F445087

General Info

Members Datasets Scaffolds Average Seq Length
443 259 412 413

Family's Representative Sequence

Representative Sequence 3300025295|Ga0209564_1003913|Ga0209564_10039136
Length 468
Sequence MDEAEFVGHKGRNDLRGGGRAESLPFPSAAAATTNRSGPRPRGEPMNRRFAFLIIAAMVLGILVGWVCNQYLDPAQTAEAVKWFKMGTDLFLRLIKMIIAPLVFTTLVAGIAHMEDAAAVGRIGAKTMGWFISASAVSLLLGLLMVHLLHPGAGLVLNEATSAAANAPAASTETFTLQGFLTHLVPTSIFDAMAKNEILQIVVFSLFVGTAVASLDNKAPHILELAEQGAQIMLKVTGFVMKLAPLAIFCALASTIAAQGLSMLAVYGKFVLGFYATMGTLWLLLFIAAFLVLGKRAVPLFGTIREPALLAFSTASSEAAYPRILDALPKLGIRRRIVSFVLPLGYSFNLDGSMLYCTFATVFILQAHGVHLSIQQQIFMLLLLMVTSKGIAGVPRASLVVIMATLTYFGLPETWIALVLGVDHLLDMGRSATNVVGNSVAAAVVAKWEGELDDPEPDVAAEAEAAKA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2851153111 Caulobacter radicis 736 Isolate Unclassified
22 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
23 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
24 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
25 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
26 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
33 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
36 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
37 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
38 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
233 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
259 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93
Metatranscriptomes 0
Isolates 7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 0
Rhizoplane 2.71
Rhizosphere 67.27
Stem 0
Stem Tuber 0
Unclassified 12.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000037 3300001904 Bacteria 22185
2 JGI24740J21852_10012740 3300001979 Bacteria 3161
3 JGI24739J22299_10003077 3300001989 Bacteria 6367
4 JGI24737J22298_10007624 3300001990 Bacteria 3645
5 JGI24735J21928_10007565 3300002067 Bacteria 3541
6 JGI24750J21931_1000681 3300002070 Bacteria 4943
7 JGI24748J21848_1000015 3300002074 Bacteria 143883
8 JGI24738J21930_10000334 3300002075 Bacteria 12870
9 JGI24749J21850_1000240 3300002076 Bacteria 8545
10 JGI24034J26672_10000006 3300002239 Bacteria 294495
11 JGI24742J22300_10001113 3300002244 Bacteria 4164
12 JGI24751J29686_10000135 3300002459 Bacteria 37169
13 JGI25153J46596_10034394 3300003215 Bacteria 1657
14 Ga0055537_1001888 3300003773 Bacteria 7521
15 Ga0055524_1012190 3300003775 Bacteria 3314
16 Ga0055524_1017739 3300003775 Bacteria 2498
17 Ga0055528_1009909 3300003790 Bacteria 3933
18 Ga0055530_10002060 3300003791 Bacteria 13517
19 Ga0055531_10000930 3300003794 Bacteria 23675
20 Ga0055531_10001767 3300003794 Bacteria 15393
21 Ga0065165_1001513 3300005262 Bacteria 24537
22 Ga0065165_1006815 3300005262 Bacteria 5828
23 Ga0065707_10083538 3300005295 Bacteria 8829
24 Ga0070658_10000708 3300005327 Bacteria 28835
25 Ga0070658_10021907 3300005327 Bacteria 5125
26 Ga0070658_10057143 3300005327 Bacteria 3173
27 Ga0070658_10073661 3300005327 Bacteria 2801
28 Ga0070690_100000074 3300005330 Bacteria 48493
29 Ga0070670_100000090 3300005331 Bacteria 86222
30 Ga0068869_100037418 3300005334 Bacteria 3450
31 Ga0070666_10000014 3300005335 Bacteria 224479
32 Ga0068868_100138717 3300005338 Bacteria 1995
33 Ga0070660_100052011 3300005339 Bacteria 3156
34 Ga0070661_100037056 3300005344 Bacteria 3547
35 Ga0070668_100001179 3300005347 Bacteria 18500
36 Ga0070669_100000093 3300005353 Bacteria 87563
37 Ga0070669_100000304 3300005353 Bacteria 38742
38 Ga0070669_100002305 3300005353 Bacteria 13824
39 Ga0070671_100002815 3300005355 Bacteria 13518
40 Ga0070688_100010173 3300005365 Bacteria 5177
41 Ga0070659_100058404 3300005366 Bacteria 3044
42 Ga0070659_100108718 3300005366 Bacteria 2237
43 Ga0070667_100001444 3300005367 Bacteria 21298
44 Ga0070667_100022770 3300005367 Bacteria 5195
45 Ga0070667_100045508 3300005367 Bacteria 3690
46 Ga0070662_100028593 3300005457 Bacteria 3881
47 Ga0070681_10007565 3300005458 Bacteria 10617
48 Ga0070679_100014656 3300005530 Bacteria 7534
49 Ga0068853_100004158 3300005539 Bacteria 11155
50 Ga0068853_100010230 3300005539 Bacteria 7585
51 Ga0068853_100100521 3300005539 Bacteria 2557
52 Ga0068853_100186988 3300005539 Bacteria 1881
53 Ga0068853_100348593 3300005539 Bacteria 1377
54 Ga0070686_100000002 3300005544 Bacteria 336303
55 Ga0070665_100000025 3300005548 Bacteria 367488
56 Ga0070665_100002155 3300005548 Bacteria 21958
57 Ga0070665_100026184 3300005548 Bacteria 5873
58 Ga0068855_100007416 3300005563 Bacteria 13279
59 Ga0068855_100010626 3300005563 Bacteria 11098
60 Ga0068855_100011377 3300005563 Bacteria 10744
61 Ga0068855_100029762 3300005563 Bacteria 6529
62 Ga0068854_100000843 3300005578 Bacteria 18349
63 Ga0068856_100208743 3300005614 Bacteria 1968
64 Ga0068856_100382966 3300005614 Bacteria 1426
65 Ga0068852_100000337 3300005616 Bacteria 31862
66 Ga0068859_100001618 3300005617 Bacteria 23030
67 Ga0068859_100009705 3300005617 Bacteria 9718
68 Ga0068859_100013233 3300005617 Bacteria 8278
69 Ga0068864_100000067 3300005618 Bacteria 115834
70 Ga0068864_100000127 3300005618 Bacteria 74135
71 Ga0068864_100002381 3300005618 Bacteria 15540
72 Ga0068864_100011026 3300005618 Bacteria 7471
73 Ga0068861_100001742 3300005719 Bacteria 13972
74 Ga0068861_100036270 3300005719 Bacteria 3658
75 Ga0068863_100000237 3300005841 Bacteria 58657
76 Ga0068863_100000541 3300005841 Bacteria 38515
77 Ga0068863_100015575 3300005841 Bacteria 7306
78 Ga0068858_100000020 3300005842 Bacteria 175896
79 Ga0068858_100002657 3300005842 Bacteria 17987
80 Ga0068858_100023998 3300005842 Bacteria 5682
81 Ga0068860_100000001 3300005843 Bacteria 703043
82 Ga0068860_100000027 3300005843 Bacteria 267207
83 Ga0068860_100023882 3300005843 Bacteria 5910
84 Ga0068862_100000048 3300005844 Bacteria 150043
85 Ga0068862_100000126 3300005844 Bacteria 89210
86 Ga0068862_100017037 3300005844 Bacteria 6045
87 Ga0068862_100144412 3300005844 Bacteria 2114
88 Ga0070717_10076777 3300006028 Bacteria 2796
89 Ga0075368_10004849 3300006042 Bacteria 4586
90 Ga0075364_10000499 3300006051 Bacteria 19964
91 Ga0075369_10018205 3300006186 Bacteria 2858
92 Ga0075369_10074201 3300006186 Bacteria 1500
93 Ga0075366_10032544 3300006195 Bacteria 3069
94 Ga0068865_100009151 3300006881 Bacteria 6129
95 Ga0097620_100001618 3300006931 Bacteria 23030
96 Ga0097620_100009706 3300006931 Bacteria 9718
97 Ga0097620_100013233 3300006931 Bacteria 8278
98 Ga0105251_10000241 3300009011 Bacteria 54940
99 Ga0105250_10007725 3300009092 Bacteria 4608
100 Ga0105240_10000156 3300009093 Bacteria 139950
101 Ga0105240_10004673 3300009093 Bacteria 20699
102 Ga0105247_10055785 3300009101 Bacteria 2438
103 Ga0105242_10121033 3300009176 Bacteria 2246
104 Ga0105248_10000155 3300009177 Bacteria 79121
105 Ga0105248_10000454 3300009177 Bacteria 46692
106 Ga0105248_10004217 3300009177 Bacteria 15903
107 Ga0105248_10008368 3300009177 Bacteria 11362
108 Ga0105248_10010014 3300009177 Bacteria 10436
109 Ga0105237_10001457 3300009545 Bacteria 31207
110 Ga0105237_10408949 3300009545 Bacteria 1362
111 Ga0105238_10007800 3300009551 Bacteria 10707
112 Ga0105249_10000005 3300009553 Bacteria 362467
113 Ga0105249_10003389 3300009553 Bacteria 13802
114 Ga0105239_10001406 3300010375 Bacteria 32187
115 Ga0105239_10197671 3300010375 Bacteria 2252
116 Ga0105239_10202515 3300010375 Bacteria 2224
117 Ga0157371_10001910 3300013102 Bacteria 20840
118 Ga0157370_10160109 3300013104 Bacteria 2095
119 Ga0157369_10018155 3300013105 Bacteria 7890
120 Ga0157369_10040454 3300013105 Bacteria 5088
121 Ga0157369_10145843 3300013105 Bacteria 2503
122 Ga0163162_10090598 3300013306 Bacteria 3140
123 Ga0157372_10089995 3300013307 Bacteria 3488
124 Ga0163163_10004271 3300014325 Bacteria 12174
125 Ga0163163_10021751 3300014325 Bacteria 6058
126 Ga0157380_10000137 3300014326 Bacteria 40923
127 Ga0157380_10000223 3300014326 Bacteria 33890
128 Ga0157379_10001771 3300014968 Bacteria 17815
129 Ga0157379_10003874 3300014968 Bacteria 12752
130 Ga0163161_10000559 3300017792 Bacteria 29995
131 Ga0213876_10010428 3300021384 Bacteria 4987
132 Ga0207672_1001347 3300025223 Bacteria 1964
133 Ga0209565_1000179 3300025263 Bacteria 79300
134 Ga0209673_1001240 3300025273 Bacteria 26584
135 Ga0209675_1014925 3300025291 Bacteria 2336
136 Ga0209676_1000253 3300025292 Bacteria 113412
137 Ga0209564_1003913 3300025295 Bacteria 9537
138 Ga0209758_1000894 3300025297 Bacteria 40579
139 Ga0209050_1000173 3300025298 Bacteria 149800
140 Ga0209050_1000649 3300025298 Bacteria 53856
141 Ga0209050_1001834 3300025298 Bacteria 20662
142 Ga0209256_1005813 3300025299 Bacteria 6875
143 Ga0209256_1010954 3300025299 Bacteria 3710
144 Ga0209256_1023109 3300025299 Bacteria 1863
145 Ga0209051_1002693 3300025303 Bacteria 12365
146 Ga0209257_1000196 3300025304 Bacteria 149656
147 Ga0209257_1000364 3300025304 Bacteria 91820
148 Ga0209257_1001017 3300025304 Bacteria 37734
149 Ga0209257_1002949 3300025304 Bacteria 15613
150 Ga0207696_1013327 3300025711 Bacteria 2870
151 Ga0207713_1029629 3300025735 Bacteria 2448
152 Ga0207680_10000004 3300025903 Bacteria 827324
153 Ga0207647_10000038 3300025904 Bacteria 94897
154 Ga0207647_10045722 3300025904 Bacteria 2730
155 Ga0207705_10000157 3300025909 Bacteria 73563
156 Ga0207705_10001784 3300025909 Bacteria 16963
157 Ga0207654_10024848 3300025911 Bacteria 3226
158 Ga0207695_10000250 3300025913 Bacteria 139984
159 Ga0207695_10001288 3300025913 Bacteria 42577
160 Ga0207695_10002305 3300025913 Bacteria 28454
161 Ga0207695_10003077 3300025913 Bacteria 23893
162 Ga0207695_10053728 3300025913 Bacteria 4210
163 Ga0207671_10001429 3300025914 Bacteria 27685
164 Ga0207671_10003755 3300025914 Bacteria 14950
165 Ga0207660_10000681 3300025917 Bacteria 22727
166 Ga0207660_10035160 3300025917 Bacteria 3476
167 Ga0207660_10049656 3300025917 Bacteria 2976
168 Ga0207657_10001673 3300025919 Bacteria 23919
169 Ga0207657_10110429 3300025919 Bacteria 2271
170 Ga0207652_10004669 3300025921 Bacteria 11109
171 Ga0207652_10042913 3300025921 Bacteria 3850
172 Ga0207681_10000005 3300025923 Bacteria 555724
173 Ga0207681_10000152 3300025923 Bacteria 57600
174 Ga0207681_10001688 3300025923 Bacteria 14203
175 Ga0207694_10005393 3300025924 Bacteria 9841
176 Ga0207694_10071428 3300025924 Bacteria 2712
177 Ga0207650_10000004 3300025925 Bacteria 743372
178 Ga0207650_10000452 3300025925 Bacteria 34879
179 Ga0207650_10050044 3300025925 Bacteria 3088
180 Ga0207650_10060470 3300025925 Bacteria 2827
181 Ga0207644_10000956 3300025931 Bacteria 18437
182 Ga0207644_10016847 3300025931 Bacteria 4923
183 Ga0207690_10000116 3300025932 Bacteria 65776
184 Ga0207706_10051090 3300025933 Bacteria 3651
185 Ga0207686_10230260 3300025934 Bacteria 1343
186 Ga0207670_10010762 3300025936 Bacteria 5281
187 Ga0207711_10000017 3300025941 Bacteria 441730
188 Ga0207711_10000464 3300025941 Bacteria 42035
189 Ga0207711_10001118 3300025941 Bacteria 25658
190 Ga0207711_10001710 3300025941 Bacteria 20197
191 Ga0207711_10021499 3300025941 Bacteria 5390
192 Ga0207667_10000006 3300025949 Bacteria 679876
193 Ga0207667_10000091 3300025949 Bacteria 148651
194 Ga0207667_10005755 3300025949 Bacteria 15129
195 Ga0207667_10041526 3300025949 Bacteria 4892
196 Ga0207667_10094032 3300025949 Bacteria 3095
197 Ga0207667_10101163 3300025949 Bacteria 2973
198 Ga0207712_10000001 3300025961 Bacteria 750309
199 Ga0207712_10000113 3300025961 Bacteria 88030
200 Ga0207640_10000766 3300025981 Bacteria 18386
201 Ga0207658_10000119 3300025986 Bacteria 86779
202 Ga0207658_10000483 3300025986 Bacteria 36812
203 Ga0207658_10000907 3300025986 Bacteria 24619
204 Ga0207658_10076185 3300025986 Bacteria 2554
205 Ga0207677_10066126 3300026023 Bacteria 2526
206 Ga0207703_10000082 3300026035 Bacteria 110579
207 Ga0207703_10003897 3300026035 Bacteria 12390
208 Ga0207639_10000185 3300026041 Bacteria 48694
209 Ga0207639_10026976 3300026041 Bacteria 4179
210 Ga0207678_10007379 3300026067 Bacteria 9732
211 Ga0207678_10037093 3300026067 Bacteria 4241
212 Ga0207702_10332321 3300026078 Bacteria 1450
213 Ga0207641_10000007 3300026088 Bacteria 441443
214 Ga0207641_10000008 3300026088 Bacteria 424415
215 Ga0207641_10000033 3300026088 Bacteria 219261
216 Ga0207641_10014295 3300026088 Bacteria 6504
217 Ga0207648_10168795 3300026089 Bacteria 1934
218 Ga0207676_10000006 3300026095 Bacteria 681936
219 Ga0207676_10000019 3300026095 Bacteria 305653
220 Ga0207676_10002060 3300026095 Bacteria 14590
221 Ga0207676_10005298 3300026095 Bacteria 9134
222 Ga0207674_10009512 3300026116 Bacteria 11097
223 Ga0207675_100000171 3300026118 Bacteria 58198
224 Ga0207675_100000385 3300026118 Bacteria 42428
225 Ga0207675_100033773 3300026118 Bacteria 4767
226 Ga0207698_10000333 3300026142 Bacteria 27984
227 Ga0209981_1000450 3300027378 Bacteria 5205
228 Ga0268266_10000003 3300028379 Bacteria 1701703
229 Ga0268266_10000028 3300028379 Bacteria 425294
230 Ga0268266_10009290 3300028379 Bacteria 8674
231 Ga0268266_10066004 3300028379 Bacteria 3129
232 Ga0268266_10105644 3300028379 Bacteria 2488
233 Ga0268265_10000001 3300028380 Bacteria 1230727
234 Ga0268265_10000011 3300028380 Bacteria 343832
235 Ga0268265_10000071 3300028380 Bacteria 132890
236 Ga0268265_10004520 3300028380 Bacteria 9629
237 Ga0268265_10031272 3300028380 Bacteria 3843
238 Ga0268264_10000006 3300028381 Bacteria 827324
239 Ga0268264_10000181 3300028381 Bacteria 134092
240 Ga0268264_10011436 3300028381 Bacteria 7330
241 Ga0307517_10003203 3300028786 Bacteria 25702
242 Ga0307517_10070948 3300028786 Bacteria 3130
243 Ga0307515_10076827 3300028794 Bacteria 4421
244 Ga0307515_10085750 3300028794 Bacteria 4025
245 Ga0307515_10097211 3300028794 Bacteria 3601
246 Ga0307515_10167003 3300028794 Bacteria 2213
247 Ga0265338_10050438 3300028800 Bacteria 3762
248 Ga0265327_10000287 3300031251 Bacteria 99268
249 Ga0265327_10002320 3300031251 Bacteria 20341
250 Ga0307513_10000077 3300031456 Bacteria 134167
251 Ga0307513_10003660 3300031456 Bacteria 20800
252 Ga0307513_10007104 3300031456 Bacteria 14560
253 Ga0307513_10018914 3300031456 Bacteria 8213
254 Ga0307516_10000030 3300031730 Bacteria 159694
255 Ga0307413_10032906 3300031824 Bacteria 2945
256 Ga0307410_10111005 3300031852 Bacteria 1984
257 Ga0307406_10138352 3300031901 Bacteria 1720
258 Ga0307414_10000202 3300032004 Bacteria 40091
259 Ga0307414_10049900 3300032004 Bacteria 2896
260 Ga0307510_10043919 3300033180 Bacteria 4849
261 Ga0307510_10069742 3300033180 Bacteria 3518
262 Ga0373960_0009148 3300035121 Bacteria 2392
263 Ga0373946_0048624 3300035171 Bacteria 1766
264 Ga0373961_0020618 3300035241 Bacteria 1745
265 Ga0373931_0001350 3300035691 Bacteria 10502
266 Ga0373927_0000831 3300035695 Bacteria 23649
267 Ga0373925_0000984 3300037068 Bacteria 25954
268 Ga0395899_0000486 3300037312 Bacteria 44413
269 Ga0395900_0000008 3300037418 Bacteria 480459
270 Ga0395900_0026680 3300037418 Bacteria 5914
271 Ga0395900_0152018 3300037418 Bacteria 2364
272 Ga0395898_0020955 3300037466 Bacteria 6632
273 Ga0395905_0003251 3300037471 Bacteria 17474
274 Ga0395905_0011963 3300037471 Bacteria 8366
275 Ga0436364_0062945 3300037853 Bacteria 5623
276 Ga0395901_0000008 3300038443 Bacteria 495962
277 Ga0436365_1127900 3300039437 Bacteria 5066
278 Ga0439445_0037414 3300042004 Bacteria 1280
279 Ga0439435_0007160 3300042436 Bacteria 2538
280 Ga0453684_0295664 3300044712 Bacteria 1842
281 Ga0495627_000511 3300046453 Bacteria 32184
282 Ga0495629_0022694 3300046459 Bacteria 4473
283 Ga0495638_0001235 3300046460 Bacteria 24108
284 Ga0495638_0003577 3300046460 Bacteria 12168
285 Ga0495638_0007109 3300046460 Bacteria 8072
286 Ga0495638_0009533 3300046460 Bacteria 6805
287 Ga0495638_0026395 3300046460 Bacteria 3763
288 Ga0495638_0053557 3300046460 Bacteria 2511
289 Ga0495650_0000024 3300046471 Bacteria 496674
290 Ga0495583_0000025 3300046506 Bacteria 263775
291 Ga0495606_0006495 3300046507 Bacteria 10756
292 Ga0495610_0000478 3300046512 Bacteria 41250
293 Ga0495610_0004119 3300046512 Bacteria 10879
294 Ga0495610_0009039 3300046512 Bacteria 6356
295 Ga0495616_0005214 3300046513 Bacteria 8035
296 Ga0495620_0023949 3300046515 Bacteria 2910
297 Ga0495631_0081894 3300046518 Bacteria 1392
298 Ga0495632_0004458 3300046519 Bacteria 9510
299 Ga0495637_0010312 3300046520 Bacteria 4526
300 Ga0495637_0018260 3300046520 Bacteria 3256
301 Ga0495648_0000634 3300046524 Bacteria 37553
302 Ga0495648_0041139 3300046524 Bacteria 2922
303 Ga0495648_0054033 3300046524 Bacteria 2429
304 Ga0495642_0012414 3300046528 Bacteria 3284
305 Ga0495654_0000135 3300046530 Bacteria 77516
306 Ga0495609_0005335 3300046538 Bacteria 6787
307 Ga0495597_0002511 3300046542 Bacteria 11530
308 Ga0495622_0009313 3300046557 Bacteria 4544
309 Ga0495668_0000291 3300046616 Bacteria 68802
310 Ga0495668_0005699 3300046616 Bacteria 8337
311 Ga0495668_0010898 3300046616 Bacteria 5474
312 Ga0495668_0014658 3300046616 Bacteria 4591
313 Ga0495625_0002176 3300046660 Bacteria 21762
314 Ga0495625_0042930 3300046660 Bacteria 3282
315 Ga0495625_0057973 3300046660 Bacteria 2752
316 Ga0495625_0157772 3300046660 Bacteria 1522
317 Ga0495659_0034172 3300046664 Bacteria 1787
318 Ga0495669_0000044 3300046684 Bacteria 85633
319 Ga0495669_0070251 3300046684 Bacteria 1594
320 Ga0495589_0012780 3300046794 Bacteria 4341
321 Ga0495660_0025068 3300046810 Bacteria 3390
322 Ga0495672_0001086 3300047320 Bacteria 27612
323 Ga0495683_0052985 3300047323 Bacteria 2024
324 Ga0495673_0000939 3300047469 Bacteria 26438
325 Ga0495673_0001300 3300047469 Bacteria 20332
326 Ga0495681_0020989 3300047470 Bacteria 3529
327 Ga0495686_0005596 3300047472 Bacteria 9871
328 Ga0495686_0005965 3300047472 Bacteria 9483
329 Ga0495686_0012613 3300047472 Bacteria 5906
330 Ga0495686_0029654 3300047472 Bacteria 3558
331 Ga0495686_0079000 3300047472 Bacteria 2012
332 Ga0496102_0000043 3300048905 Bacteria 189201
333 Ga0496103_0000086 3300048906 Bacteria 104765
334 Ga0496103_0009518 3300048906 Bacteria 5752
335 Ga0496106_0037873 3300048909 Bacteria 3608
336 Ga0496106_0071775 3300048909 Bacteria 2647
337 Ga0496107_0000028 3300048910 Bacteria 105641
338 Ga0496107_0148462 3300048910 Bacteria 1734
339 Ga0496112_0014185 3300048915 Bacteria 7385
340 Ga0496113_0089474 3300048916 Bacteria 2370
341 Ga0496115_0001111 3300048918 Bacteria 19439
342 Ga0496115_0001701 3300048918 Bacteria 15773
343 Ga0496115_0002063 3300048918 Bacteria 14389
344 Ga0496116_0001293 3300048919 Bacteria 28728
345 Ga0496116_0022300 3300048919 Bacteria 4749
346 Ga0496117_0000104 3300048920 Bacteria 189201
347 Ga0496117_0051396 3300048920 Bacteria 2913
348 Ga0496118_0000080 3300048921 Bacteria 189201
349 Ga0496118_0003398 3300048921 Bacteria 20114
350 Ga0496118_0007844 3300048921 Bacteria 11193
351 Ga0496118_0069596 3300048921 Bacteria 2547
352 Ga0496121_0000035 3300048924 Bacteria 374316
353 Ga0496121_0005053 3300048924 Bacteria 17236
354 Ga0496121_0098916 3300048924 Bacteria 2256
355 Ga0496124_0000093 3300048927 Bacteria 189201
356 Ga0496124_0028207 3300048927 Bacteria 5025
357 Ga0496125_0002080 3300048928 Bacteria 26979
358 Ga0496125_0025122 3300048928 Bacteria 5464
359 Ga0496125_0098450 3300048928 Bacteria 2164
360 Ga0496126_0007586 3300048929 Bacteria 11855
361 Ga0495678_000699 3300049459 Bacteria 30520
362 Ga0501037_0058462 3300049573 Bacteria 2814
363 Ga0501047_0002252 3300049581 Bacteria 18471
364 Ga0501047_0244971 3300049581 Bacteria 1642
365 Ga0501044_0013955 3300049823 Bacteria 8680
366 nmdc:mga00v17_599_c1 3300050491 Bacteria 19989
367 nmdc:mga07m45_9007_c1 3300050496 Bacteria 5156
368 nmdc:mga0sz30_21335_c1 3300050516 Bacteria 2621
369 nmdc:mga0sz30_7766_c1 3300050516 Bacteria 2815
370 Ga0500635_0000163 3300053080 Bacteria 35728
371 Ga0500578_0000159 3300053086 Bacteria 79246
372 Ga0500643_005911 3300053087 Bacteria 5190
373 Ga0500643_011594 3300053087 Bacteria 3205
374 Ga0500644_0000269 3300053088 Bacteria 29380
375 Ga0500644_0015613 3300053088 Bacteria 2170
376 Ga0500647_0003244 3300053091 Bacteria 6301
377 Ga0500647_0078600 3300053091 Bacteria 1583
378 Ga0500651_0013216 3300053093 Bacteria 5023
379 Ga0500566_0060397 3300053094 Bacteria 2147
380 Ga0500641_0003922 3300053096 Bacteria 5260
381 Ga0500641_0007126 3300053096 Bacteria 3980
382 Ga0500641_0009828 3300053096 Bacteria 3445
383 Ga0500555_006371 3300053103 Bacteria 3352
384 Ga0500556_0007069 3300053104 Bacteria 3204
385 Ga0500562_007337 3300053108 Bacteria 2783
386 Ga0500562_010707 3300053108 Bacteria 2325
387 Ga0500572_000338 3300053111 Bacteria 16833
388 Ga0500594_0000312 3300053118 Bacteria 10863
389 Ga0500595_005586 3300053119 Bacteria 5472
390 Ga0500595_011256 3300053119 Bacteria 3512
391 Ga0500607_079568 3300053121 Bacteria 1674
392 Ga0500608_000348 3300053122 Bacteria 17856
393 Ga0500614_001685 3300053123 Bacteria 5163
394 Ga0500642_0062989 3300053130 Bacteria 1670
395 Ga0500658_0000742 3300053134 Bacteria 13445
396 Ga0500559_0000098 3300053136 Bacteria 69305
397 Ga0500559_0013428 3300053136 Bacteria 3468
398 Ga0500564_005262 3300053138 Bacteria 5276
399 Ga0500577_0000456 3300053142 Bacteria 10560
400 Ga0500616_0014001 3300053153 Bacteria 4625
401 Ga0500616_0014739 3300053153 Bacteria 4485
402 Ga0500616_0050652 3300053153 Bacteria 2192
403 Ga0500616_0076476 3300053153 Bacteria 1692
404 Ga0500622_0000140 3300053156 Bacteria 76624
405 Ga0500622_0006444 3300053156 Bacteria 6803
406 Ga0500622_0007480 3300053156 Bacteria 6200
407 Ga0500627_0044443 3300053158 Bacteria 1918
408 Ga0500645_000996 3300053730 Bacteria 15975
409 Ga0500645_003519 3300053730 Bacteria 6328
410 Ga0500645_005439 3300053730 Bacteria 4687
411 Ga0500609_000273 3300053731 Bacteria 7534
412 Ga0500596_000307 3300053735 Bacteria 8725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035121 Ga0373960_0009148 Ga0373960_0009148_52_1389 314
2 3300035241 Ga0373961_0020618 Ga0373961_0020618_286_1623 314
3 3300035691 Ga0373931_0001350 Ga0373931_0001350_1421_2758 314
4 iso_pu_bacteria 2898329390 2898332674 319
5 3300046660 Ga0495625_0157772 Ga0495625_0157772_449_1498 324
6 3300046664 Ga0495659_0034172 Ga0495659_0034172_656_1774 336
7 3300025904 Ga0207647_10045722 Ga0207647_100457222 347
8 3300005327 Ga0070658_10000708 Ga0070658_1000070810 351
9 3300005539 Ga0068853_100010230 Ga0068853_1000102302 351
10 3300005563 Ga0068855_100007416 Ga0068855_1000074162 351
11 3300005578 Ga0068854_100000843 Ga0068854_10000084315 351
12 3300005616 Ga0068852_100000337 Ga0068852_10000033716 351
13 3300009093 Ga0105240_10000156 Ga0105240_10000156114 351
14 3300009545 Ga0105237_10001457 Ga0105237_1000145715 351
15 3300010375 Ga0105239_10001406 Ga0105239_100014062 351
16 3300025909 Ga0207705_10000157 Ga0207705_1000015743 351
17 3300025913 Ga0207695_10000250 Ga0207695_10000250112 351
18 3300025914 Ga0207671_10001429 Ga0207671_1000142910 351
19 3300025949 Ga0207667_10000006 Ga0207667_10000006309 351
20 3300025949 Ga0207667_10000091 Ga0207667_100000912 351
21 3300025981 Ga0207640_10000766 Ga0207640_100007663 351
22 3300026041 Ga0207639_10000185 Ga0207639_1000018516 351
23 3300026142 Ga0207698_10000333 Ga0207698_1000033310 351
24 3300042004 Ga0439445_0037414 Ga0439445_0037414_125_1258 351
25 3300005539 Ga0068853_100348593 Ga0068853_1003485931 352
26 3300013307 Ga0157372_10089995 Ga0157372_100899952 354
27 iso_pu_bacteria 2643221583 2643922750 355
28 3300005563 Ga0068855_100029762 Ga0068855_1000297624 357
29 3300005614 Ga0068856_100382966 Ga0068856_1003829661 357
30 3300025913 Ga0207695_10003077 Ga0207695_1000307710 357
31 3300025917 Ga0207660_10035160 Ga0207660_100351603 357
32 3300025949 Ga0207667_10094032 Ga0207667_100940324 357
33 3300026078 Ga0207702_10332321 Ga0207702_103323211 357
34 3300028800 Ga0265338_10050438 Ga0265338_100504382 360
35 3300005563 Ga0068855_100011377 Ga0068855_1000113772 361
36 3300025949 Ga0207667_10041526 Ga0207667_100415261 361
37 3300053096 Ga0500641_0007126 Ga0500641_0007126_1454_2704 366
38 3300047470 Ga0495681_0020989 Ga0495681_0020989_1168_2421 368
39 3300028786 Ga0307517_10070948 Ga0307517_100709482 370
40 3300005353 Ga0070669_100002305 Ga0070669_1000023053 371
41 3300005367 Ga0070667_100045508 Ga0070667_1000455082 371
42 3300005617 Ga0068859_100001618 Ga0068859_10000161811 371
43 3300005841 Ga0068863_100015575 Ga0068863_1000155753 371
44 3300005842 Ga0068858_100023998 Ga0068858_1000239982 371
45 3300005843 Ga0068860_100023882 Ga0068860_1000238822 371
46 3300005844 Ga0068862_100144412 Ga0068862_1001444122 371
47 3300006931 Ga0097620_100001618 Ga0097620_10000161814 371
48 3300009177 Ga0105248_10010014 Ga0105248_100100144 371
49 3300014325 Ga0163163_10004271 Ga0163163_100042712 371
50 3300014968 Ga0157379_10003874 Ga0157379_100038749 371
51 3300025923 Ga0207681_10001688 Ga0207681_100016889 371
52 3300025986 Ga0207658_10076185 Ga0207658_100761852 371
53 3300026035 Ga0207703_10003897 Ga0207703_100038972 371
54 3300026088 Ga0207641_10014295 Ga0207641_100142955 371
55 3300026118 Ga0207675_100033773 Ga0207675_1000337732 371
56 3300028379 Ga0268266_10105644 Ga0268266_101056442 371
57 3300028381 Ga0268264_10011436 Ga0268264_100114362 371
58 3300046616 Ga0495668_0005699 Ga0495668_0005699_1099_2358 372
59 3300021384 Ga0213876_10010428 Ga0213876_100104284 374
60 3300039437 Ga0436365_1127900 Ga0436365_1127900_3596_4834 374
61 3300049581 Ga0501047_0244971 Ga0501047_0244971_183_1433 375
62 3300001990 JGI24737J22298_10007624 JGI24737J22298_100076242 377
63 3300046459 Ga0495629_0022694 Ga0495629_0022694_661_1905 377
64 iso_pu_bacteria 2510917020 2511125120 377
65 3300005327 Ga0070658_10057143 Ga0070658_100571432 380
66 3300005539 Ga0068853_100004158 Ga0068853_1000041589 380
67 3300005563 Ga0068855_100010626 Ga0068855_1000106265 380
68 3300025909 Ga0207705_10001784 Ga0207705_1000178411 380
69 3300025917 Ga0207660_10000681 Ga0207660_100006815 380
70 3300025919 Ga0207657_10001673 Ga0207657_1000167320 380
71 3300025921 Ga0207652_10004669 Ga0207652_100046696 380
72 3300026041 Ga0207639_10026976 Ga0207639_100269762 380
73 3300053108 Ga0500562_007337 Ga0500562_007337_1479_2741 380
74 3300053156 Ga0500622_0007480 Ga0500622_0007480_1703_2965 380
75 3300002076 JGI24749J21850_1000240 JGI24749J21850_10002405 382
76 3300002459 JGI24751J29686_10000135 JGI24751J29686_1000013511 382
77 3300005295 Ga0065707_10083538 Ga0065707_100835389 382
78 3300005331 Ga0070670_100000090 Ga0070670_10000009032 382
79 3300005353 Ga0070669_100000093 Ga0070669_10000009329 382
80 3300005367 Ga0070667_100001444 Ga0070667_1000014448 382
81 3300005617 Ga0068859_100013233 Ga0068859_1000132338 382
82 3300005618 Ga0068864_100000127 Ga0068864_10000012757 382
83 3300005719 Ga0068861_100036270 Ga0068861_1000362703 382
84 3300005844 Ga0068862_100000126 Ga0068862_10000012669 382
85 3300006931 Ga0097620_100013233 Ga0097620_1000132338 382
86 3300009177 Ga0105248_10000155 Ga0105248_1000015528 382
87 3300013306 Ga0163162_10090598 Ga0163162_100905982 382
88 3300014326 Ga0157380_10000137 Ga0157380_1000013725 382
89 3300025923 Ga0207681_10000005 Ga0207681_10000005130 382
90 3300025925 Ga0207650_10000004 Ga0207650_10000004591 382
91 3300025941 Ga0207711_10001118 Ga0207711_1000111818 382
92 3300025986 Ga0207658_10000907 Ga0207658_1000090719 382
93 3300026095 Ga0207676_10000006 Ga0207676_10000006121 382
94 3300026118 Ga0207675_100000385 Ga0207675_10000038514 382
95 3300028380 Ga0268265_10000001 Ga0268265_100000011057 382
96 3300053111 Ga0500572_000338 Ga0500572_000338_7555_8784 382
97 3300046520 Ga0495637_0010312 Ga0495637_0010312_1715_3004 383
98 3300047472 Ga0495686_0079000 Ga0495686_0079000_731_2002 383
99 3300053103 Ga0500555_006371 Ga0500555_006371_256_1506 383
100 3300049581 Ga0501047_0002252 Ga0501047_0002252_3009_4238 384
101 iso_pu_bacteria 2851153111 2851156207 384
102 3300047469 Ga0495673_0000939 Ga0495673_0000939_324_1589 385
103 3300046512 Ga0495610_0009039 Ga0495610_0009039_1064_2335 386
104 3300003773 Ga0055537_1001888 Ga0055537_10018886 387
105 3300003775 Ga0055524_1017739 Ga0055524_10177392 387
106 3300003790 Ga0055528_1009909 Ga0055528_10099093 387
107 3300013104 Ga0157370_10160109 Ga0157370_101601092 387
108 3300049573 Ga0501037_0058462 Ga0501037_0058462_124_1362 387
109 3300049823 Ga0501044_0013955 Ga0501044_0013955_3109_4347 387
110 iso_pu_bacteria 2643221598 2644001585 387
111 iso_pu_bacteria 2643221614 2644087987 387
112 iso_pu_bacteria 2643221640 2644223717 387
113 iso_pu_bacteria 2643221642 2644236195 387
114 iso_pu_bacteria 2643221661 2644344126 387
115 iso_pu_bacteria 2643221666 2644367344 387
116 iso_pu_bacteria 2843744320 2843745898 387
117 iso_pu_bacteria 2843744320 2843749458 387
118 iso_pu_bacteria 2928531327 2928534607 387
119 3300005618 Ga0068864_100000067 Ga0068864_100000067103 388
120 3300005841 Ga0068863_100000237 Ga0068863_10000023711 388
121 3300005842 Ga0068858_100000020 Ga0068858_100000020162 388
122 3300009177 Ga0105248_10004217 Ga0105248_100042172 388
123 3300009545 Ga0105237_10408949 Ga0105237_104089491 388
124 3300025263 Ga0209565_1000179 Ga0209565_100017921 388
125 3300025273 Ga0209673_1001240 Ga0209673_100124014 388
126 3300025291 Ga0209675_1014925 Ga0209675_10149253 388
127 3300025299 Ga0209256_1005813 Ga0209256_10058135 388
128 3300025925 Ga0207650_10060470 Ga0207650_100604702 388
129 3300025941 Ga0207711_10001710 Ga0207711_1000171021 388
130 3300026035 Ga0207703_10000082 Ga0207703_10000082101 388
131 3300026088 Ga0207641_10000007 Ga0207641_1000000711 388
132 3300026095 Ga0207676_10002060 Ga0207676_100020605 388
133 3300031251 Ga0265327_10002320 Ga0265327_1000232019 388
134 3300046515 Ga0495620_0023949 Ga0495620_0023949_552_1796 388
135 3300046538 Ga0495609_0005335 Ga0495609_0005335_3615_4859 388
136 3300046542 Ga0495597_0002511 Ga0495597_0002511_4208_5452 388
137 3300046557 Ga0495622_0009313 Ga0495622_0009313_2618_3862 388
138 3300048909 Ga0496106_0071775 Ga0496106_0071775_337_1587 388
139 3300048921 Ga0496118_0003398 Ga0496118_0003398_9516_10766 388
140 3300048924 Ga0496121_0000035 Ga0496121_0000035_105797_107047 388
141 3300053080 Ga0500635_0000163 Ga0500635_0000163_12058_13314 388
142 3300053091 Ga0500647_0078600 Ga0500647_0078600_94_1350 388
143 3300053093 Ga0500651_0013216 Ga0500651_0013216_2537_3781 388
144 3300053094 Ga0500566_0060397 Ga0500566_0060397_469_1713 388
145 3300053119 Ga0500595_005586 Ga0500595_005586_505_1749 388
146 3300053121 Ga0500607_079568 Ga0500607_079568_24_1280 388
147 3300053123 Ga0500614_001685 Ga0500614_001685_2940_4184 388
148 3300053130 Ga0500642_0062989 Ga0500642_0062989_268_1512 388
149 3300053735 Ga0500596_000307 Ga0500596_000307_5545_6789 388
150 iso_pu_bacteria 2585428106 2587917078 388
151 iso_pu_bacteria 2643221552 2643782338 388
152 iso_pu_bacteria 2643221560 2643823145 388
153 iso_pu_bacteria 2643221584 2643929847 388
154 3300005338 Ga0068868_100138717 Ga0068868_1001387173 389
155 3300005457 Ga0070662_100028593 Ga0070662_1000285932 389
156 3300005614 Ga0068856_100208743 Ga0068856_1002087432 389
157 3300005618 Ga0068864_100011026 Ga0068864_1000110264 389
158 3300006042 Ga0075368_10004849 Ga0075368_100048491 389
159 3300006051 Ga0075364_10000499 Ga0075364_100004994 389
160 3300006186 Ga0075369_10018205 Ga0075369_100182052 389
161 3300006195 Ga0075366_10032544 Ga0075366_100325442 389
162 3300010375 Ga0105239_10202515 Ga0105239_102025151 389
163 3300025711 Ga0207696_1013327 Ga0207696_10133272 389
164 3300025913 Ga0207695_10053728 Ga0207695_100537282 389
165 3300025931 Ga0207644_10016847 Ga0207644_100168473 389
166 3300025933 Ga0207706_10051090 Ga0207706_100510903 389
167 3300026023 Ga0207677_10066126 Ga0207677_100661262 389
168 3300026067 Ga0207678_10037093 Ga0207678_100370932 389
169 3300031456 Ga0307513_10000077 Ga0307513_1000007714 389
170 3300046616 Ga0495668_0014658 Ga0495668_0014658_1951_3195 389
171 3300048910 Ga0496107_0148462 Ga0496107_0148462_94_1398 389
172 3300048915 Ga0496112_0014185 Ga0496112_0014185_2665_3909 389
173 3300048916 Ga0496113_0089474 Ga0496113_0089474_531_1775 389
174 3300050491 nmdc:mga00v17_599_c1 nmdc:mga00v17_599_c1_4534_5778 389
175 3300050496 nmdc:mga07m45_9007_c1 nmdc:mga07m45_9007_c1_2570_3814 389
176 3300050516 nmdc:mga0sz30_7766_c1 nmdc:mga0sz30_7766_c1_1355_2599 389
177 3300053087 Ga0500643_011594 Ga0500643_011594_1373_2623 389
178 3300053119 Ga0500595_011256 Ga0500595_011256_1549_2793 389
179 iso_pu_bacteria 2582581279 2585148173 389
180 iso_pu_bacteria 2643221614 2644088247 389
181 iso_pu_bacteria 2643221661 2644343485 389
182 iso_pu_bacteria 2643221666 2644369038 389
183 iso_pu_bacteria 2884960567 2884963471 389
184 iso_pu_bacteria 2941485952 2941485987 389
185 3300005548 Ga0070665_100026184 Ga0070665_1000261846 390
186 3300028379 Ga0268266_10066004 Ga0268266_100660042 390
187 3300031456 Ga0307513_10003660 Ga0307513_1000366011 390
188 3300031456 Ga0307513_10018914 Ga0307513_100189147 390
189 3300031901 Ga0307406_10138352 Ga0307406_101383522 390
190 3300035171 Ga0373946_0048624 Ga0373946_0048624_30_1286 390
191 3300035695 Ga0373927_0000831 Ga0373927_0000831_15747_17003 390
192 3300037068 Ga0373925_0000984 Ga0373925_0000984_14909_16165 390
193 3300046528 Ga0495642_0012414 Ga0495642_0012414_425_1672 390
194 3300048918 Ga0496115_0001111 Ga0496115_0001111_16931_18190 390
195 3300053096 Ga0500641_0003922 Ga0500641_0003922_2674_3927 390
196 3300053153 Ga0500616_0050652 Ga0500616_0050652_91_1413 390
197 3300053156 Ga0500622_0006444 Ga0500622_0006444_1765_3018 390
198 iso_pu_bacteria 2643221545 2643747369 390
199 iso_pu_bacteria 2643221598 2643999809 390
200 iso_pu_bacteria 2643221691 2644507432 390
201 iso_pu_bacteria 2818991435 2819538483 390
202 iso_pu_bacteria 2818991454 2819648072 390
203 iso_pu_bacteria 2857504554 2857506111 390
204 3300005327 Ga0070658_10073661 Ga0070658_100736612 391
205 3300005334 Ga0068869_100037418 Ga0068869_1000374183 391
206 3300005347 Ga0070668_100001179 Ga0070668_10000117913 391
207 3300005458 Ga0070681_10007565 Ga0070681_100075654 391
208 3300005530 Ga0070679_100014656 Ga0070679_1000146566 391
209 3300005539 Ga0068853_100100521 Ga0068853_1001005212 391
210 3300005539 Ga0068853_100186988 Ga0068853_1001869882 391
211 3300009092 Ga0105250_10007725 Ga0105250_100077254 391
212 3300009093 Ga0105240_10004673 Ga0105240_1000467319 391
213 3300009176 Ga0105242_10121033 Ga0105242_101210331 391
214 3300009551 Ga0105238_10007800 Ga0105238_100078001 391
215 3300013105 Ga0157369_10145843 Ga0157369_101458432 391
216 3300025299 Ga0209256_1023109 Ga0209256_10231091 391
217 3300025913 Ga0207695_10001288 Ga0207695_1000128827 391
218 3300025917 Ga0207660_10049656 Ga0207660_100496562 391
219 3300025921 Ga0207652_10042913 Ga0207652_100429132 391
220 3300025924 Ga0207694_10071428 Ga0207694_100714281 391
221 3300025934 Ga0207686_10230260 Ga0207686_102302601 391
222 3300025949 Ga0207667_10101163 Ga0207667_101011632 391
223 3300028379 Ga0268266_10009290 Ga0268266_100092908 391
224 3300028786 Ga0307517_10003203 Ga0307517_1000320316 391
225 3300031456 Ga0307513_10007104 Ga0307513_1000710413 391
226 3300033180 Ga0307510_10043919 Ga0307510_100439193 391
227 3300033180 Ga0307510_10069742 Ga0307510_100697422 391
228 3300037418 Ga0395900_0026680 Ga0395900_0026680_1292_2545 391
229 3300037418 Ga0395900_0152018 Ga0395900_0152018_1094_2347 391
230 3300037471 Ga0395905_0003251 Ga0395905_0003251_6380_7633 391
231 3300046460 Ga0495638_0053557 Ga0495638_0053557_865_2115 391
232 3300046616 Ga0495668_0010898 Ga0495668_0010898_634_1884 391
233 3300046684 Ga0495669_0000044 Ga0495669_0000044_44187_45437 391
234 3300046684 Ga0495669_0070251 Ga0495669_0070251_255_1505 391
235 3300048919 Ga0496116_0022300 Ga0496116_0022300_680_1939 391
236 3300048928 Ga0496125_0002080 Ga0496125_0002080_9134_10393 391
237 3300053087 Ga0500643_005911 Ga0500643_005911_3510_4766 391
238 3300053153 Ga0500616_0014739 Ga0500616_0014739_791_2047 391
239 3300053730 Ga0500645_000996 Ga0500645_000996_12166_13422 391
240 iso_pu_bacteria 2582581280 2585155152 391
241 iso_pu_bacteria 2582581293 2585194833 391
242 3300003215 JGI25153J46596_10034394 JGI25153J46596_100343942 392
243 3300003791 Ga0055530_10002060 Ga0055530_100020604 392
244 3300005262 Ga0065165_1001513 Ga0065165_10015132 392
245 3300005339 Ga0070660_100052011 Ga0070660_1000520112 392
246 3300005366 Ga0070659_100108718 Ga0070659_1001087182 392
247 3300005548 Ga0070665_100002155 Ga0070665_1000021559 392
248 3300005843 Ga0068860_100000027 Ga0068860_10000002777 392
249 3300005844 Ga0068862_100017037 Ga0068862_1000170372 392
250 3300006028 Ga0070717_10076777 Ga0070717_100767772 392
251 3300010375 Ga0105239_10197671 Ga0105239_101976712 392
252 3300025297 Ga0209758_1000894 Ga0209758_100089444 392
253 3300025298 Ga0209050_1000173 Ga0209050_100017334 392
254 3300025299 Ga0209256_1010954 Ga0209256_10109543 392
255 3300025304 Ga0209257_1000196 Ga0209257_100019634 392
256 3300025304 Ga0209257_1002949 Ga0209257_10029492 392
257 3300025919 Ga0207657_10110429 Ga0207657_101104292 392
258 3300025932 Ga0207690_10000116 Ga0207690_1000011653 392
259 3300025941 Ga0207711_10000464 Ga0207711_1000046421 392
260 3300027378 Ga0209981_1000450 Ga0209981_10004503 392
261 3300028379 Ga0268266_10000003 Ga0268266_10000003902 392
262 3300028380 Ga0268265_10004520 Ga0268265_100045205 392
263 3300028380 Ga0268265_10031272 Ga0268265_100312723 392
264 3300028381 Ga0268264_10000181 Ga0268264_1000018148 392
265 3300028794 Ga0307515_10167003 Ga0307515_101670031 392
266 3300031251 Ga0265327_10000287 Ga0265327_1000028795 392
267 3300031730 Ga0307516_10000030 Ga0307516_10000030140 392
268 3300031824 Ga0307413_10032906 Ga0307413_100329062 392
269 3300031852 Ga0307410_10111005 Ga0307410_101110051 392
270 3300032004 Ga0307414_10000202 Ga0307414_1000020225 392
271 3300037312 Ga0395899_0000486 Ga0395899_0000486_41390_42646 392
272 3300037418 Ga0395900_0000008 Ga0395900_0000008_41390_42646 392
273 3300037466 Ga0395898_0020955 Ga0395898_0020955_1424_2680 392
274 3300037471 Ga0395905_0011963 Ga0395905_0011963_6668_7924 392
275 3300038443 Ga0395901_0000008 Ga0395901_0000008_437820_439076 392
276 3300044712 Ga0453684_0295664 Ga0453684_0295664_229_1482 392
277 3300046506 Ga0495583_0000025 Ga0495583_0000025_106183_107436 392
278 3300047469 Ga0495673_0001300 Ga0495673_0001300_18443_19696 392
279 3300047472 Ga0495686_0005596 Ga0495686_0005596_4958_6211 392
280 3300047472 Ga0495686_0012613 Ga0495686_0012613_2984_4249 392
281 3300048918 Ga0496115_0001701 Ga0496115_0001701_11862_13178 392
282 3300053088 Ga0500644_0000269 Ga0500644_0000269_14760_16013 392
283 3300053096 Ga0500641_0009828 Ga0500641_0009828_668_1930 392
284 3300053153 Ga0500616_0014001 Ga0500616_0014001_441_1703 392
285 3300053730 Ga0500645_003519 Ga0500645_003519_2017_3279 392
286 3300006881 Ga0068865_100009151 Ga0068865_1000091513 393
287 3300025292 Ga0209676_1000253 Ga0209676_100025323 393
288 3300025298 Ga0209050_1000649 Ga0209050_100064928 393
289 3300025303 Ga0209051_1002693 Ga0209051_100269311 393
290 3300025304 Ga0209257_1000364 Ga0209257_100036441 393
291 3300028794 Ga0307515_10085750 Ga0307515_100857503 393
292 3300028794 Ga0307515_10097211 Ga0307515_100972114 393
293 3300032004 Ga0307414_10049900 Ga0307414_100499001 393
294 3300037853 Ga0436364_0062945 Ga0436364_0062945_2497_3753 393
295 3300046460 Ga0495638_0001235 Ga0495638_0001235_20186_21442 393
296 3300046512 Ga0495610_0004119 Ga0495610_0004119_7907_9163 393
297 3300046524 Ga0495648_0000634 Ga0495648_0000634_27870_29126 393
298 3300046524 Ga0495648_0054033 Ga0495648_0054033_994_2250 393
299 3300046616 Ga0495668_0000291 Ga0495668_0000291_2199_3455 393
300 3300047472 Ga0495686_0005965 Ga0495686_0005965_6393_7649 393
301 3300049459 Ga0495678_000699 Ga0495678_000699_9203_10459 393
302 3300053086 Ga0500578_0000159 Ga0500578_0000159_3017_4273 393
303 3300053088 Ga0500644_0015613 Ga0500644_0015613_280_1536 393
304 3300053108 Ga0500562_010707 Ga0500562_010707_639_1895 393
305 3300053118 Ga0500594_0000312 Ga0500594_0000312_7829_9085 393
306 3300053136 Ga0500559_0000098 Ga0500559_0000098_22922_24178 393
307 3300053138 Ga0500564_005262 Ga0500564_005262_2222_3478 393
308 3300053156 Ga0500622_0000140 Ga0500622_0000140_45266_46522 393
309 3300003775 Ga0055524_1012190 Ga0055524_10121904 394
310 3300003794 Ga0055531_10000930 Ga0055531_1000093014 394
311 3300003794 Ga0055531_10001767 Ga0055531_100017671 394
312 3300006186 Ga0075369_10074201 Ga0075369_100742011 394
313 3300013102 Ga0157371_10001910 Ga0157371_100019103 394
314 3300013105 Ga0157369_10018155 Ga0157369_100181557 394
315 3300025298 Ga0209050_1001834 Ga0209050_10018344 394
316 3300025304 Ga0209257_1001017 Ga0209257_100101713 394
317 3300026089 Ga0207648_10168795 Ga0207648_101687952 394
318 3300028794 Ga0307515_10076827 Ga0307515_100768272 394
319 3300042436 Ga0439435_0007160 Ga0439435_0007160_299_1561 394
320 3300046460 Ga0495638_0003577 Ga0495638_0003577_1610_2869 394
321 3300046460 Ga0495638_0009533 Ga0495638_0009533_2737_4143 394
322 3300046471 Ga0495650_0000024 Ga0495650_0000024_83467_84726 394
323 3300046507 Ga0495606_0006495 Ga0495606_0006495_2659_4059 394
324 3300046513 Ga0495616_0005214 Ga0495616_0005214_2440_3699 394
325 3300046518 Ga0495631_0081894 Ga0495631_0081894_108_1367 394
326 3300046519 Ga0495632_0004458 Ga0495632_0004458_5975_7234 394
327 3300046520 Ga0495637_0018260 Ga0495637_0018260_1910_3169 394
328 3300046524 Ga0495648_0041139 Ga0495648_0041139_1009_2268 394
329 3300046530 Ga0495654_0000135 Ga0495654_0000135_15140_16399 394
330 3300046660 Ga0495625_0002176 Ga0495625_0002176_17872_19131 394
331 3300046660 Ga0495625_0057973 Ga0495625_0057973_272_1531 394
332 3300046810 Ga0495660_0025068 Ga0495660_0025068_1437_2696 394
333 3300047320 Ga0495672_0001086 Ga0495672_0001086_1689_2948 394
334 3300047323 Ga0495683_0052985 Ga0495683_0052985_602_1861 394
335 3300048909 Ga0496106_0037873 Ga0496106_0037873_1506_2765 394
336 3300048910 Ga0496107_0000028 Ga0496107_0000028_9140_10399 394
337 3300048918 Ga0496115_0002063 Ga0496115_0002063_8367_9626 394
338 3300048924 Ga0496121_0005053 Ga0496121_0005053_12706_13965 394
339 3300048924 Ga0496121_0098916 Ga0496121_0098916_744_2003 394
340 3300048927 Ga0496124_0028207 Ga0496124_0028207_3278_4537 394
341 3300050516 nmdc:mga0sz30_21335_c1 nmdc:mga0sz30_21335_c1_776_2035 394
342 3300053091 Ga0500647_0003244 Ga0500647_0003244_1586_2881 394
343 3300053104 Ga0500556_0007069 Ga0500556_0007069_1400_2659 394
344 3300053122 Ga0500608_000348 Ga0500608_000348_1824_3083 394
345 3300053136 Ga0500559_0013428 Ga0500559_0013428_627_1886 394
346 3300053153 Ga0500616_0076476 Ga0500616_0076476_411_1670 394
347 3300053158 Ga0500627_0044443 Ga0500627_0044443_43_1302 394
348 3300053730 Ga0500645_005439 Ga0500645_005439_1564_2823 394
349 3300053731 Ga0500609_000273 Ga0500609_000273_3121_4380 394
350 3300005262 Ga0065165_1006815 Ga0065165_10068152 395
351 3300025295 Ga0209564_1003913 Ga0209564_10039136 395
352 3300046453 Ga0495627_000511 Ga0495627_000511_24937_26331 395
353 3300046460 Ga0495638_0007109 Ga0495638_0007109_2219_3622 395
354 3300046460 Ga0495638_0026395 Ga0495638_0026395_741_2012 395
355 3300046512 Ga0495610_0000478 Ga0495610_0000478_35386_36657 395
356 3300046660 Ga0495625_0042930 Ga0495625_0042930_272_1543 395
357 3300046794 Ga0495589_0012780 Ga0495589_0012780_794_2065 395
358 3300047472 Ga0495686_0029654 Ga0495686_0029654_170_1486 395
359 3300048928 Ga0496125_0025122 Ga0496125_0025122_405_1667 395
360 3300048929 Ga0496126_0007586 Ga0496126_0007586_6787_8049 395
361 3300053134 Ga0500658_0000742 Ga0500658_0000742_11489_12760 395
362 3300053142 Ga0500577_0000456 Ga0500577_0000456_5074_6345 395
363 3300025913 Ga0207695_10002305 Ga0207695_1000230515 396
364 3300048905 Ga0496102_0000043 Ga0496102_0000043_43356_44672 402
365 3300048906 Ga0496103_0000086 Ga0496103_0000086_65901_67217 402
366 3300048919 Ga0496116_0001293 Ga0496116_0001293_12121_13437 402
367 3300048920 Ga0496117_0000104 Ga0496117_0000104_43356_44672 402
368 3300048921 Ga0496118_0000080 Ga0496118_0000080_144530_145846 402
369 3300048927 Ga0496124_0000093 Ga0496124_0000093_144530_145846 402
370 3300001979 JGI24740J21852_10012740 JGI24740J21852_100127401 405
371 3300001904 JGI24736J21556_1000037 JGI24736J21556_100003719 408
372 3300001989 JGI24739J22299_10003077 JGI24739J22299_100030777 408
373 3300002067 JGI24735J21928_10007565 JGI24735J21928_100075653 408
374 3300002070 JGI24750J21931_1000681 JGI24750J21931_10006814 408
375 3300002074 JGI24748J21848_1000015 JGI24748J21848_1000015136 408
376 3300002075 JGI24738J21930_10000334 JGI24738J21930_100003349 408
377 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006136 408
378 3300002244 JGI24742J22300_10001113 JGI24742J22300_100011132 408
379 3300005327 Ga0070658_10021907 Ga0070658_100219073 408
380 3300005330 Ga0070690_100000074 Ga0070690_10000007426 408
381 3300005335 Ga0070666_10000014 Ga0070666_1000001477 408
382 3300005344 Ga0070661_100037056 Ga0070661_1000370562 408
383 3300005353 Ga0070669_100000304 Ga0070669_10000030410 408
384 3300005355 Ga0070671_100002815 Ga0070671_10000281512 408
385 3300005365 Ga0070688_100010173 Ga0070688_1000101736 408
386 3300005366 Ga0070659_100058404 Ga0070659_1000584043 408
387 3300005367 Ga0070667_100022770 Ga0070667_1000227706 408
388 3300005544 Ga0070686_100000002 Ga0070686_100000002196 408
389 3300005548 Ga0070665_100000025 Ga0070665_100000025136 408
390 3300005617 Ga0068859_100009705 Ga0068859_1000097059 408
391 3300005618 Ga0068864_100002381 Ga0068864_1000023817 408
392 3300005719 Ga0068861_100001742 Ga0068861_1000017422 408
393 3300005841 Ga0068863_100000541 Ga0068863_10000054122 408
394 3300005842 Ga0068858_100002657 Ga0068858_10000265717 408
395 3300005843 Ga0068860_100000001 Ga0068860_100000001585 408
396 3300005844 Ga0068862_100000048 Ga0068862_10000004828 408
397 3300006931 Ga0097620_100009706 Ga0097620_1000097069 408
398 3300009011 Ga0105251_10000241 Ga0105251_1000024139 408
399 3300009101 Ga0105247_10055785 Ga0105247_100557853 408
400 3300009177 Ga0105248_10000454 Ga0105248_100004543 408
401 3300009177 Ga0105248_10008368 Ga0105248_100083686 408
402 3300009553 Ga0105249_10000005 Ga0105249_10000005157 408
403 3300009553 Ga0105249_10003389 Ga0105249_100033893 408
404 3300013105 Ga0157369_10040454 Ga0157369_100404543 408
405 3300014325 Ga0163163_10021751 Ga0163163_100217514 408
406 3300014326 Ga0157380_10000223 Ga0157380_1000022311 408
407 3300014968 Ga0157379_10001771 Ga0157379_1000177113 408
408 3300017792 Ga0163161_10000559 Ga0163161_1000055923 408
409 3300025223 Ga0207672_1001347 Ga0207672_10013472 408
410 3300025735 Ga0207713_1029629 Ga0207713_10296291 408
411 3300025903 Ga0207680_10000004 Ga0207680_10000004284 408
412 3300025904 Ga0207647_10000038 Ga0207647_1000003861 408
413 3300025911 Ga0207654_10024848 Ga0207654_100248483 408
414 3300025914 Ga0207671_10003755 Ga0207671_100037553 408
415 3300025923 Ga0207681_10000152 Ga0207681_1000015226 408
416 3300025924 Ga0207694_10005393 Ga0207694_100053933 408
417 3300025925 Ga0207650_10000452 Ga0207650_1000045231 408
418 3300025925 Ga0207650_10050044 Ga0207650_100500442 408
419 3300025931 Ga0207644_10000956 Ga0207644_100009567 408
420 3300025936 Ga0207670_10010762 Ga0207670_100107626 408
421 3300025941 Ga0207711_10000017 Ga0207711_1000001767 408
422 3300025941 Ga0207711_10021499 Ga0207711_100214994 408
423 3300025949 Ga0207667_10005755 Ga0207667_100057558 408
424 3300025961 Ga0207712_10000001 Ga0207712_10000001158 408
425 3300025961 Ga0207712_10000113 Ga0207712_1000011360 408
426 3300025986 Ga0207658_10000119 Ga0207658_1000011980 408
427 3300025986 Ga0207658_10000483 Ga0207658_1000048346 408
428 3300026067 Ga0207678_10007379 Ga0207678_1000737910 408
429 3300026088 Ga0207641_10000008 Ga0207641_10000008191 408
430 3300026088 Ga0207641_10000033 Ga0207641_1000003388 408
431 3300026095 Ga0207676_10000019 Ga0207676_1000001975 408
432 3300026095 Ga0207676_10005298 Ga0207676_100052983 408
433 3300026116 Ga0207674_10009512 Ga0207674_100095122 408
434 3300026118 Ga0207675_100000171 Ga0207675_10000017111 408
435 3300028379 Ga0268266_10000028 Ga0268266_10000028248 408
436 3300028380 Ga0268265_10000011 Ga0268265_10000011191 408
437 3300028380 Ga0268265_10000071 Ga0268265_1000007195 408
438 3300028381 Ga0268264_10000006 Ga0268264_10000006284 408
439 3300048906 Ga0496103_0009518 Ga0496103_0009518_3729_5051 408
440 3300048920 Ga0496117_0051396 Ga0496117_0051396_67_1389 408
441 3300048921 Ga0496118_0007844 Ga0496118_0007844_9035_10357 408
442 3300048921 Ga0496118_0069596 Ga0496118_0069596_117_1439 408
443 3300048928 Ga0496125_0098450 Ga0496125_0098450_250_1572 408

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

50

448

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wyk-assembly1.cif.gz_A cryo-em structure of the gltph l152c-g321c mutant in the intermediate chloride conducting state. 0.7724 8 380
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.7254 9 380
8cua-assembly1.cif.gz_A human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state 0.7195 4 381
3v8g-assembly1.cif.gz_C crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) 0.7186 5 380
7ngh-assembly1.cif.gz_C structure of glutamate transporter homologue in complex with sybody 0.7167 5 385
ID Description Score Start End Superfamily
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.7119 5 385 1.10.3860.10
4p3jC00 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.7024 5 380 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.6749 5 387 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.6715 5 385 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.6551 3 386 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A0R3QIY3-F1-model_v4 Amino acid transporter 0.9185 5 253 GO:0005886
GO:0006835
GO:0015293
AF-A0A353HZ05-F1-model_v4 Dicarboxylate/amino acid:cation symporter 0.8988 3 262 GO:0005886
GO:0006835
GO:0015293
AF-W7DK85-F1-model_v4 C4-dicarboxylate transporter 0.889 2 382 GO:0005886
GO:0006835
GO:0015293
AF-A0A2J4Z8Y1-F1-model_v4 Dicarboxylate/amino acid:cation symporter 0.8858 5 324 GO:0005886
GO:0006835
GO:0015293
AF-B0SXJ5-F1-model_v4 Sodium:dicarboxylate symporter 0.8794 1 283 GO:0005886
GO:0006835
GO:0015293

Feature Viewer

pLDDT pTM Quality
82.08 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map