436 Bacteria 929
37 Ga0070701_10009062 3300005438 Bacteria 4344
38 Ga0070701_10822310 3300005438 Unclassified 635
39 Ga0070711_100003300 3300005439 Bacteria 9395
40 Ga0070705_101784329 3300005440 Unclassified 521
41 Ga0070700_100064579 3300005441 Bacteria 2319
42 Ga0070694_100147694 3300005444 Bacteria 1714
43 Ga0070694_100901502 3300005444 Unclassified 730
44 Ga0070708_100058579 3300005445 Bacteria 3432
45 Ga0070708_100072078 3300005445 Bacteria 3112
46 Ga0070708_100092654 3300005445 Bacteria 2753
47 Ga0070708_100214855 3300005445 Bacteria 1802
48 Ga0070708_100961978 3300005445 Unclassified 801
49 Ga0070662_100085252 3300005457 Bacteria 2361
50 Ga0070662_100197405 3300005457 Bacteria 1595
51 Ga0068867_100139572 3300005459 Bacteria 1893
52 Ga0070706_100020403 3300005467 Bacteria 6107
53 Ga0070706_100049138 3300005467 Bacteria 3893
54 Ga0070706_100075207 3300005467 Bacteria 3125
55 Ga0070706_100275509 3300005467 Bacteria 1570
56 Ga0070706_100501666 3300005467 Bacteria 1129
57 Ga0070706_101257331 3300005467 Unclassified 679
58 Ga0070706_101295568 3300005467 Unclassified 668
59 Ga0070707_100000561 3300005468 Bacteria 37306
60 Ga0070707_100005665 3300005468 Bacteria 11663
61 Ga0070707_100022819 3300005468 Bacteria 5918
62 Ga0070707_100287207 3300005468 Bacteria 1599
63 Ga0070707_100447845 3300005468 Unclassified 1252
64 Ga0070707_100449302 3300005468 Bacteria 1249
65 Ga0070707_100761182 3300005468 Unclassified 932
66 Ga0070707_100881464 3300005468 Bacteria 859
67 Ga0070698_100116176 3300005471 Bacteria 2640
68 Ga0070698_100126044 3300005471 Bacteria 2518
69 Ga0070698_100301806 3300005471 Bacteria 1532
70 Ga0070698_100538179 3300005471 Bacteria 1107
71 Ga0070698_102018196 3300005471 Bacteria 530
72 Ga0070699_100040901 3300005518 Bacteria 4013
73 Ga0070699_100080462 3300005518 Bacteria 2839
74 Ga0070699_100594731 3300005518 Bacteria 1008
75 Ga0070699_100733910 3300005518 Unclassified 903
76 Ga0070699_101186658 3300005518 Bacteria 700
77 Ga0070699_101560398 3300005518 Unclassified 605
78 Ga0070679_101313639 3300005530 Bacteria 669
79 Ga0070697_100002259 3300005536 Bacteria 14778
80 Ga0070697_100050391 3300005536 Bacteria 3379
81 Ga0070697_100253092 3300005536 Bacteria 1506
82 Ga0070672_100016504 3300005543 Bacteria 5288
83 Ga0070672_100305769 3300005543 Bacteria 1349
84 Ga0070695_100027471 3300005545 Bacteria 3525
85 Ga0070695_101426439 3300005545 Bacteria 575
86 Ga0070696_100089983 3300005546 Bacteria 2183
87 Ga0070696_100488548 3300005546 Bacteria 977
88 Ga0070696_100547377 3300005546 Unclassified 927
89 Ga0070704_100053811 3300005549 Bacteria 2846
90 Ga0070664_100038318 3300005564 Bacteria 4034
91 Ga0068857_100014484 3300005577 Bacteria 6880
92 Ga0068857_100073968 3300005577 Bacteria 3037
93 Ga0068859_100032628 3300005617 Bacteria 5230
94 Ga0068864_100137654 3300005618 Bacteria 2200
95 Ga0068861_100242370 3300005719 Bacteria 1534
96 Ga0068851_10715013 3300005834 Unclassified 617
97 Ga0068870_10009111 3300005840 Bacteria 4498
98 Ga0068870_10163272 3300005840 Bacteria 1323
99 Ga0068860_100447616 3300005843 Bacteria 1284
100 Ga0068860_100709150 3300005843 Unclassified 1016
101 Ga0068860_100915570 3300005843 Unclassified 893
102 Ga0068862_100003736 3300005844 Bacteria 12990
103 Ga0068862_100131342 3300005844 Bacteria 2215
104 Ga0068862_101849516 3300005844 Bacteria 613
105 Ga0081455_10078689 3300005937 Bacteria 2709
106 Ga0081455_10100112 3300005937 Unclassified 2329
107 Ga0081538_10001519 3300005981 Bacteria 23824
108 Ga0081538_10006724 3300005981 Bacteria 10062
109 Ga0081538_10017184 3300005981 Bacteria 5503
110 Ga0081538_10031873 3300005981 Bacteria 3545
111 Ga0070717_10173266 3300006028 Bacteria 1878
112 Ga0070717_10934405 3300006028 Unclassified 790
113 Ga0075432_10017643 3300006058 Bacteria 2433
114 Ga0070716_100562794 3300006173 Unclassified 852
115 Ga0070716_100746783 3300006173 Unclassified 752
116 Ga0070716_101117546 3300006173 Unclassified 629
117 Ga0070712_100007707 3300006175 Bacteria 6735
118 Ga0075427_10020377 3300006194 Bacteria 1050
119 Ga0097621_102093600 3300006237 Unclassified 541
120 Ga0075428_100045657 3300006844 Bacteria 4813
121 Ga0075428_100501171 3300006844 Unclassified 1299
122 Ga0075428_100532149 3300006844 Unclassified 1257
123 Ga0075428_100538992 3300006844 Bacteria 1248
124 Ga0075428_100674129 3300006844 Bacteria 1102
125 Ga0075428_101270411 3300006844 Bacteria 775
126 Ga0075428_101801118 3300006844 Unclassified 637
127 Ga0075428_102422939 3300006844 Unclassified 538
128 Ga0075428_102422940 3300006844 Unclassified 538
129 Ga0075430_100002680 3300006846 Bacteria 14865
130 Ga0075430_100033393 3300006846 Bacteria 4367
131 Ga0075430_100035876 3300006846 Bacteria 4205
132 Ga0075430_100113546 3300006846 Bacteria 2258
133 Ga0075431_100191936 3300006847 Bacteria 2093
134 Ga0075431_100330363 3300006847 Bacteria 1536
135 Ga0075431_100388096 3300006847 Unclassified 1399
136 Ga0075431_100429972 3300006847 Bacteria 1318
137 Ga0075431_100549463 3300006847 Bacteria 1142
138 Ga0075431_100845621 3300006847 Unclassified 887
139 Ga0075431_101212412 3300006847 Bacteria 717
140 Ga0075431_101833345 3300006847 Bacteria 562
141 Ga0075433_10007197 3300006852 Bacteria 8810
142 Ga0075433_10020809 3300006852 Bacteria 5492
143 Ga0075433_10046353 3300006852 Bacteria 3781
144 Ga0075433_10048992 3300006852 Bacteria 3675
145 Ga0075433_10119880 3300006852 Bacteria 2335
146 Ga0075433_10204986 3300006852 Unclassified 1753
147 Ga0075433_10653065 3300006852 Bacteria 922
148 Ga0075433_11168885 3300006852 Bacteria 668
149 Ga0075433_11614502 3300006852 Unclassified 559
150 Ga0075434_100032985 3300006871 Bacteria 5108
151 Ga0075434_100043193 3300006871 Bacteria 4470
152 Ga0075434_100135347 3300006871 Bacteria 2483
153 Ga0075434_100365762 3300006871 Bacteria 1463
154 Ga0075434_100637801 3300006871 Unclassified 1084
155 Ga0075434_100643830 3300006871 Bacteria 1078
156 Ga0075434_102507557 3300006871 Unclassified 517
157 Ga0075429_100008200 3300006880 Bacteria 9081
158 Ga0075429_100073644 3300006880 Bacteria 2974
159 Ga0075429_100185080 3300006880 Bacteria 1825
160 Ga0075429_100768432 3300006880 Unclassified 844
161 Ga0075429_100787733 3300006880 Unclassified 833
162 Ga0075429_101042117 3300006880 Unclassified 715
163 Ga0068865_100155847 3300006881 Bacteria 1737
164 Ga0068865_102072210 3300006881 Bacteria 517
165 Ga0075436_100037362 3300006914 Bacteria 3353
166 Ga0097620_100032630 3300006931 Bacteria 5230
167 Ga0075435_100032120 3300007076 Bacteria 4144
168 Ga0075435_100034677 3300007076 Bacteria 4000
169 Ga0075435_100174000 3300007076 Bacteria 1817
170 Ga0075435_100178444 3300007076 Bacteria 1794
171 Ga0075435_100223586 3300007076 Bacteria 1599
172 Ga0075435_100941015 3300007076 Unclassified 754
173 Ga0099794_10471898 3300007265 Unclassified 659
174 Ga0111539_10073734 3300009094 Bacteria 4024
175 Ga0111539_10263737 3300009094 Bacteria 2005
176 Ga0111539_11277534 3300009094 Unclassified 852
177 Ga0111539_13019841 3300009094 Bacteria 544
178 Ga0105245_10649726 3300009098 Bacteria 1085
179 Ga0105245_11509709 3300009098 Bacteria 723
180 Ga0114129_10001858 3300009147 Bacteria 28777
181 Ga0114129_10032627 3300009147 Bacteria 7359
182 Ga0114129_10033854 3300009147 Bacteria 7217
183 Ga0114129_10048357 3300009147 Bacteria 5976
184 Ga0114129_10056198 3300009147 Bacteria 5514
185 Ga0114129_10056362 3300009147 Bacteria 5505
186 Ga0114129_10065657 3300009147 Bacteria 5064
187 Ga0114129_10084554 3300009147 Unclassified 4405
188 Ga0114129_10116877 3300009147 Bacteria 3675
189 Ga0114129_10118533 3300009147 Bacteria 3646
190 Ga0114129_10137341 3300009147 Bacteria 3353
191 Ga0114129_10197829 3300009147 Bacteria 2724
192 Ga0114129_10243727 3300009147 Bacteria 2415
193 Ga0114129_10339480 3300009147 Bacteria 1993
194 Ga0114129_10531783 3300009147 Bacteria 1531
195 Ga0114129_10848557 3300009147 Bacteria 1161
196 Ga0114129_10984937 3300009147 Bacteria 1063
197 Ga0114129_11009887 3300009147 Bacteria 1047
198 Ga0114129_11071530 3300009147 Bacteria 1011
199 Ga0105238_10900504 3300009551 Bacteria 903
200 Ga0105249_10213859 3300009553 Bacteria 1893
201 Ga0105239_10255228 3300010375 Bacteria 1970
202 Ga0105246_10668325 3300011119 Bacteria 906
203 Ga0157369_11865434 3300013105 Unclassified 610
204 Ga0157374_10161957 3300013296 Bacteria 2179
205 Ga0163162_10059786 3300013306 Bacteria 3844
206 Ga0157372_10055226 3300013307 Bacteria 4435
207 Ga0157375_10146685 3300013308 Bacteria 2491
208 Ga0157375_10327306 3300013308 Bacteria 1697
209 Ga0157375_12352373 3300013308 Unclassified 635
210 Ga0163163_10354326 3300014325 Bacteria 1524
211 Ga0157380_10010539 3300014326 Bacteria 6651
212 Ga0157380_10032889 3300014326 Bacteria 3991
213 Ga0157380_11161996 3300014326 Bacteria 814
214 Ga0157380_11805743 3300014326 Unclassified 671
215 Ga0157377_10885017 3300014745 Unclassified 666
216 Ga0157379_12049423 3300014968 Unclassified 566
217 Ga0157376_12119039 3300014969 Bacteria 601
218 Ga0163161_10207547 3300017792 Bacteria 1512
219 Ga0213872_10001214 3300021361 Bacteria 17438
220 Ga0207682_10019923 3300025893 Bacteria 2630
221 Ga0207647_10019594 3300025904 Bacteria 4548
222 Ga0207699_11215177 3300025906 Unclassified 558
223 Ga0207643_10010456 3300025908 Bacteria 4998
224 Ga0207643_10206606 3300025908 Bacteria 1197
225 Ga0207643_10705658 3300025908 Bacteria 652
226 Ga0207684_10055259 3300025910 Bacteria 3368
227 Ga0207684_10175982 3300025910 Unclassified 1845
228 Ga0207684_10833799 3300025910 Bacteria 778
229 Ga0207684_11530748 3300025910 Unclassified 542
230 Ga0207693_10046855 3300025915 Bacteria 3397
231 Ga0207693_10964317 3300025915 Unclassified 652
232 Ga0207663_10260593 3300025916 Unclassified 1280
233 Ga0207662_10376801 3300025918 Bacteria 958
234 Ga0207657_11238473 3300025919 Bacteria 566
235 Ga0207646_10000267 3300025922 Bacteria 71176
236 Ga0207646_10000519 3300025922 Bacteria 51444
237 Ga0207646_10017748 3300025922 Bacteria 6647
238 Ga0207646_10144502 3300025922 Bacteria 2143
239 Ga0207646_10514346 3300025922 Unclassified 1078
240 Ga0207646_10695188 3300025922 Bacteria 909
241 Ga0207646_10788382 3300025922 Bacteria 847
242 Ga0207681_11098232 3300025923 Unclassified 668
243 Ga0207650_10142842 3300025925 Bacteria 1883
244 Ga0207650_11854897 3300025925 Unclassified 510
245 Ga0207659_10016712 3300025926 Bacteria 4781
246 Ga0207687_10513530 3300025927 Bacteria 1001
247 Ga0207687_11172444 3300025927 Unclassified 660
248 Ga0207700_10003852 3300025928 Bacteria 8768
249 Ga0207664_10011171 3300025929 Bacteria 6366
250 Ga0207644_10306771 3300025931 Bacteria 1281
251 Ga0207706_10081865 3300025933 Bacteria 2837
252 Ga0207706_10651788 3300025933 Bacteria 902
253 Ga0207709_10396706 3300025935 Bacteria 1054
254 Ga0207704_10149065 3300025938 Bacteria 1648
255 Ga0207665_10718582 3300025939 Unclassified 786
256 Ga0207665_10922585 3300025939 Unclassified 693
257 Ga0207691_10010420 3300025940 Bacteria 8920
258 Ga0207689_10240634 3300025942 Unclassified 1496
259 Ga0207661_10247339 3300025944 Bacteria 1584
260 Ga0207679_10028161 3300025945 Bacteria 3896
261 Ga0207712_10031388 3300025961 Bacteria 3578
262 Ga0207668_11938007 3300025972 Unclassified 531
263 Ga0207658_10208320 3300025986 Bacteria 1637
264 Ga0207658_10632991 3300025986 Bacteria 963
265 Ga0207708_10111171 3300026075 Bacteria 2127
266 Ga0207648_10162112 3300026089 Bacteria 1975
267 Ga0207676_10862130 3300026095 Bacteria 886
268 Ga0207674_10077473 3300026116 Bacteria 3330
269 Ga0207674_10136658 3300026116 Bacteria 2413
270 Ga0207674_10176661 3300026116 Bacteria 2088
271 Ga0207675_100080431 3300026118 Bacteria 3055
272 Ga0207675_100966186 3300026118 Unclassified 870
273 Ga0207675_102325453 3300026118 Unclassified 549
274 Ga0209973_1037540 3300027252 Unclassified 702
275 Ga0209998_10053963 3300027717 Unclassified 936
276 Ga0209974_10063727 3300027876 Unclassified 1250
277 Ga0207428_10027679 3300027907 Bacteria 4718
278 Ga0268266_10972417 3300028379 Unclassified 821
279 Ga0268265_10002690 3300028380 Bacteria 13168
280 Ga0268265_10429877 3300028380 Unclassified 1228
281 Ga0268265_11461345 3300028380 Unclassified 687
282 Ga0268264_11025269 3300028381 Unclassified 832
283 Ga0307408_100023491 3300031548 Bacteria 4200
284 Ga0307408_100695830 3300031548 Bacteria 913
285 Ga0307405_10000417 3300031731 Bacteria 16027
286 Ga0307405_10589587 3300031731 Bacteria 905
287 Ga0307413_10232707 3300031824 Bacteria 1354
288 Ga0307413_11120656 3300031824 Unclassified 681
289 Ga0307410_10001092 3300031852 Bacteria 11815
290 Ga0307410_10090950 3300031852 Bacteria 2166
291 Ga0307410_10445035 3300031852 Unclassified 1056
292 Ga0307406_10000678 3300031901 Bacteria 19268
293 Ga0307406_10364211 3300031901 Bacteria 1134
294 Ga0307407_10000248 3300031903 Bacteria 16024
295 Ga0307407_10922110 3300031903 Unclassified 671
296 Ga0307412_10009390 3300031911 Bacteria 5611
297 Ga0307412_10520082 3300031911 Unclassified 994
298 Ga0307409_100123075 3300031995 Unclassified 2201
299 Ga0307409_100252013 3300031995 Bacteria 1614
300 Ga0307409_100350456 3300031995 Bacteria 1393
301 Ga0307416_100000616 3300032002 Bacteria 18327
302 Ga0307416_100038248 3300032002 Bacteria 3701
303 Ga0307416_100224238 3300032002 Bacteria 1806
304 Ga0307416_100750209 3300032002 Bacteria 1069
305 Ga0307416_101293810 3300032002 Unclassified 835
306 Ga0307414_10018421 3300032004 Bacteria 4299
307 Ga0307414_10427777 3300032004 Bacteria 1156
308 Ga0307411_10001453 3300032005 Bacteria 9696
309 Ga0307411_10044692 3300032005 Bacteria 2844
310 Ga0307411_10211092 3300032005 Bacteria 1499
311 Ga0307411_11005043 3300032005 Unclassified 747
312 Ga0307415_100001381 3300032126 Bacteria 11577
313 Ga0307415_100225579 3300032126 Bacteria 1505
314 Ga0307415_100920272 3300032126 Unclassified 807
315 Ga0307415_102379765 3300032126 Bacteria 520
316 Ga0373926_0045767 3300035083 Bacteria 1569
317 Ga0373926_0108136 3300035083 Unclassified 1043
318 Ga0373926_0124138 3300035083 Unclassified 975
319 Ga0373934_0062800 3300035086 Bacteria 1481
320 Ga0373953_0055329 3300035117 Bacteria 1611
321 Ga0373954_0000673 3300035118 Bacteria 13097
322 Ga0373955_0043399 3300035172 Bacteria 2419
323 Ga0373935_0017799 3300035692 Bacteria 4317
324 Ga0373927_0001660 3300035695 Bacteria 16642
325 Ga0373927_0006739 3300035695 Bacteria 7818
326 Ga0373933_0021031 3300035724 Bacteria 3702
327 Ga0373947_0178402 3300035725 Unclassified 1382
328 Ga0373947_0564305 3300035725 Unclassified 775
329 Ga0373937_0055786 3300036401 Bacteria 3628
330 Ga0373937_1553971 3300036401 Unclassified 609
331 Ga0373925_0008908 3300037068 Bacteria 7310
332 Ga0373925_0581702 3300037068 Bacteria 922
333 Ga0395898_0484319 3300037466 Bacteria 1177
334 Ga0395898_0752060 3300037466 Bacteria 916
335 Ga0436364_1370430 3300037853 Bacteria 920
336 Ga0395901_0814604 3300038443 Bacteria 922
337 Ga0436360_0677902 3300039438 Unclassified 603
338 Ga0436361_1097729 3300039447 Bacteria 95612
339 Ga0451789_1141981 3300041443 Unclassified 605
340 Ga0451793_1464722 3300041452 Bacteria 533
341 Ga0439435_0065290 3300042436 Bacteria 1068
342 Ga0439460_0295680 3300042461 Bacteria 565
343 Ga0451577_0094742 3300042876 Bacteria 2666
344 Ga0451577_0421896 3300042876 Bacteria 1211
345 Ga0453683_0011486 3300044673 Bacteria 5834
346 Ga0453683_0555787 3300044673 Unclassified 747
347 Ga0453683_0616198 3300044673 Bacteria 708
348 Ga0466963_0442423 3300044694 Unclassified 917
349 Ga0451576_0183921 3300045051 Bacteria 2182
350 Ga0451576_0282240 3300045051 Bacteria 1736
351 Ga0466967_0019154 3300045976 Bacteria 5495
352 Ga0466967_0184202 3300045976 Bacteria 1971
353 Ga0495638_0036403 3300046460 Bacteria 3136
354 Ga0495651_0072809 3300046462 Bacteria 2609
355 Ga0495580_0003398 3300046472 Bacteria 13588
356 Ga0495580_0154075 3300046472 Unclassified 1592
357 Ga0495580_0190008 3300046472 Unclassified 1417
358 Ga0495580_0292450 3300046472 Unclassified 1110
359 Ga0495580_0784620 3300046472 Unclassified 619
360 Ga0495594_0140264 3300046499 Unclassified 1371
361 Ga0495608_0640092 3300046511 Unclassified 636
362 Ga0495587_0758420 3300046536 Unclassified 531
363 Ga0495667_0209975 3300046559 Bacteria 1244
364 Ga0495635_0375641 3300046663 Bacteria 946
365 Ga0495657_0567813 3300046675 Unclassified 658
366 Ga0495623_0276362 3300046679 Unclassified 936
367 Ga0495684_0029930 3300047471 Bacteria 4179
368 Ga0495684_0629735 3300047471 Unclassified 720
369 Ga0495602_0342383 3300048088 Bacteria 1081
370 Ga0501298_005306 3300049521 Bacteria 2062
371 Ga0501042_0798432 3300049578 Bacteria 687
372 Ga0501042_1021644 3300049578 Unclassified 603
373 Ga0501068_0188836 3300049584 Unclassified 1304
374 Ga0501068_0688969 3300049584 Unclassified 668
375 Ga0501235_030340 3300049669 Bacteria 1218
376 Ga0501243_026831 3300049675 Bacteria 970
377 Ga0501250_079115 3300049680 Unclassified 556
378 Ga0501255_018551 3300049684 Unclassified 880
379 Ga0501259_008240 3300049688 Bacteria 1676
380 Ga0501270_010304 3300049767 Bacteria 1228
381 Ga0501283_043619 3300049779 Unclassified 781
382 nmdc:mga05p37_15016_c1 3300050507 Bacteria 9297
383 nmdc:mga05p37_1562505_c1 3300050507 Unclassified 653
384 nmdc:mga05p37_244169_c1 3300050507 Bacteria 2157
385 nmdc:mga05p37_337421_c1 3300050507 Bacteria 1778
386 nmdc:mga05p37_355887_c1 3300050507 Bacteria 1723
387 nmdc:mga05p37_39341_c2 3300050507 Bacteria 5322
388 nmdc:mga05p37_459214_c2 3300050507 Unclassified 969
389 nmdc:mga05p37_47105_c1 3300050507 Bacteria 5302
390 nmdc:mga05p37_48396_c1 3300050507 Bacteria 5229
391 nmdc:mga05p37_634768_c1 3300050507 Bacteria 1199
392 nmdc:mga05p37_6786_c1 3300050507 Bacteria 13490
393 nmdc:mga05p37_71322_c1 3300050507 Bacteria 4273
394 nmdc:mga05p37_723310_c1 3300050507 Bacteria 1102
395 nmdc:mga05p37_81212_c1 3300050507 Bacteria 3993
396 nmdc:mga09592_1288002_c1 3300050508 Unclassified 601
397 nmdc:mga09592_166705_c1 3300050508 Bacteria 1904
398 nmdc:mga09592_218248_c1 3300050508 Bacteria 1653
399 nmdc:mga09592_342638_c1 3300050508 Unclassified 1294
400 nmdc:mga09592_538518_c1 3300050508 Bacteria 1003
401 nmdc:mga09592_634849_c1 3300050508 Bacteria 913
402 nmdc:mga09592_674804_c1 3300050508 Bacteria 881
403 nmdc:mga09592_81580_c1 3300050508 Bacteria 2756
404 nmdc:mga0qj67_167989_c1 3300050509 Bacteria 1781
405 nmdc:mga0qj67_28940_c1 3300050509 Bacteria 4301
406 nmdc:mga0qj67_332739_c1 3300050509 Bacteria 1229
407 nmdc:mga0qj67_35483_c1 3300050509 Bacteria 3899
408 nmdc:mga0qj67_44720_c1 3300050509 Bacteria 3491
409 nmdc:mga06r32_111132_c1 3300050510 Bacteria 2697
410 nmdc:mga06r32_132847_c1 3300050510 Bacteria 2462
411 nmdc:mga06r32_147111_c1 3300050510 Bacteria 2333
412 nmdc:mga06r32_1721150_c1 3300050510 Bacteria 564
413 nmdc:mga06r32_411077_c1 3300050510 Bacteria 1335
414 nmdc:mga06r32_765814_c1 3300050510 Unclassified 928
415 nmdc:mga06r32_780230_c1 3300050510 Bacteria 917
416 nmdc:mga06r32_830669_c1 3300050510 Bacteria 883
417 nmdc:mga08y16_237328_c1 3300050511 Bacteria 1885
418 nmdc:mga0n895_15064_c1 3300050512 Bacteria 7046
419 nmdc:mga0n895_625582_c1 3300050512 Bacteria 1077
420 nmdc:mga0n895_681677_c1 3300050512 Unclassified 1025
421 nmdc:mga0n895_74861_c1 3300050512 Bacteria 3364
422 nmdc:mga0n895_814333_c1 3300050512 Bacteria 924
423 nmdc:mga0n895_94998_c1 3300050512 Bacteria 2986
424 nmdc:mga0rr50_10189_c1 3300050513 Bacteria 5951
425 nmdc:mga0rr50_1107435_c1 3300050513 Unclassified 674
426 nmdc:mga0rr50_277970_c1 3300050513 Bacteria 1397
427 nmdc:mga0rr50_300072_c1 3300050513 Bacteria 1344
428 nmdc:mga0rr50_488503_c1 3300050513 Unclassified 1046
429 nmdc:mga0rr50_554106_c1 3300050513 Bacteria 979
430 nmdc:mga08x19_11403_c1 3300050514 Bacteria 5351
431 nmdc:mga0a205_114564_c1 3300050515 Bacteria 2595
432 nmdc:mga0a205_16770_c1 3300050515 Bacteria 6860
433 nmdc:mga0a205_259020_c1 3300050515 Bacteria 1617
434 nmdc:mga0a205_31365_c1 3300050515 Bacteria 5092
435 nmdc:mga0a205_562877_c1 3300050515 Unclassified 994
436 nmdc:mga0a205_746044_c1 3300050515 Unclassified 828
437 nmdc:mga0a205_79006_c1 3300050515 Unclassified 3179
438 Ga0500646_0392077 3300053090 Unclassified 512
439 Ga0501084_1678951 3300054114 Bacteria 531
440 Ga0590071_001059 3300059421 Bacteria 7449
441 Ga0590075_000123 3300059424 Bacteria 19905
442 Ga0590077_000109 3300059426 Bacteria 21950
443 Ga0501082_1508761 3300060353 Unclassified 587
444 Ga0373925_0991256
445 SwRhRL3b_contig_1413738
446 SwRhRL2b_contig_1700974
447 JGI24740J21852_10013119
448 JGI24739J22299_10019462
449 JGI24737J22298_10005357
450 JGI24735J21928_10089000
451 JGI24738J21930_10017897
452 Ga0065704_10110570
453 Ga0065704_10308146
454 Ga0065704_10451153
455 Ga0065707_10011416
456 Ga0070676_10288566
457 Ga0070676_11167477
458 Ga0070683_100325669
459 Ga0070670_100027666
460 Ga0070670_100185956
461 Ga0070670_102245241
462 Ga0070677_10038688
463 Ga0068869_100181253
464 Ga0068869_101765803
465 Ga0070682_101726763
466 Ga0070660_100193037
467 Ga0070668_100012784
468 Ga0070669_100002826
469 Ga0070669_100130986
470 Ga0070675_100553304
471 Ga0070673_101530350
472 Ga0070688_101173847
473 Ga0070659_100583789
474 Ga0070667_100210960
475 Ga0070667_100374937
476 Ga0070709_10684334
477 Ga0070714_100054855
478 Ga0070713_100000605
479 Ga0070713_100758136
480 Ga0070701_10009062
481 Ga0070701_10822310
482 Ga0070711_100003300
483 Ga0070705_101784329
484 Ga0070700_100064579
485 Ga0070694_100147694
486 Ga0070694_100901502
487 Ga0070708_100058579
488 Ga0070708_100072078
489 Ga0070708_100092654
490 Ga0070708_100214855
491 Ga0070708_100961978
492 Ga0070662_100085252
493 Ga0070662_100197405
494 Ga0068867_100139572
495 Ga0070706_100020403
496 Ga0070706_100049138
497 Ga0070706_100075207
498 Ga0070706_100275509
499 Ga0070706_100501666
500 Ga0070706_101257331
501 Ga0070706_101295568
502 Ga0070707_100000561
503 Ga0070707_100005665
504 Ga0070707_100022819
505 Ga0070707_100287207
506 Ga0070707_100447845
507 Ga0070707_100449302
508 Ga0070707_100761182
509 Ga0070707_100881464
510 Ga0070698_100116176
511 Ga0070698_100126044
512 Ga0070698_100301806
513 Ga0070698_100538179
514 Ga0070698_102018196
515 Ga0070699_100040901
516 Ga0070699_100080462
517 Ga0070699_100594731
518 Ga0070699_100733910
519 Ga0070699_101186658
520 Ga0070699_101560398
521 Ga0070679_101313639
522 Ga0070697_100002259
523 Ga0070697_100050391
524 Ga0070697_100253092
525 Ga0070672_100016504
526 Ga0070672_100305769
527 Ga0070695_100027471
528 Ga0070695_101426439
529 Ga0070696_100089983
530 Ga0070696_100488548
531 Ga0070696_100547377
532 Ga0070704_100053811
533 Ga0070664_100038318
534 Ga0068857_100014484
535 Ga0068857_100073968
536 Ga0068859_100032628
537 Ga0068864_100137654
538 Ga0068861_100242370
539 Ga0068851_10715013
540 Ga0068870_10009111
541 Ga0068870_10163272
542 Ga0068860_100447616
543 Ga0068860_100709150
544 Ga0068860_100915570
545 Ga0068862_100003736
546 Ga0068862_100131342
547 Ga0068862_101849516
548 Ga0081455_10078689
549 Ga0081455_10100112
550 Ga0081538_10001519
551 Ga0081538_10006724
552 Ga0081538_10017184
553 Ga0081538_10031873
554 Ga0070717_10173266
555 Ga0070717_10934405
556 Ga0075432_10017643
557 Ga0070716_100562794
558 Ga0070716_100746783
559 Ga0070716_101117546
560 Ga0070712_100007707
561 Ga0075427_10020377
562 Ga0097621_102093600
563 Ga0075428_100045657
564 Ga0075428_100501171
565 Ga0075428_100532149
566 Ga0075428_100538992
567 Ga0075428_100674129
568 Ga0075428_101270411
569 Ga0075428_101801118
570 Ga0075428_102422939
571 Ga0075428_102422940
572 Ga0075430_100002680
573 Ga0075430_100033393
574 Ga0075430_100035876
575 Ga0075430_100113546
576 Ga0075431_100191936
577 Ga0075431_100330363
578 Ga0075431_100388096
579 Ga0075431_100429972
580 Ga0075431_100549463
581 Ga0075431_100845621
582 Ga0075431_101212412
583 Ga0075431_101833345
584 Ga0075433_10007197
585 Ga0075433_10020809
586 Ga0075433_10046353
587 Ga0075433_10048992
588 Ga0075433_10119880
589 Ga0075433_10204986
590 Ga0075433_10653065
591 Ga0075433_11168885
592 Ga0075433_11614502
593 Ga0075434_100032985
594 Ga0075434_100043193
595 Ga0075434_100135347
596 Ga0075434_100365762
597 Ga0075434_100637801
598 Ga0075434_100643830
599 Ga0075434_102507557
600 Ga0075429_100008200
601 Ga0075429_100073644
602 Ga0075429_100185080
603 Ga0075429_100768432
604 Ga0075429_100787733
605 Ga0075429_101042117
606 Ga0068865_100155847
607 Ga0068865_102072210
608 Ga0075436_100037362
609 Ga0097620_100032630
610 Ga0075435_100032120
611 Ga0075435_100034677
612 Ga0075435_100174000
613 Ga0075435_100178444
614 Ga0075435_100223586
615 Ga0075435_100941015
616 Ga0099794_10471898
617 Ga0111539_10073734
618 Ga0111539_10263737
619 Ga0111539_11277534
620 Ga0111539_13019841
621 Ga0105245_10649726
622 Ga0105245_11509709
623 Ga0114129_10001858
624 Ga0114129_10032627
625 Ga0114129_10033854
626 Ga0114129_10048357
627 Ga0114129_10056198
628 Ga0114129_10056362
629 Ga0114129_10065657
630 Ga0114129_10084554
631 Ga0114129_10116877
632 Ga0114129_10118533
633 Ga0114129_10137341
634 Ga0114129_10197829
635 Ga0114129_10243727
636 Ga0114129_10339480
637 Ga0114129_10531783
638 Ga0114129_10848557
639 Ga0114129_10984937
640 Ga0114129_11009887
641 Ga0114129_11071530
642 Ga0105238_10900504
643 Ga0105249_10213859
644 Ga0105239_10255228
645 Ga0105246_10668325
646 Ga0157369_11865434
647 Ga0157374_10161957
648 Ga0163162_10059786
649 Ga0157372_10055226
650 Ga0157375_10146685
651 Ga0157375_10327306
652 Ga0157375_12352373
653 Ga0163163_10354326
654 Ga0157380_10010539
655 Ga0157380_10032889
656 Ga0157380_11161996
657 Ga0157380_11805743
658 Ga0157377_10885017
659 Ga0157379_12049423
660 Ga0157376_12119039
661 Ga0163161_10207547
662 Ga0213872_10001214
663 Ga0207682_10019923
664 Ga0207647_10019594
665 Ga0207699_11215177
666 Ga0207643_10010456
667 Ga0207643_10206606
668 Ga0207643_10705658
669 Ga0207684_10055259
670 Ga0207684_10175982
671 Ga0207684_10833799
672 Ga0207684_11530748
673 Ga0207693_10046855
674 Ga0207693_10964317
675 Ga0207663_10260593
676 Ga0207662_10376801
677 Ga0207657_11238473
678 Ga0207646_10000267
679 Ga0207646_10000519
680 Ga0207646_10017748
681 Ga0207646_10144502
682 Ga0207646_10514346
683 Ga0207646_10695188
684 Ga0207646_10788382
685 Ga0207681_11098232
686 Ga0207650_10142842
687 Ga0207650_11854897
688 Ga0207659_10016712
689 Ga0207687_10513530
690 Ga0207687_11172444
691 Ga0207700_10003852
692 Ga0207664_10011171
693 Ga0207644_10306771
694 Ga0207706_10081865
695 Ga0207706_10651788
696 Ga0207709_10396706
697 Ga0207704_10149065
698 Ga0207665_10718582
699 Ga0207665_10922585
700 Ga0207691_10010420
701 Ga0207689_10240634
702 Ga0207661_10247339
703 Ga0207679_10028161
704 Ga0207712_10031388
705 Ga0207668_11938007
706 Ga0207658_10208320
707 Ga0207658_10632991
708 Ga0207708_10111171
709 Ga0207648_10162112
710 Ga0207676_10862130
711 Ga0207674_10077473
712 Ga0207674_10136658
713 Ga0207674_10176661
714 Ga0207675_100080431
715 Ga0207675_100966186
716 Ga0207675_102325453
717 Ga0209973_1037540
718 Ga0209998_10053963
719 Ga0209974_10063727
720 Ga0207428_10027679
721 Ga0268266_10972417
722 Ga0268265_10002690
723 Ga0268265_10429877
724 Ga0268265_11461345
725 Ga0268264_11025269
726 Ga0307408_100023491
727 Ga0307408_100695830
728 Ga0307405_10000417
729 Ga0307405_10589587
730 Ga0307413_10232707
731 Ga0307413_11120656
732 Ga0307410_10001092
733 Ga0307410_10090950
734 Ga0307410_10445035
735 Ga0307406_10000678
736 Ga0307406_10364211
737 Ga0307407_10000248
738 Ga0307407_10922110
739 Ga0307412_10009390
740 Ga0307412_10520082
741 Ga0307409_100123075
742 Ga0307409_100252013
743 Ga0307409_100350456
744 Ga0307416_100000616
745 Ga0307416_100038248
746 Ga0307416_100224238
747 Ga0307416_100750209
748 Ga0307416_101293810
749 Ga0307414_10018421
750 Ga0307414_10427777
751 Ga0307411_10001453
752 Ga0307411_10044692
753 Ga0307411_10211092
754 Ga0307411_11005043
755 Ga0307415_100001381
756 Ga0307415_100225579
757 Ga0307415_100920272
758 Ga0307415_102379765
759 Ga0373926_0045767
760 Ga0373926_0108136
761 Ga0373926_0124138
762 Ga0373934_0062800
763 Ga0373953_0055329
764 Ga0373954_0000673
765 Ga0373955_0043399
766 Ga0373935_0017799
767 Ga0373927_0001660
768 Ga0373927_0006739
769 Ga0373933_0021031
770 Ga0373947_0178402
771 Ga0373947_0564305
772 Ga0373937_0055786
773 Ga0373937_1553971
774 Ga0373925_0008908
775 Ga0373925_0581702
776 Ga0395898_0484319
777 Ga0395898_0752060
778 Ga0436364_1370430
779 Ga0395901_0814604
780 Ga0436360_0677902
781 Ga0436361_1097729
782 Ga0451789_1141981
783 Ga0451793_1464722
784 Ga0439435_0065290
785 Ga0439460_0295680
786 Ga0451577_0094742
787 Ga0451577_0421896
788 Ga0453683_0011486
789 Ga0453683_0555787
790 Ga0453683_0616198
791 Ga0466963_0442423
792 Ga0451576_0183921
793 Ga0451576_0282240
794 Ga0466967_0019154
795 Ga0466967_0184202
796 Ga0495638_0036403
797 Ga0495651_0072809
798 Ga0495580_0003398
799 Ga0495580_0154075
800 Ga0495580_0190008
801 Ga0495580_0292450
802 Ga0495580_0784620
803 Ga0495594_0140264
804 Ga0495608_0640092
805 Ga0495587_0758420
806 Ga0495667_0209975
807 Ga0495635_0375641
808 Ga0495657_0567813
809 Ga0495623_0276362
810 Ga0495684_0029930
811 Ga0495684_0629735
812 Ga0495602_0342383
813 Ga0501298_005306
814 Ga0501042_0798432
815 Ga0501042_1021644
816 Ga0501068_0188836
817 Ga0501068_0688969
818 Ga0501235_030340
819 Ga0501243_026831
820 Ga0501250_079115
821 Ga0501255_018551
822 Ga0501259_008240
823 Ga0501270_010304
824 Ga0501283_043619
825 nmdc:mga05p37_15016_c1
826 nmdc:mga05p37_1562505_c1
827 nmdc:mga05p37_244169_c1
828 nmdc:mga05p37_337421_c1
829 nmdc:mga05p37_355887_c1
830 nmdc:mga05p37_39341_c2
831 nmdc:mga05p37_459214_c2
832 nmdc:mga05p37_47105_c1
833 nmdc:mga05p37_48396_c1
834 nmdc:mga05p37_634768_c1
835 nmdc:mga05p37_6786_c1
836 nmdc:mga05p37_71322_c1
837 nmdc:mga05p37_723310_c1
838 nmdc:mga05p37_81212_c1
839 nmdc:mga09592_1288002_c1
840 nmdc:mga09592_166705_c1
841 nmdc:mga09592_218248_c1
842 nmdc:mga09592_342638_c1
843 nmdc:mga09592_538518_c1
844 nmdc:mga09592_634849_c1
845 nmdc:mga09592_674804_c1
846 nmdc:mga09592_81580_c1
847 nmdc:mga0qj67_167989_c1
848 nmdc:mga0qj67_28940_c1
849 nmdc:mga0qj67_332739_c1
850 nmdc:mga0qj67_35483_c1
851 nmdc:mga0qj67_44720_c1
852 nmdc:mga06r32_111132_c1
853 nmdc:mga06r32_132847_c1
854 nmdc:mga06r32_147111_c1
855 nmdc:mga06r32_1721150_c1
856 nmdc:mga06r32_411077_c1
857 nmdc:mga06r32_765814_c1
858 nmdc:mga06r32_780230_c1
859 nmdc:mga06r32_830669_c1
860 nmdc:mga08y16_237328_c1
861 nmdc:mga0n895_15064_c1
862 nmdc:mga0n895_625582_c1
863 nmdc:mga0n895_681677_c1
864 nmdc:mga0n895_74861_c1
865 nmdc:mga0n895_814333_c1
866 nmdc:mga0n895_94998_c1
867 nmdc:mga0rr50_10189_c1
868 nmdc:mga0rr50_1107435_c1
869 nmdc:mga0rr50_277970_c1
870 nmdc:mga0rr50_300072_c1
871 nmdc:mga0rr50_488503_c1
872 nmdc:mga0rr50_554106_c1
873 nmdc:mga08x19_11403_c1
874 nmdc:mga0a205_114564_c1
875 nmdc:mga0a205_16770_c1
876 nmdc:mga0a205_259020_c1
877 nmdc:mga0a205_31365_c1
878 nmdc:mga0a205_562877_c1
879 nmdc:mga0a205_746044_c1
880 nmdc:mga0a205_79006_c1
881 Ga0500646_0392077
882 Ga0501084_1678951
883 Ga0590071_001059
884 Ga0590075_000123
885 Ga0590077_000109
886 Ga0501082_1508761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02313

Fumarate_red_D

Fumarate reductase subunit D

22

135

0.94

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

16

134

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cir-assembly1.cif.gz_D e. coli quinol fumarate reductase frda t234a mutation 0.8171 6 111
3cir-assembly1.cif.gz_D e. coli quinol fumarate reductase frda t234a mutation 0.7772 6 111
6lum-assembly1.cif.gz_N structure of mycobacterium smegmatis succinate dehydrogenase 2 0.7574 8 111
2b76-assembly2.cif.gz_P e. coli quinol fumarate reductase frda e49q mutation 0.7469 2 111
2b76-assembly2.cif.gz_P e. coli quinol fumarate reductase frda e49q mutation 0.7353 2 111
ID Description Score Start End Superfamily
af_P9WNB5_8_125_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.896 2 111 1.20.1300.10
af_P9WNB5_8_125_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8811 2 111 1.20.1300.10
af_P0A8Q3_1_119_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8436 6 111 1.20.1300.10
2b76D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8346 6 111 1.20.1300.10
1fumD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8302 6 111 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A7Z9W6B5-F1-model_v4 Fumarate reductase subunit D 0.9933 53 111 GO:0005886
GO:0006106
AF-A0A7Z9T022-F1-model_v4 Fumarate reductase subunit D 0.9905 46 111 GO:0005886
GO:0006106
AF-A0A7Y4U5V7-F1-model_v4 Fumarate reductase subunit D 0.9386 1 111 GO:0005886
GO:0006106
AF-A0A7Z9W6B5-F1-model_v4 Fumarate reductase subunit D 0.9309 53 111 GO:0005886
GO:0006106
AF-A0A7Y4U5V7-F1-model_v4 Fumarate reductase subunit D 0.9306 1 111 GO:0005886
GO:0006106

Map