F444781

General Info

Members Datasets Scaffolds Average Seq Length
441 206 882 296

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_226049_c1|nmdc:mga05p37_226049_c1_342_1376
Length 338
Sequence MSRANLSLNNGTANVKTAHTDHWNCASQTYGPAQRAYLHSVVGPMCGIAGLFSKSLDVSGHLMLLQLSDRGPDSAGVAIYRHPAPSGSSKVSLFSPNPEQDWEAVRHELADTFGAGDPERRASHAVIVVETDADVAQAWLREHHPELRVMSAGQAIEIYKEAGSPRDFIEAFALDEMQGSHALGHTRMATESAVTTEHSHPFSTGLDLCLVHNGSLSNHNDLRRWLRKEGIQFETDNDSEVAAGYLTHRLREGATLEQALEGCLEDLDGFYTFAVGTAEGFAVLRDPIACKPAVMAETDDWVAMASEYRAIAVLPGAEDATTWEPEPGRVYSWERAPV

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
206 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0.23
Rhizoplane 12.24
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_226049_c1 3300050507 Bacteria 2256
2 JGI25406J46586_10036164 3300003203 Bacteria 1795
3 JGI25407J50210_10000113 3300003373 Bacteria 11531
4 JGI25407J50210_10014623 3300003373 Bacteria 2023
5 Ga0055542_1000172 3300003762 Bacteria 80034
6 Ga0070658_10082628 3300005327 Bacteria 2640
7 Ga0070676_10093092 3300005328 Bacteria 1850
8 Ga0070683_100127595 3300005329 Bacteria 2405
9 Ga0070692_10010544 3300005345 Bacteria 4212
10 Ga0070668_100183930 3300005347 Bacteria 1708
11 Ga0070668_100371056 3300005347 Bacteria 1216
12 Ga0070669_100122720 3300005353 Bacteria 1984
13 Ga0070674_100482644 3300005356 Bacteria 1029
14 Ga0070659_100324515 3300005366 Bacteria 1287
15 Ga0070714_100178527 3300005435 Bacteria 1931
16 Ga0070710_10217210 3300005437 Bacteria 1215
17 Ga0070711_100085302 3300005439 Bacteria 2262
18 Ga0070711_100241400 3300005439 Bacteria 1413
19 Ga0070663_100367827 3300005455 Bacteria 1168
20 Ga0070678_100001287 3300005456 Bacteria 13285
21 Ga0070662_100013491 3300005457 Bacteria 5438
22 Ga0070706_100004153 3300005467 Bacteria 14086
23 Ga0070707_100004688 3300005468 Bacteria 12810
24 Ga0070698_100139155 3300005471 Bacteria 2380
25 Ga0070686_100277425 3300005544 Bacteria 1235
26 Ga0070695_100084593 3300005545 Bacteria 2105
27 Ga0070696_100056517 3300005546 Bacteria 2737
28 Ga0070696_100091989 3300005546 Bacteria 2161
29 Ga0070665_100028590 3300005548 Bacteria 5614
30 Ga0070665_100197598 3300005548 Bacteria 2012
31 Ga0070665_100240295 3300005548 Bacteria 1812
32 Ga0070704_100184998 3300005549 Bacteria 1670
33 Ga0070664_100025405 3300005564 Bacteria 4909
34 Ga0068861_100008198 3300005719 Bacteria 7186
35 Ga0068861_100037932 3300005719 Bacteria 3584
36 Ga0068858_100010612 3300005842 Bacteria 8719
37 Ga0068860_100138845 3300005843 Bacteria 2335
38 Ga0081455_10019824 3300005937 Bacteria 6351
39 Ga0081455_10038883 3300005937 Bacteria 4210
40 Ga0081455_10056572 3300005937 Bacteria 3329
41 Ga0081455_10070439 3300005937 Bacteria 2903
42 Ga0081538_10000042 3300005981 Bacteria 115656
43 Ga0081538_10000987 3300005981 Bacteria 30164
44 Ga0081538_10002802 3300005981 Bacteria 16695
45 Ga0081538_10007515 3300005981 Bacteria 9419
46 Ga0081538_10008457 3300005981 Bacteria 8728
47 Ga0081538_10031593 3300005981 Bacteria 3566
48 Ga0081538_10034147 3300005981 Bacteria 3368
49 Ga0081538_10107338 3300005981 Bacteria 1383
50 Ga0081539_10004883 3300005985 Bacteria 14311
51 Ga0075432_10016507 3300006058 Bacteria 2520
52 Ga0070716_100339993 3300006173 Bacteria 1058
53 Ga0070712_100082497 3300006175 Bacteria 2332
54 Ga0075362_10038605 3300006177 Bacteria 2097
55 Ga0097621_100182810 3300006237 Bacteria 1812
56 Ga0068871_100419554 3300006358 Bacteria 1195
57 Ga0075428_100027622 3300006844 Bacteria 6278
58 Ga0075430_100389141 3300006846 Bacteria 1151
59 Ga0075431_100007623 3300006847 Bacteria 10776
60 Ga0075431_100010526 3300006847 Bacteria 9298
61 Ga0075431_100137083 3300006847 Bacteria 2523
62 Ga0075431_100264818 3300006847 Bacteria 1744
63 Ga0075433_10099450 3300006852 Bacteria 2575
64 Ga0075433_10445315 3300006852 Bacteria 1142
65 Ga0075434_100008567 3300006871 Bacteria 9514
66 Ga0075434_100438592 3300006871 Bacteria 1327
67 Ga0075436_100399261 3300006914 Bacteria 996
68 Ga0075435_100153109 3300007076 Bacteria 1939
69 Ga0099795_10071603 3300007788 Bacteria 1309
70 Ga0111539_10006793 3300009094 Bacteria 14722
71 Ga0111539_10259120 3300009094 Bacteria 2025
72 Ga0111539_10619311 3300009094 Bacteria 1260
73 Ga0105245_10015294 3300009098 Bacteria 6687
74 Ga0105247_10026782 3300009101 Bacteria 3484
75 Ga0114129_10009212 3300009147 Bacteria 14080
76 Ga0114129_10095937 3300009147 Bacteria 4107
77 Ga0114129_10195106 3300009147 Bacteria 2746
78 Ga0114129_10197856 3300009147 Bacteria 2724
79 Ga0114129_10545841 3300009147 Bacteria 1508
80 Ga0114129_10816903 3300009147 Bacteria 1188
81 Ga0105243_10331217 3300009148 Bacteria 1391
82 Ga0105241_10034697 3300009174 Bacteria 3792
83 Ga0105242_10032801 3300009176 Bacteria 4154
84 Ga0105242_10341156 3300009176 Bacteria 1381
85 Ga0105248_10043842 3300009177 Bacteria 5017
86 Ga0105249_10024802 3300009553 Bacteria 5393
87 Ga0105249_10051046 3300009553 Bacteria 3772
88 Ga0105249_10238979 3300009553 Bacteria 1795
89 Ga0105249_10487962 3300009553 Bacteria 1276
90 Ga0099796_10033898 3300010159 Bacteria 1683
91 Ga0105239_10322296 3300010375 Bacteria 1742
92 Ga0105239_10389360 3300010375 Bacteria 1577
93 Ga0105246_10014264 3300011119 Bacteria 4995
94 Ga0157378_10003506 3300013297 Bacteria 13916
95 Ga0163162_10057191 3300013306 Bacteria 3928
96 Ga0163162_10086743 3300013306 Bacteria 3208
97 Ga0163162_10843121 3300013306 Bacteria 1032
98 Ga0157375_10188112 3300013308 Bacteria 2219
99 Ga0157379_10006564 3300014968 Bacteria 10039
100 Ga0157376_10116678 3300014969 Bacteria 2359
101 Ga0163161_10376259 3300017792 Bacteria 1134
102 Ga0207692_10109110 3300025898 Bacteria 1532
103 Ga0207645_10035419 3300025907 Bacteria 3205
104 Ga0207705_10200387 3300025909 Bacteria 1512
105 Ga0207654_10233084 3300025911 Bacteria 1227
106 Ga0207693_10033822 3300025915 Bacteria 4032
107 Ga0207663_10014191 3300025916 Bacteria 4354
108 Ga0207706_10002536 3300025933 Bacteria 17809
109 Ga0207686_10028224 3300025934 Bacteria 3296
110 Ga0207709_10055680 3300025935 Bacteria 2444
111 Ga0207709_10211847 3300025935 Bacteria 1391
112 Ga0207665_10120858 3300025939 Bacteria 1850
113 Ga0207711_10417539 3300025941 Bacteria 1248
114 Ga0207711_10555381 3300025941 Bacteria 1071
115 Ga0207712_10097016 3300025961 Bacteria 2183
116 Ga0207668_10090391 3300025972 Bacteria 2247
117 Ga0207703_10521842 3300026035 Bacteria 1117
118 Ga0207678_10028536 3300026067 Bacteria 4871
119 Ga0207708_10447434 3300026075 Bacteria 1075
120 Ga0207676_10356241 3300026095 Bacteria 1355
121 Ga0207675_100013767 3300026118 Bacteria 7545
122 Ga0207675_100049762 3300026118 Bacteria 3910
123 Ga0207683_10000105 3300026121 Bacteria 68330
124 Ga0207428_10050976 3300027907 Bacteria 3309
125 Ga0268266_10016027 3300028379 Bacteria 6408
126 Ga0268266_10169486 3300028379 Bacteria 1981
127 Ga0268264_10108584 3300028381 Bacteria 2426
128 Ga0265318_10024818 3300028577 Bacteria 2373
129 Ga0265320_10056646 3300031240 Bacteria 1883
130 Ga0307408_100061396 3300031548 Bacteria 2744
131 Ga0316579_10003904 3300031691 Bacteria 5871
132 Ga0307410_10022580 3300031852 Bacteria 3892
133 Ga0307406_10037139 3300031901 Bacteria 3006
134 Ga0307406_10039583 3300031901 Bacteria 2926
135 Ga0307406_10236340 3300031901 Bacteria 1368
136 Ga0307409_100274143 3300031995 Bacteria 1555
137 Ga0307416_100045051 3300032002 Bacteria 3470
138 Ga0307416_100127953 3300032002 Bacteria 2279
139 Ga0307414_10154585 3300032004 Bacteria 1814
140 Ga0307415_100000421 3300032126 Bacteria 18158
141 Ga0307415_100436365 3300032126 Bacteria 1128
142 Ga0373949_0022013 3300035090 Bacteria 1467
143 Ga0373941_0047110 3300035115 Bacteria 1357
144 Ga0373961_0004603 3300035241 Bacteria 3329
145 Ga0373962_0013400 3300035242 Bacteria 2076
146 Ga0373937_0434460 3300036401 Bacteria 1246
147 Ga0395899_0121143 3300037312 Bacteria 1874
148 Ga0395900_0080450 3300037418 Bacteria 3348
149 Ga0395898_0569797 3300037466 Bacteria 1075
150 Ga0436364_1522204 3300037853 Bacteria 2032
151 Ga0395901_0060095 3300038443 Bacteria 3954
152 Ga0395901_0256735 3300038443 Bacteria 1820
153 Ga0395901_0398892 3300038443 Bacteria 1413
154 Ga0436365_0743095 3300039437 Bacteria 7653
155 Ga0436365_0949435 3300039437 Bacteria 1756
156 Ga0436360_1274656 3300039438 Bacteria 921
157 Ga0436363_0269896 3300039450 Bacteria 2320
158 Ga0436362_0079871 3300039453 Bacteria 3009
159 Ga0450910_006141 3300042147 Bacteria 1652
160 Ga0450918_018111 3300042531 Bacteria 1228
161 Ga0466969_0052133 3300044656 Bacteria 2011
162 Ga0466963_0004685 3300044694 Bacteria 7982
163 Ga0466963_0132206 3300044694 Bacteria 1725
164 Ga0466964_0025464 3300044706 Bacteria 2310
165 Ga0466968_0012291 3300044735 Bacteria 3348
166 Ga0466970_0010414 3300044765 Bacteria 4723
167 Ga0466957_0002056 3300044842 Bacteria 10760
168 Ga0466960_0069219 3300044901 Bacteria 1753
169 Ga0466960_0082761 3300044901 Bacteria 1621
170 Ga0466959_0007802 3300045049 Bacteria 7530
171 Ga0466959_0012779 3300045049 Bacteria 6076
172 Ga0466959_0147062 3300045049 Bacteria 1662
173 Ga0466958_0009364 3300045836 Bacteria 5458
174 Ga0466958_0031007 3300045836 Bacteria 3178
175 Ga0466958_0043143 3300045836 Bacteria 2716
176 Ga0466958_0055602 3300045836 Bacteria 2402
177 Ga0466958_0136248 3300045836 Bacteria 1544
178 Ga0466958_0337811 3300045836 Bacteria 969
179 Ga0466967_0000418 3300045976 Bacteria 20170
180 Ga0466967_0002534 3300045976 Bacteria 11435
181 Ga0466967_0104705 3300045976 Bacteria 2591
182 Ga0466967_0166328 3300045976 Bacteria 2073
183 Ga0466967_0308759 3300045976 Bacteria 1523
184 Ga0466967_0698466 3300045976 Bacteria 1005
185 Ga0495603_0067145 3300046455 Bacteria 2112
186 Ga0495591_031764 3300046458 Bacteria 1581
187 Ga0495629_0096728 3300046459 Bacteria 2060
188 Ga0495584_0074564 3300046491 Bacteria 1706
189 Ga0495608_0149124 3300046511 Bacteria 1491
190 Ga0495630_0051160 3300046517 Bacteria 3092
191 Ga0495631_0120941 3300046518 Bacteria 1126
192 Ga0495663_0043142 3300046525 Bacteria 1377
193 Ga0495667_0298728 3300046559 Bacteria 1020
194 Ga0495667_0341375 3300046559 Bacteria 947
195 Ga0495668_0180442 3300046616 Bacteria 1157
196 Ga0495634_0233151 3300046642 Bacteria 1132
197 Ga0495589_0061088 3300046794 Bacteria 1850
198 Ga0495604_0237547 3300047317 Bacteria 1248
199 Ga0495674_0066979 3300047319 Bacteria 3113
200 Ga0496100_0024051 3300048903 Bacteria 3710
201 Ga0496100_0028080 3300048903 Bacteria 3467
202 Ga0496100_0100130 3300048903 Bacteria 1996
203 Ga0496100_0204970 3300048903 Bacteria 1439
204 Ga0496101_0036230 3300048904 Bacteria 3494
205 Ga0496101_0040271 3300048904 Bacteria 3327
206 Ga0496101_0125659 3300048904 Bacteria 1943
207 Ga0496101_0215059 3300048904 Bacteria 1490
208 Ga0496101_0361966 3300048904 Bacteria 1140
209 Ga0496102_0001457 3300048905 Bacteria 20953
210 Ga0496102_0013722 3300048905 Bacteria 7026
211 Ga0496102_0090096 3300048905 Bacteria 2838
212 Ga0496102_0151137 3300048905 Bacteria 2182
213 Ga0496102_0460774 3300048905 Bacteria 1192
214 Ga0496103_0041556 3300048906 Bacteria 2827
215 Ga0496103_0165390 3300048906 Bacteria 1419
216 Ga0496104_0078852 3300048907 Bacteria 3138
217 Ga0496105_0008694 3300048908 Bacteria 7901
218 Ga0496105_0027346 3300048908 Bacteria 4658
219 Ga0496105_0067624 3300048908 Bacteria 2950
220 Ga0496105_0354978 3300048908 Bacteria 1170
221 Ga0496106_0013408 3300048909 Bacteria 6051
222 Ga0496106_0210593 3300048909 Bacteria 1548
223 Ga0496107_0003703 3300048910 Bacteria 10271
224 Ga0496107_0008198 3300048910 Bacteria 7226
225 Ga0496107_0026420 3300048910 Bacteria 4115
226 Ga0496107_0071368 3300048910 Bacteria 2523
227 Ga0496107_0082534 3300048910 Bacteria 2344
228 Ga0496107_0098804 3300048910 Bacteria 2138
229 Ga0496108_0179649 3300048911 Bacteria 1832
230 Ga0496108_0255901 3300048911 Bacteria 1523
231 Ga0496109_0003646 3300048912 Bacteria 12871
232 Ga0496109_0013259 3300048912 Bacteria 7139
233 Ga0496109_0041373 3300048912 Bacteria 4174
234 Ga0496109_0078360 3300048912 Bacteria 3042
235 Ga0496109_0658076 3300048912 Bacteria 984
236 Ga0496110_0021704 3300048913 Bacteria 5441
237 Ga0496110_0093177 3300048913 Bacteria 2696
238 Ga0496110_0101048 3300048913 Bacteria 2585
239 Ga0496111_0044088 3300048914 Bacteria 3206
240 Ga0496111_0196111 3300048914 Bacteria 1501
241 Ga0496112_0155792 3300048915 Bacteria 2251
242 Ga0496112_0251550 3300048915 Bacteria 1718
243 Ga0496112_0393081 3300048915 Bacteria 1327
244 Ga0496113_0068788 3300048916 Bacteria 2688
245 Ga0496114_0002279 3300048917 Bacteria 14623
246 Ga0496114_0007223 3300048917 Bacteria 8773
247 Ga0496114_0587369 3300048917 Bacteria 983
248 Ga0496115_0041719 3300048918 Bacteria 3653
249 Ga0496115_0140340 3300048918 Bacteria 1994
250 Ga0496115_0156881 3300048918 Bacteria 1880
251 Ga0496115_0162944 3300048918 Bacteria 1843
252 Ga0496115_0226152 3300048918 Bacteria 1543
253 Ga0496115_0372408 3300048918 Bacteria 1162
254 Ga0496119_0004127 3300048922 Bacteria 14626
255 Ga0496121_0030769 3300048924 Bacteria 4923
256 Ga0501031_0000125 3300049568 Bacteria 42541
257 Ga0501031_0008435 3300049568 Bacteria 6702
258 Ga0501031_0051288 3300049568 Bacteria 2687
259 Ga0501031_0055587 3300049568 Bacteria 2579
260 Ga0501031_0206763 3300049568 Bacteria 1280
261 Ga0501031_0211111 3300049568 Bacteria 1265
262 Ga0501031_0247019 3300049568 Bacteria 1160
263 Ga0501032_0001906 3300049569 Bacteria 16467
264 Ga0501032_0044845 3300049569 Bacteria 2991
265 Ga0501033_0000431 3300049570 Bacteria 40150
266 Ga0501033_0046664 3300049570 Bacteria 3221
267 Ga0501033_0105139 3300049570 Bacteria 2058
268 Ga0501033_0162229 3300049570 Bacteria 1609
269 Ga0501034_0173865 3300049571 Bacteria 2120
270 Ga0501036_0000028 3300049572 Bacteria 94173
271 Ga0501036_0025772 3300049572 Bacteria 4962
272 Ga0501036_0067849 3300049572 Bacteria 3018
273 Ga0501036_0290224 3300049572 Bacteria 1369
274 Ga0501036_0468940 3300049572 Bacteria 1048
275 Ga0501037_0002401 3300049573 Bacteria 13536
276 Ga0501037_0015676 3300049573 Bacteria 5578
277 Ga0501038_0002612 3300049574 Bacteria 16843
278 Ga0501038_0160842 3300049574 Bacteria 1825
279 Ga0501038_0230505 3300049574 Bacteria 1474
280 Ga0501039_0000151 3300049575 Bacteria 47532
281 Ga0501039_0011275 3300049575 Bacteria 6808
282 Ga0501039_0029820 3300049575 Bacteria 4203
283 Ga0501039_0089743 3300049575 Bacteria 2395
284 Ga0501039_0199378 3300049575 Bacteria 1574
285 Ga0501040_0000329 3300049576 Bacteria 27806
286 Ga0501040_0000625 3300049576 Bacteria 21623
287 Ga0501040_0013278 3300049576 Bacteria 5417
288 Ga0501040_0046110 3300049576 Bacteria 2975
289 Ga0501040_0107971 3300049576 Bacteria 1945
290 Ga0501040_0142200 3300049576 Bacteria 1691
291 Ga0501040_0152997 3300049576 Bacteria 1628
292 Ga0501041_0000030 3300049577 Bacteria 45525
293 Ga0501041_0010589 3300049577 Bacteria 5436
294 Ga0501041_0013040 3300049577 Bacteria 4925
295 Ga0501041_0018062 3300049577 Bacteria 4199
296 Ga0501042_0000573 3300049578 Bacteria 19416
297 Ga0501042_0001343 3300049578 Bacteria 14383
298 Ga0501042_0023475 3300049578 Bacteria 4317
299 Ga0501042_0030864 3300049578 Bacteria 3789
300 Ga0501042_0054750 3300049578 Bacteria 2846
301 Ga0501042_0063051 3300049578 Bacteria 2649
302 Ga0501042_0178712 3300049578 Bacteria 1531
303 Ga0501042_0184747 3300049578 Bacteria 1504
304 Ga0501043_0000505 3300049579 Bacteria 35068
305 Ga0501043_0042463 3300049579 Bacteria 3573
306 Ga0501046_0000040 3300049580 Bacteria 155029
307 Ga0501046_0024399 3300049580 Bacteria 4962
308 Ga0501046_0034905 3300049580 Bacteria 4056
309 Ga0501046_0140010 3300049580 Bacteria 1831
310 Ga0501046_0196430 3300049580 Bacteria 1503
311 Ga0501047_0000843 3300049581 Bacteria 31660
312 Ga0501047_0249230 3300049581 Bacteria 1624
313 Ga0501048_0000010 3300049582 Bacteria 80895
314 Ga0501048_0011882 3300049582 Bacteria 6492
315 Ga0501048_0074753 3300049582 Bacteria 2391
316 Ga0501048_0230257 3300049582 Bacteria 1315
317 Ga0501067_0030412 3300049583 Bacteria 2995
318 Ga0501067_0132882 3300049583 Bacteria 1385
319 Ga0501067_0142078 3300049583 Bacteria 1337
320 Ga0501067_0180615 3300049583 Bacteria 1175
321 Ga0501068_0000045 3300049584 Bacteria 47610
322 Ga0501068_0005274 3300049584 Bacteria 7059
323 Ga0501068_0010180 3300049584 Bacteria 5277
324 Ga0501068_0098088 3300049584 Bacteria 1814
325 Ga0501068_0108404 3300049584 Bacteria 1725
326 Ga0501068_0110703 3300049584 Bacteria 1707
327 Ga0501069_0030933 3300049585 Bacteria 2941
328 Ga0501069_0085014 3300049585 Bacteria 1785
329 Ga0501069_0240278 3300049585 Bacteria 1055
330 Ga0501070_0001266 3300049586 Bacteria 22684
331 Ga0501070_0034964 3300049586 Bacteria 4199
332 Ga0501070_0217916 3300049586 Bacteria 1566
333 Ga0501070_0248975 3300049586 Bacteria 1454
334 Ga0501071_0000258 3300049587 Bacteria 24788
335 Ga0501071_0006868 3300049587 Bacteria 7417
336 Ga0501071_0063424 3300049587 Bacteria 2679
337 Ga0501072_0000124 3300049588 Bacteria 57193
338 Ga0501072_0017610 3300049588 Bacteria 5494
339 Ga0501072_0019732 3300049588 Bacteria 5214
340 Ga0501072_0023360 3300049588 Bacteria 4802
341 Ga0501072_0098139 3300049588 Bacteria 2328
342 Ga0501073_0001044 3300049589 Bacteria 20014
343 Ga0501074_0000042 3300049590 Bacteria 59418
344 Ga0501074_0017478 3300049590 Bacteria 5206
345 Ga0501074_0033215 3300049590 Bacteria 3738
346 Ga0501074_0224467 3300049590 Bacteria 1337
347 Ga0501075_0000019 3300049591 Bacteria 68101
348 Ga0501075_0002203 3300049591 Bacteria 12896
349 Ga0501075_0102458 3300049591 Bacteria 2174
350 Ga0501075_0179334 3300049591 Bacteria 1616
351 Ga0501075_0645749 3300049591 Bacteria 807
352 Ga0501076_0000043 3300049592 Bacteria 62174
353 Ga0501076_0001440 3300049592 Bacteria 15990
354 Ga0501076_0006501 3300049592 Bacteria 8480
355 Ga0501076_0027917 3300049592 Bacteria 4378
356 Ga0501076_0048208 3300049592 Bacteria 3368
357 Ga0501076_0061106 3300049592 Bacteria 2998
358 Ga0501076_0386179 3300049592 Bacteria 1151
359 Ga0501076_0524424 3300049592 Bacteria 976
360 Ga0501077_0006516 3300049593 Bacteria 7165
361 Ga0501077_0011086 3300049593 Bacteria 5623
362 Ga0501077_0016606 3300049593 Bacteria 4639
363 Ga0501077_0185445 3300049593 Bacteria 1322
364 Ga0501079_0000035 3300049741 Bacteria 58031
365 Ga0501079_0016362 3300049741 Bacteria 5666
366 Ga0501079_0081622 3300049741 Bacteria 2500
367 Ga0501079_0134410 3300049741 Bacteria 1925
368 Ga0501079_0239028 3300049741 Bacteria 1419
369 Ga0501080_0000029 3300049742 Bacteria 88488
370 Ga0501080_0067613 3300049742 Bacteria 3324
371 Ga0501080_0168251 3300049742 Bacteria 2022
372 Ga0501080_0190271 3300049742 Bacteria 1886
373 Ga0501081_0000255 3300049743 Bacteria 27560
374 Ga0501081_0006263 3300049743 Bacteria 7713
375 Ga0501081_0025824 3300049743 Bacteria 3956
376 Ga0501081_0048774 3300049743 Bacteria 2914
377 Ga0501081_0050076 3300049743 Bacteria 2877
378 Ga0501081_0076485 3300049743 Bacteria 2338
379 Ga0501081_0147225 3300049743 Bacteria 1690
380 Ga0501035_0000757 3300049822 Bacteria 34788
381 Ga0501035_0252630 3300049822 Bacteria 1496
382 Ga0501044_0021083 3300049823 Bacteria 6957
383 Ga0501044_0023392 3300049823 Bacteria 6571
384 Ga0501045_0000601 3300049824 Bacteria 22672
385 Ga0501045_0004928 3300049824 Bacteria 9245
386 Ga0501045_0018226 3300049824 Bacteria 4991
387 Ga0501045_0116218 3300049824 Bacteria 1985
388 Ga0501045_0246127 3300049824 Bacteria 1331
389 nmdc:mga03683_34074_c1 3300050489 Bacteria 2059
390 nmdc:mga03683_5859_c1 3300050489 Bacteria 4176
391 nmdc:mga0yw44_283143_c1 3300050492 Bacteria 1108
392 nmdc:mga05p37_14233_c1 3300050507 Bacteria 9552
393 nmdc:mga05p37_244593_c1 3300050507 Bacteria 2155
394 nmdc:mga05p37_566204_c1 3300050507 Bacteria 1290
395 nmdc:mga05p37_85094_c1 3300050507 Bacteria 3896
396 nmdc:mga09592_395033_c1 3300050508 Bacteria 1195
397 nmdc:mga09592_466217_c1 3300050508 Bacteria 1089
398 nmdc:mga0qj67_199947_c1 3300050509 Bacteria 1624
399 nmdc:mga0qj67_222769_c1 3300050509 Bacteria 1531
400 nmdc:mga0qj67_3202_c1 3300050509 Bacteria 11788
401 nmdc:mga0qj67_344304_c1 3300050509 Bacteria 1205
402 nmdc:mga0qj67_78115_c1 3300050509 Bacteria 2649
403 nmdc:mga06r32_19176_c1 3300050510 Bacteria 6276
404 nmdc:mga06r32_8265_c1 3300050510 Bacteria 9367
405 nmdc:mga06r32_9932_c1 3300050510 Bacteria 8590
406 nmdc:mga08y16_12777_c1 3300050511 Bacteria 8835
407 nmdc:mga08y16_212947_c1 3300050511 Bacteria 2001
408 nmdc:mga08y16_96139_c1 3300050511 Bacteria 3085
409 nmdc:mga0n895_129248_c1 3300050512 Bacteria 2550
410 nmdc:mga0rr50_179342_c1 3300050513 Bacteria 1730
411 nmdc:mga0a205_103729_c1 3300050515 Bacteria 2742
412 nmdc:mga0a205_140055_c1 3300050515 Bacteria 2319
413 nmdc:mga0a205_484735_c1 3300050515 Bacteria 1094
414 Ga0495601_0053311 3300053077 Bacteria 2556
415 Ga0495655_0063352 3300053083 Bacteria 1015
416 Ga0500555_013254 3300053103 Bacteria 2377
417 Ga0500568_0000103 3300053139 Bacteria 78174
418 Ga0501084_0000289 3300054114 Bacteria 38129
419 Ga0501084_0002460 3300054114 Bacteria 14912
420 Ga0501084_0026870 3300054114 Bacteria 4808
421 Ga0501084_0033506 3300054114 Bacteria 4297
422 Ga0501084_0034705 3300054114 Bacteria 4217
423 Ga0501084_0103408 3300054114 Bacteria 2392
424 Ga0501084_0117429 3300054114 Bacteria 2237
425 Ga0501082_0000127 3300060353 Bacteria 61567
426 Ga0501082_0000421 3300060353 Bacteria 37503
427 Ga0501082_0005306 3300060353 Bacteria 11204
428 Ga0501082_0032848 3300060353 Bacteria 4476
429 Ga0501082_0163335 3300060353 Bacteria 1935
430 Ga0501082_0310020 3300060353 Bacteria 1374
431 Ga0501082_0481047 3300060353 Bacteria 1085
432 Ga0466962_0009835 3300061719 Bacteria 4589
433 Ga0530510_0000251 3300061734 Bacteria 33633
434 Ga0530510_0012532 3300061734 Bacteria 5958
435 Ga0530510_0074641 3300061734 Bacteria 2462
436 Ga0530510_0124454 3300061734 Bacteria 1894
437 Ga0530510_0131141 3300061734 Bacteria 1844
438 Ga0530510_0203438 3300061734 Bacteria 1471
439 Ga0530510_0537508 3300061734 Bacteria 887
440 2883294927 2883291878 Bacteria 5894118
441 2924748814 2924748358 Bacteria 6154725
442 nmdc:mga05p37_226049_c1
443 JGI25406J46586_10036164
444 JGI25407J50210_10000113
445 JGI25407J50210_10014623
446 Ga0055542_1000172
447 Ga0070658_10082628
448 Ga0070676_10093092
449 Ga0070683_100127595
450 Ga0070692_10010544
451 Ga0070668_100183930
452 Ga0070668_100371056
453 Ga0070669_100122720
454 Ga0070674_100482644
455 Ga0070659_100324515
456 Ga0070714_100178527
457 Ga0070710_10217210
458 Ga0070711_100085302
459 Ga0070711_100241400
460 Ga0070663_100367827
461 Ga0070678_100001287
462 Ga0070662_100013491
463 Ga0070706_100004153
464 Ga0070707_100004688
465 Ga0070698_100139155
466 Ga0070686_100277425
467 Ga0070695_100084593
468 Ga0070696_100056517
469 Ga0070696_100091989
470 Ga0070665_100028590
471 Ga0070665_100197598
472 Ga0070665_100240295
473 Ga0070704_100184998
474 Ga0070664_100025405
475 Ga0068861_100008198
476 Ga0068861_100037932
477 Ga0068858_100010612
478 Ga0068860_100138845
479 Ga0081455_10019824
480 Ga0081455_10038883
481 Ga0081455_10056572
482 Ga0081455_10070439
483 Ga0081538_10000042
484 Ga0081538_10000987
485 Ga0081538_10002802
486 Ga0081538_10007515
487 Ga0081538_10008457
488 Ga0081538_10031593
489 Ga0081538_10034147
490 Ga0081538_10107338
491 Ga0081539_10004883
492 Ga0075432_10016507
493 Ga0070716_100339993
494 Ga0070712_100082497
495 Ga0075362_10038605
496 Ga0097621_100182810
497 Ga0068871_100419554
498 Ga0075428_100027622
499 Ga0075430_100389141
500 Ga0075431_100007623
501 Ga0075431_100010526
502 Ga0075431_100137083
503 Ga0075431_100264818
504 Ga0075433_10099450
505 Ga0075433_10445315
506 Ga0075434_100008567
507 Ga0075434_100438592
508 Ga0075436_100399261
509 Ga0075435_100153109
510 Ga0099795_10071603
511 Ga0111539_10006793
512 Ga0111539_10259120
513 Ga0111539_10619311
514 Ga0105245_10015294
515 Ga0105247_10026782
516 Ga0114129_10009212
517 Ga0114129_10095937
518 Ga0114129_10195106
519 Ga0114129_10197856
520 Ga0114129_10545841
521 Ga0114129_10816903
522 Ga0105243_10331217
523 Ga0105241_10034697
524 Ga0105242_10032801
525 Ga0105242_10341156
526 Ga0105248_10043842
527 Ga0105249_10024802
528 Ga0105249_10051046
529 Ga0105249_10238979
530 Ga0105249_10487962
531 Ga0099796_10033898
532 Ga0105239_10322296
533 Ga0105239_10389360
534 Ga0105246_10014264
535 Ga0157378_10003506
536 Ga0163162_10057191
537 Ga0163162_10086743
538 Ga0163162_10843121
539 Ga0157375_10188112
540 Ga0157379_10006564
541 Ga0157376_10116678
542 Ga0163161_10376259
543 Ga0207692_10109110
544 Ga0207645_10035419
545 Ga0207705_10200387
546 Ga0207654_10233084
547 Ga0207693_10033822
548 Ga0207663_10014191
549 Ga0207706_10002536
550 Ga0207686_10028224
551 Ga0207709_10055680
552 Ga0207709_10211847
553 Ga0207665_10120858
554 Ga0207711_10417539
555 Ga0207711_10555381
556 Ga0207712_10097016
557 Ga0207668_10090391
558 Ga0207703_10521842
559 Ga0207678_10028536
560 Ga0207708_10447434
561 Ga0207676_10356241
562 Ga0207675_100013767
563 Ga0207675_100049762
564 Ga0207683_10000105
565 Ga0207428_10050976
566 Ga0268266_10016027
567 Ga0268266_10169486
568 Ga0268264_10108584
569 Ga0265318_10024818
570 Ga0265320_10056646
571 Ga0307408_100061396
572 Ga0316579_10003904
573 Ga0307410_10022580
574 Ga0307406_10037139
575 Ga0307406_10039583
576 Ga0307406_10236340
577 Ga0307409_100274143
578 Ga0307416_100045051
579 Ga0307416_100127953
580 Ga0307414_10154585
581 Ga0307415_100000421
582 Ga0307415_100436365
583 Ga0373949_0022013
584 Ga0373941_0047110
585 Ga0373961_0004603
586 Ga0373962_0013400
587 Ga0373937_0434460
588 Ga0395899_0121143
589 Ga0395900_0080450
590 Ga0395898_0569797
591 Ga0436364_1522204
592 Ga0395901_0060095
593 Ga0395901_0256735
594 Ga0395901_0398892
595 Ga0436365_0743095
596 Ga0436365_0949435
597 Ga0436360_1274656
598 Ga0436363_0269896
599 Ga0436362_0079871
600 Ga0450910_006141
601 Ga0450918_018111
602 Ga0466969_0052133
603 Ga0466963_0004685
604 Ga0466963_0132206
605 Ga0466964_0025464
606 Ga0466968_0012291
607 Ga0466970_0010414
608 Ga0466957_0002056
609 Ga0466960_0069219
610 Ga0466960_0082761
611 Ga0466959_0007802
612 Ga0466959_0012779
613 Ga0466959_0147062
614 Ga0466958_0009364
615 Ga0466958_0031007
616 Ga0466958_0043143
617 Ga0466958_0055602
618 Ga0466958_0136248
619 Ga0466958_0337811
620 Ga0466967_0000418
621 Ga0466967_0002534
622 Ga0466967_0104705
623 Ga0466967_0166328
624 Ga0466967_0308759
625 Ga0466967_0698466
626 Ga0495603_0067145
627 Ga0495591_031764
628 Ga0495629_0096728
629 Ga0495584_0074564
630 Ga0495608_0149124
631 Ga0495630_0051160
632 Ga0495631_0120941
633 Ga0495663_0043142
634 Ga0495667_0298728
635 Ga0495667_0341375
636 Ga0495668_0180442
637 Ga0495634_0233151
638 Ga0495589_0061088
639 Ga0495604_0237547
640 Ga0495674_0066979
641 Ga0496100_0024051
642 Ga0496100_0028080
643 Ga0496100_0100130
644 Ga0496100_0204970
645 Ga0496101_0036230
646 Ga0496101_0040271
647 Ga0496101_0125659
648 Ga0496101_0215059
649 Ga0496101_0361966
650 Ga0496102_0001457
651 Ga0496102_0013722
652 Ga0496102_0090096
653 Ga0496102_0151137
654 Ga0496102_0460774
655 Ga0496103_0041556
656 Ga0496103_0165390
657 Ga0496104_0078852
658 Ga0496105_0008694
659 Ga0496105_0027346
660 Ga0496105_0067624
661 Ga0496105_0354978
662 Ga0496106_0013408
663 Ga0496106_0210593
664 Ga0496107_0003703
665 Ga0496107_0008198
666 Ga0496107_0026420
667 Ga0496107_0071368
668 Ga0496107_0082534
669 Ga0496107_0098804
670 Ga0496108_0179649
671 Ga0496108_0255901
672 Ga0496109_0003646
673 Ga0496109_0013259
674 Ga0496109_0041373
675 Ga0496109_0078360
676 Ga0496109_0658076
677 Ga0496110_0021704
678 Ga0496110_0093177
679 Ga0496110_0101048
680 Ga0496111_0044088
681 Ga0496111_0196111
682 Ga0496112_0155792
683 Ga0496112_0251550
684 Ga0496112_0393081
685 Ga0496113_0068788
686 Ga0496114_0002279
687 Ga0496114_0007223
688 Ga0496114_0587369
689 Ga0496115_0041719
690 Ga0496115_0140340
691 Ga0496115_0156881
692 Ga0496115_0162944
693 Ga0496115_0226152
694 Ga0496115_0372408
695 Ga0496119_0004127
696 Ga0496121_0030769
697 Ga0501031_0000125
698 Ga0501031_0008435
699 Ga0501031_0051288
700 Ga0501031_0055587
701 Ga0501031_0206763
702 Ga0501031_0211111
703 Ga0501031_0247019
704 Ga0501032_0001906
705 Ga0501032_0044845
706 Ga0501033_0000431
707 Ga0501033_0046664
708 Ga0501033_0105139
709 Ga0501033_0162229
710 Ga0501034_0173865
711 Ga0501036_0000028
712 Ga0501036_0025772
713 Ga0501036_0067849
714 Ga0501036_0290224
715 Ga0501036_0468940
716 Ga0501037_0002401
717 Ga0501037_0015676
718 Ga0501038_0002612
719 Ga0501038_0160842
720 Ga0501038_0230505
721 Ga0501039_0000151
722 Ga0501039_0011275
723 Ga0501039_0029820
724 Ga0501039_0089743
725 Ga0501039_0199378
726 Ga0501040_0000329
727 Ga0501040_0000625
728 Ga0501040_0013278
729 Ga0501040_0046110
730 Ga0501040_0107971
731 Ga0501040_0142200
732 Ga0501040_0152997
733 Ga0501041_0000030
734 Ga0501041_0010589
735 Ga0501041_0013040
736 Ga0501041_0018062
737 Ga0501042_0000573
738 Ga0501042_0001343
739 Ga0501042_0023475
740 Ga0501042_0030864
741 Ga0501042_0054750
742 Ga0501042_0063051
743 Ga0501042_0178712
744 Ga0501042_0184747
745 Ga0501043_0000505
746 Ga0501043_0042463
747 Ga0501046_0000040
748 Ga0501046_0024399
749 Ga0501046_0034905
750 Ga0501046_0140010
751 Ga0501046_0196430
752 Ga0501047_0000843
753 Ga0501047_0249230
754 Ga0501048_0000010
755 Ga0501048_0011882
756 Ga0501048_0074753
757 Ga0501048_0230257
758 Ga0501067_0030412
759 Ga0501067_0132882
760 Ga0501067_0142078
761 Ga0501067_0180615
762 Ga0501068_0000045
763 Ga0501068_0005274
764 Ga0501068_0010180
765 Ga0501068_0098088
766 Ga0501068_0108404
767 Ga0501068_0110703
768 Ga0501069_0030933
769 Ga0501069_0085014
770 Ga0501069_0240278
771 Ga0501070_0001266
772 Ga0501070_0034964
773 Ga0501070_0217916
774 Ga0501070_0248975
775 Ga0501071_0000258
776 Ga0501071_0006868
777 Ga0501071_0063424
778 Ga0501072_0000124
779 Ga0501072_0017610
780 Ga0501072_0019732
781 Ga0501072_0023360
782 Ga0501072_0098139
783 Ga0501073_0001044
784 Ga0501074_0000042
785 Ga0501074_0017478
786 Ga0501074_0033215
787 Ga0501074_0224467
788 Ga0501075_0000019
789 Ga0501075_0002203
790 Ga0501075_0102458
791 Ga0501075_0179334
792 Ga0501075_0645749
793 Ga0501076_0000043
794 Ga0501076_0001440
795 Ga0501076_0006501
796 Ga0501076_0027917
797 Ga0501076_0048208
798 Ga0501076_0061106
799 Ga0501076_0386179
800 Ga0501076_0524424
801 Ga0501077_0006516
802 Ga0501077_0011086
803 Ga0501077_0016606
804 Ga0501077_0185445
805 Ga0501079_0000035
806 Ga0501079_0016362
807 Ga0501079_0081622
808 Ga0501079_0134410
809 Ga0501079_0239028
810 Ga0501080_0000029
811 Ga0501080_0067613
812 Ga0501080_0168251
813 Ga0501080_0190271
814 Ga0501081_0000255
815 Ga0501081_0006263
816 Ga0501081_0025824
817 Ga0501081_0048774
818 Ga0501081_0050076
819 Ga0501081_0076485
820 Ga0501081_0147225
821 Ga0501035_0000757
822 Ga0501035_0252630
823 Ga0501044_0021083
824 Ga0501044_0023392
825 Ga0501045_0000601
826 Ga0501045_0004928
827 Ga0501045_0018226
828 Ga0501045_0116218
829 Ga0501045_0246127
830 nmdc:mga03683_34074_c1
831 nmdc:mga03683_5859_c1
832 nmdc:mga0yw44_283143_c1
833 nmdc:mga05p37_14233_c1
834 nmdc:mga05p37_244593_c1
835 nmdc:mga05p37_566204_c1
836 nmdc:mga05p37_85094_c1
837 nmdc:mga09592_395033_c1
838 nmdc:mga09592_466217_c1
839 nmdc:mga0qj67_199947_c1
840 nmdc:mga0qj67_222769_c1
841 nmdc:mga0qj67_3202_c1
842 nmdc:mga0qj67_344304_c1
843 nmdc:mga0qj67_78115_c1
844 nmdc:mga06r32_19176_c1
845 nmdc:mga06r32_8265_c1
846 nmdc:mga06r32_9932_c1
847 nmdc:mga08y16_12777_c1
848 nmdc:mga08y16_212947_c1
849 nmdc:mga08y16_96139_c1
850 nmdc:mga0n895_129248_c1
851 nmdc:mga0rr50_179342_c1
852 nmdc:mga0a205_103729_c1
853 nmdc:mga0a205_140055_c1
854 nmdc:mga0a205_484735_c1
855 Ga0495601_0053311
856 Ga0495655_0063352
857 Ga0500555_013254
858 Ga0500568_0000103
859 Ga0501084_0000289
860 Ga0501084_0002460
861 Ga0501084_0026870
862 Ga0501084_0033506
863 Ga0501084_0034705
864 Ga0501084_0103408
865 Ga0501084_0117429
866 Ga0501082_0000127
867 Ga0501082_0000421
868 Ga0501082_0005306
869 Ga0501082_0032848
870 Ga0501082_0163335
871 Ga0501082_0310020
872 Ga0501082_0481047
873 Ga0466962_0009835
874 Ga0530510_0000251
875 Ga0530510_0012532
876 Ga0530510_0074641
877 Ga0530510_0124454
878 Ga0530510_0131141
879 Ga0530510_0203438
880 Ga0530510_0537508
881 2883294927
882 2924748814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

185

313

0.9

PF13522

GATase_6

Glutamine amidotransferase domain

169

307

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ooj-assembly1.cif.gz_F c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.9052 3 298
3ooj-assembly1.cif.gz_G c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.8838 3 298
3ooj-assembly1.cif.gz_E c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.8817 3 298
3ooj-assembly1.cif.gz_B c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.8808 3 298
2j6h-assembly1.cif.gz_A e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine 0.8803 2 298
ID Description Score Start End Superfamily
af_P17169_2_241_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8889 2 298 3.60.20.10
af_Q8IJF3_215_453_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8548 2 298 3.60.20.10
af_P9WN49_2_241_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8467 2 298 3.60.20.10
af_Q10MX3_3_193_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8458 141 296 3.60.20.10
af_P58018_125_356_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8437 104 295 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A2E8BF73-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9865 175 298
AF-A0A0N8T9W8-F1-model_v4 deleted 0.9685 1 302
AF-A0A1J5MMU9-F1-model_v4 Glutamine amidotransferase 0.9619 1 299 GO:0016740
AF-A0A1W6BHZ5-F1-model_v4 glutamine--fructose-6-phosphate transaminase (isomerizing) (EC 2.6.1.16) 0.9604 1 297 GO:0008483
AF-A0A7C1PA32-F1-model_v4 Glutamine amidotransferase 0.9604 203 303 GO:0016740

Map