F444652

General Info

Members Datasets Scaffolds Average Seq Length
441 244 437 115

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10178916|Ga0157371_101789163
Length 126
Sequence LLKLTLKTASMDQTRVFKMSFAGVYPLYIKKAERKGRTKEEVDAIICWLTGYDQQALQNQIDKKIDLQTFFDEAPALNPNATKITGVICGYRVEEIEDKLMQKIRYMDKLVDELAKGKALEKILRK

Samples

Sample ID Description Type Environment
1 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
2 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
3 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
4 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
191 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
233 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
234 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 0.45
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10011515 3300003320 Bacteria 9709
2 rootH2_10063812 3300003320 Bacteria 4652
3 rootH1_10001123 3300003323 Bacteria 32582
4 rootH1_10013541 3300003323 Bacteria 10239
5 Ga0065714_10002194 3300005288 Bacteria 111067
6 Ga0065712_10071173 3300005290 Bacteria 5439
7 Ga0065712_10076109 3300005290 Bacteria 3704
8 Ga0070658_11008621 3300005327 Bacteria 724
9 Ga0070658_11710277 3300005327 Unclassified 544
10 Ga0070676_10015570 3300005328 Bacteria 4196
11 Ga0070683_100147357 3300005329 Bacteria 2231
12 Ga0070683_100160243 3300005329 Bacteria 2135
13 Ga0070683_100407974 3300005329 Bacteria 1296
14 Ga0070670_100214041 3300005331 Bacteria 1676
15 Ga0070670_100862606 3300005331 Bacteria 819
16 Ga0070670_101486591 3300005331 Bacteria 622
17 Ga0068869_100000824 3300005334 Bacteria 17695
18 Ga0068869_100117825 3300005334 Bacteria 2027
19 Ga0068869_100219986 3300005334 Bacteria 1505
20 Ga0068869_100673088 3300005334 Bacteria 880
21 Ga0068869_100909971 3300005334 Bacteria 762
22 Ga0070666_10012781 3300005335 Bacteria 5307
23 Ga0070666_10078447 3300005335 Bacteria 2254
24 Ga0070680_100091839 3300005336 Bacteria 2513
25 Ga0070680_100261036 3300005336 Bacteria 1465
26 Ga0068868_100119292 3300005338 Bacteria 2150
27 Ga0068868_101930982 3300005338 Bacteria 559
28 Ga0070660_100270886 3300005339 Bacteria 1388
29 Ga0070660_100471046 3300005339 Bacteria 1043
30 Ga0070689_100038671 3300005340 Bacteria 3651
31 Ga0070691_11007904 3300005341 Unclassified 520
32 Ga0070687_100286701 3300005343 Bacteria 1039
33 Ga0070661_100015586 3300005344 Bacteria 5364
34 Ga0070668_100086398 3300005347 Bacteria 2466
35 Ga0070669_100053889 3300005353 Bacteria 2945
36 Ga0070669_101338167 3300005353 Bacteria 621
37 Ga0070669_101788444 3300005353 Bacteria 536
38 Ga0070675_100000132 3300005354 Bacteria 44955
39 Ga0070675_100054564 3300005354 Bacteria 3288
40 Ga0070675_100315212 3300005354 Bacteria 1381
41 Ga0070675_100998843 3300005354 Bacteria 768
42 Ga0070675_101007968 3300005354 Bacteria 765
43 Ga0070671_100111911 3300005355 Bacteria 2293
44 Ga0070671_100704122 3300005355 Bacteria 876
45 Ga0070674_100138042 3300005356 Bacteria 1826
46 Ga0070673_100012041 3300005364 Bacteria 5926
47 Ga0070673_100316294 3300005364 Bacteria 1378
48 Ga0070673_100632266 3300005364 Unclassified 978
49 Ga0070688_100051357 3300005365 Bacteria 2572
50 Ga0070688_100735675 3300005365 Bacteria 767
51 Ga0070659_100007954 3300005366 Bacteria 7726
52 Ga0070659_100486372 3300005366 Bacteria 1051
53 Ga0070659_100541122 3300005366 Bacteria 996
54 Ga0070667_100010737 3300005367 Bacteria 7568
55 Ga0070667_100424371 3300005367 Bacteria 1213
56 Ga0070667_100752091 3300005367 Bacteria 903
57 Ga0070667_101167491 3300005367 Unclassified 720
58 Ga0070713_100299041 3300005436 Bacteria 1481
59 Ga0070713_100329699 3300005436 Bacteria 1411
60 Ga0070701_10903567 3300005438 Bacteria 610
61 Ga0070700_101768796 3300005441 Bacteria 532
62 Ga0070708_101301136 3300005445 Bacteria 679
63 Ga0070663_100229321 3300005455 Bacteria 1462
64 Ga0070678_100071188 3300005456 Bacteria 2603
65 Ga0070678_100347707 3300005456 Bacteria 1274
66 Ga0070681_10147045 3300005458 Bacteria 2285
67 Ga0070685_10020865 3300005466 Bacteria 3551
68 Ga0070685_10060162 3300005466 Bacteria 2220
69 Ga0070685_10121234 3300005466 Bacteria 1624
70 Ga0070706_100528396 3300005467 Bacteria 1097
71 Ga0070679_100179567 3300005530 Bacteria 2089
72 Ga0070679_100179736 3300005530 Bacteria 2088
73 Ga0070684_100141367 3300005535 Bacteria 2177
74 Ga0070684_101498158 3300005535 Bacteria 636
75 Ga0070672_100010123 3300005543 Bacteria 6530
76 Ga0070672_100091930 3300005543 Bacteria 2449
77 Ga0070672_100455235 3300005543 Bacteria 1103
78 Ga0070672_100474672 3300005543 Bacteria 1079
79 Ga0070672_100558009 3300005543 Bacteria 995
80 Ga0070686_100269992 3300005544 Bacteria 1250
81 Ga0070665_100000442 3300005548 Bacteria 60619
82 Ga0070665_100173433 3300005548 Bacteria 2158
83 Ga0070665_100277243 3300005548 Bacteria 1679
84 Ga0070665_101802010 3300005548 Bacteria 619
85 Ga0070704_100635048 3300005549 Bacteria 941
86 Ga0070704_100936074 3300005549 Bacteria 781
87 Ga0068855_100113043 3300005563 Bacteria 3116
88 Ga0068855_100536309 3300005563 Bacteria 1268
89 Ga0068855_100697031 3300005563 Bacteria 1087
90 Ga0070664_100019667 3300005564 Bacteria 5557
91 Ga0068857_100380853 3300005577 Bacteria 1310
92 Ga0068857_100390915 3300005577 Bacteria 1293
93 Ga0068857_101623057 3300005577 Bacteria 631
94 Ga0068857_102292657 3300005577 Bacteria 530
95 Ga0068854_100151671 3300005578 Bacteria 1788
96 Ga0068856_100003990 3300005614 Bacteria 14784
97 Ga0068856_100642478 3300005614 Bacteria 1082
98 Ga0070702_100997944 3300005615 Bacteria 662
99 Ga0068852_101473255 3300005616 Unclassified 703
100 Ga0068859_100008549 3300005617 Bacteria 10356
101 Ga0068859_100029283 3300005617 Bacteria 5525
102 Ga0068859_100058913 3300005617 Bacteria 3869
103 Ga0068859_102365791 3300005617 Unclassified 586
104 Ga0068864_100204361 3300005618 Bacteria 1816
105 Ga0068864_100523989 3300005618 Bacteria 1143
106 Ga0068864_102355698 3300005618 Bacteria 539
107 Ga0068866_10116656 3300005718 Bacteria 1498
108 Ga0068861_100052171 3300005719 Bacteria 3108
109 Ga0068870_10223347 3300005840 Bacteria 1154
110 Ga0068863_100147532 3300005841 Bacteria 2250
111 Ga0068863_100199136 3300005841 Unclassified 1926
112 Ga0068863_100869250 3300005841 Bacteria 901
113 Ga0068858_100101040 3300005842 Bacteria 2690
114 Ga0068858_100350607 3300005842 Bacteria 1414
115 Ga0068858_101353256 3300005842 Bacteria 701
116 Ga0068860_100025373 3300005843 Bacteria 5719
117 Ga0068860_100161201 3300005843 Bacteria 2162
118 Ga0068862_100572676 3300005844 Bacteria 1081
119 Ga0075368_10470770 3300006042 Bacteria 558
120 Ga0075364_10067455 3300006051 Bacteria 2351
121 Ga0075432_10365355 3300006058 Bacteria 615
122 Ga0075362_10135882 3300006177 Bacteria 1173
123 Ga0097621_100021727 3300006237 Bacteria 4971
124 Ga0097621_100069948 3300006237 Bacteria 2898
125 Ga0097621_100194731 3300006237 Bacteria 1757
126 Ga0097621_100560655 3300006237 Bacteria 1041
127 Ga0097621_100664845 3300006237 Bacteria 957
128 Ga0068871_100001750 3300006358 Bacteria 14634
129 Ga0068871_100064806 3300006358 Bacteria 2992
130 Ga0068871_100103942 3300006358 Bacteria 2382
131 Ga0068871_100209430 3300006358 Bacteria 1686
132 Ga0068871_100669078 3300006358 Bacteria 949
133 Ga0075428_100068233 3300006844 Bacteria 3890
134 Ga0075428_100350047 3300006844 Bacteria 1586
135 Ga0075430_100006345 3300006846 Bacteria 9974
136 Ga0075431_100035304 3300006847 Bacteria 5146
137 Ga0075433_10793634 3300006852 Bacteria 827
138 Ga0075434_100149350 3300006871 Bacteria 2357
139 Ga0075429_100147349 3300006880 Bacteria 2060
140 Ga0075429_100455107 3300006880 Bacteria 1121
141 Ga0068865_100256562 3300006881 Bacteria 1382
142 Ga0075436_100463698 3300006914 Bacteria 924
143 Ga0097620_100008549 3300006931 Bacteria 10356
144 Ga0097620_100029283 3300006931 Bacteria 5525
145 Ga0097620_100058913 3300006931 Bacteria 3869
146 Ga0097620_102365544 3300006931 Unclassified 586
147 Ga0105240_10078354 3300009093 Bacteria 4070
148 Ga0105240_10234083 3300009093 Bacteria 2133
149 Ga0105240_10356823 3300009093 Bacteria 1657
150 Ga0105240_12281855 3300009093 Bacteria 561
151 Ga0111539_10420346 3300009094 Bacteria 1557
152 Ga0111539_11599377 3300009094 Bacteria 756
153 Ga0105245_10371948 3300009098 Bacteria 1421
154 Ga0114129_11523455 3300009147 Bacteria 821
155 Ga0105243_11298410 3300009148 Bacteria 745
156 Ga0105241_10004950 3300009174 Bacteria 9827
157 Ga0105241_10164105 3300009174 Bacteria 1829
158 Ga0105241_10719624 3300009174 Unclassified 913
159 Ga0105242_10071789 3300009176 Bacteria 2874
160 Ga0105242_10101319 3300009176 Bacteria 2440
161 Ga0105242_10600940 3300009176 Bacteria 1063
162 Ga0105242_11546808 3300009176 Bacteria 695
163 Ga0105248_10042830 3300009177 Bacteria 5076
164 Ga0105248_10174783 3300009177 Bacteria 2421
165 Ga0105237_10314787 3300009545 Bacteria 1568
166 Ga0105249_10002726 3300009553 Bacteria 15275
167 Ga0105249_10049822 3300009553 Bacteria 3819
168 Ga0105249_10109296 3300009553 Bacteria 2611
169 Ga0105249_10234172 3300009553 Bacteria 1812
170 Ga0105249_10535907 3300009553 Bacteria 1220
171 Ga0105239_10123266 3300010375 Bacteria 2880
172 Ga0105239_11771551 3300010375 Bacteria 715
173 Ga0105246_10021614 3300011119 Bacteria 4142
174 Ga0105246_10101427 3300011119 Bacteria 2096
175 Ga0105246_10774384 3300011119 Bacteria 849
176 Ga0157373_10002675 3300013100 Bacteria 13513
177 Ga0157373_10025190 3300013100 Bacteria 4306
178 Ga0157373_10205524 3300013100 Bacteria 1389
179 Ga0157371_10178916 3300013102 Bacteria 1517
180 Ga0157370_10015874 3300013104 Bacteria 7641
181 Ga0157370_10174927 3300013104 Bacteria 1995
182 Ga0157370_10198550 3300013104 Bacteria 1861
183 Ga0157369_10176551 3300013105 Bacteria 2249
184 Ga0157369_10594352 3300013105 Bacteria 1143
185 Ga0157369_10770043 3300013105 Bacteria 989
186 Ga0157369_10882656 3300013105 Bacteria 917
187 Ga0157374_10004368 3300013296 Bacteria 11900
188 Ga0157374_10022899 3300013296 Bacteria 5579
189 Ga0157374_10411932 3300013296 Bacteria 1349
190 Ga0157378_10288020 3300013297 Bacteria 1585
191 Ga0157378_10469528 3300013297 Bacteria 1252
192 Ga0163162_10030639 3300013306 Bacteria 5330
193 Ga0163162_10054907 3300013306 Bacteria 4008
194 Ga0163162_10158765 3300013306 Bacteria 2382
195 Ga0163162_10623713 3300013306 Bacteria 1203
196 Ga0157372_10066962 3300013307 Bacteria 4035
197 Ga0157372_10284611 3300013307 Bacteria 1922
198 Ga0157372_10301862 3300013307 Bacteria 1862
199 Ga0157372_10410949 3300013307 Bacteria 1577
200 Ga0157372_10953286 3300013307 Bacteria 995
201 Ga0157375_10015620 3300013308 Bacteria 6802
202 Ga0157375_10033149 3300013308 Bacteria 4905
203 Ga0157375_10231747 3300013308 Bacteria 2006
204 Ga0157375_10696872 3300013308 Unclassified 1169
205 Ga0157375_11819966 3300013308 Bacteria 722
206 Ga0163163_10019486 3300014325 Bacteria 6372
207 Ga0157380_10041358 3300014326 Bacteria 3597
208 Ga0157380_10122869 3300014326 Bacteria 2202
209 Ga0157380_10161953 3300014326 Bacteria 1945
210 Ga0157380_10417518 3300014326 Bacteria 1278
211 Ga0157377_10043132 3300014745 Bacteria 2509
212 Ga0157377_10324748 3300014745 Bacteria 1024
213 Ga0157379_10022917 3300014968 Bacteria 5535
214 Ga0157376_10007990 3300014969 Bacteria 7593
215 Ga0157376_10146603 3300014969 Bacteria 2124
216 Ga0157376_10160754 3300014969 Bacteria 2036
217 Ga0157376_10427167 3300014969 Unclassified 1287
218 Ga0157376_10937604 3300014969 Bacteria 886
219 Ga0157376_12873484 3300014969 Bacteria 521
220 Ga0182007_10055918 3300015262 Bacteria 1296
221 Ga0163161_10010043 3300017792 Bacteria 6554
222 Ga0163161_11066603 3300017792 Bacteria 693
223 Ga0213876_10179589 3300021384 Bacteria 1126
224 Ga0209026_1000844 3300025250 Bacteria 16149
225 Ga0207697_10023313 3300025315 Bacteria 2534
226 Ga0207697_10068244 3300025315 Bacteria 1487
227 Ga0207656_10356564 3300025321 Bacteria 731
228 Ga0207682_10155554 3300025893 Bacteria 1033
229 Ga0207642_10481911 3300025899 Bacteria 757
230 Ga0207688_10581396 3300025901 Bacteria 705
231 Ga0207680_10156424 3300025903 Bacteria 1524
232 Ga0207680_10708643 3300025903 Bacteria 721
233 Ga0207647_10013145 3300025904 Bacteria 5750
234 Ga0207647_10208701 3300025904 Bacteria 1128
235 Ga0207645_10018735 3300025907 Bacteria 4547
236 Ga0207643_10089829 3300025908 Bacteria 1790
237 Ga0207643_10440260 3300025908 Bacteria 828
238 Ga0207654_10378183 3300025911 Bacteria 980
239 Ga0207654_10930184 3300025911 Unclassified 631
240 Ga0207707_10302961 3300025912 Bacteria 1382
241 Ga0207695_10005702 3300025913 Bacteria 16420
242 Ga0207695_10452288 3300025913 Bacteria 1167
243 Ga0207695_10761023 3300025913 Bacteria 849
244 Ga0207660_10032554 3300025917 Bacteria 3599
245 Ga0207662_10104850 3300025918 Bacteria 1756
246 Ga0207657_10082599 3300025919 Unclassified 2697
247 Ga0207657_10666564 3300025919 Bacteria 809
248 Ga0207652_10001149 3300025921 Bacteria 23813
249 Ga0207652_10194317 3300025921 Bacteria 1825
250 Ga0207652_11395279 3300025921 Unclassified 604
251 Ga0207681_10407946 3300025923 Bacteria 1099
252 Ga0207681_10524906 3300025923 Bacteria 972
253 Ga0207681_11074225 3300025923 Bacteria 676
254 Ga0207650_10026536 3300025925 Bacteria 4133
255 Ga0207650_10110949 3300025925 Bacteria 2123
256 Ga0207650_10314681 3300025925 Bacteria 1281
257 Ga0207650_10814087 3300025925 Bacteria 792
258 Ga0207659_10000063 3300025926 Bacteria 67205
259 Ga0207659_10084624 3300025926 Bacteria 2354
260 Ga0207659_10703367 3300025926 Bacteria 865
261 Ga0207659_10854862 3300025926 Bacteria 782
262 Ga0207659_10970915 3300025926 Bacteria 731
263 Ga0207659_11844057 3300025926 Bacteria 513
264 Ga0207644_10129606 3300025931 Bacteria 1929
265 Ga0207706_10224631 3300025933 Bacteria 1644
266 Ga0207686_10083911 3300025934 Bacteria 2086
267 Ga0207686_11191466 3300025934 Bacteria 623
268 Ga0207709_10727319 3300025935 Bacteria 796
269 Ga0207670_10026209 3300025936 Bacteria 3671
270 Ga0207670_10233657 3300025936 Bacteria 1413
271 Ga0207669_10326463 3300025937 Bacteria 1176
272 Ga0207669_10488609 3300025937 Bacteria 983
273 Ga0207669_10662113 3300025937 Bacteria 855
274 Ga0207704_10180202 3300025938 Bacteria 1526
275 Ga0207691_10021716 3300025940 Bacteria 6059
276 Ga0207691_10197266 3300025940 Bacteria 1753
277 Ga0207711_10001259 3300025941 Bacteria 24037
278 Ga0207689_10002805 3300025942 Bacteria 16095
279 Ga0207689_10007844 3300025942 Bacteria 9332
280 Ga0207689_10145969 3300025942 Bacteria 1949
281 Ga0207689_10577328 3300025942 Bacteria 945
282 Ga0207689_11639733 3300025942 Bacteria 534
283 Ga0207661_10254858 3300025944 Bacteria 1561
284 Ga0207661_10302569 3300025944 Bacteria 1434
285 Ga0207661_10831199 3300025944 Bacteria 850
286 Ga0207679_10061272 3300025945 Bacteria 2800
287 Ga0207679_10374348 3300025945 Bacteria 1247
288 Ga0207667_10001143 3300025949 Bacteria 33339
289 Ga0207667_10173377 3300025949 Bacteria 2217
290 Ga0207667_10765610 3300025949 Bacteria 964
291 Ga0207651_10032769 3300025960 Bacteria 3342
292 Ga0207651_11614893 3300025960 Bacteria 584
293 Ga0207712_10001133 3300025961 Bacteria 18560
294 Ga0207712_10313326 3300025961 Bacteria 1292
295 Ga0207712_10469136 3300025961 Bacteria 1071
296 Ga0207668_11305609 3300025972 Bacteria 653
297 Ga0207668_11695097 3300025972 Bacteria 571
298 Ga0207640_10249148 3300025981 Bacteria 1377
299 Ga0207658_10023121 3300025986 Bacteria 4335
300 Ga0207658_10817970 3300025986 Unclassified 846
301 Ga0207677_10208040 3300026023 Bacteria 1560
302 Ga0207677_10946715 3300026023 Bacteria 779
303 Ga0207703_10017470 3300026035 Bacteria 5598
304 Ga0207703_10137466 3300026035 Bacteria 2117
305 Ga0207703_12341906 3300026035 Bacteria 510
306 Ga0207639_11926498 3300026041 Bacteria 552
307 Ga0207678_10038539 3300026067 Unclassified 4153
308 Ga0207702_10000196 3300026078 Bacteria 71703
309 Ga0207702_10677096 3300026078 Bacteria 1016
310 Ga0207641_10028597 3300026088 Bacteria 4606
311 Ga0207641_10227736 3300026088 Bacteria 1731
312 Ga0207641_10485437 3300026088 Unclassified 1198
313 Ga0207641_11718194 3300026088 Bacteria 629
314 Ga0207648_10002623 3300026089 Bacteria 19251
315 Ga0207648_11576673 3300026089 Bacteria 617
316 Ga0207676_10096862 3300026095 Bacteria 2436
317 Ga0207676_10390189 3300026095 Bacteria 1298
318 Ga0207676_10734683 3300026095 Bacteria 959
319 Ga0207676_12031611 3300026095 Bacteria 573
320 Ga0207674_11709487 3300026116 Bacteria 597
321 Ga0207674_12135809 3300026116 Bacteria 524
322 Ga0207675_100110326 3300026118 Bacteria 2596
323 Ga0207675_102584564 3300026118 Bacteria 518
324 Ga0207683_10020712 3300026121 Bacteria 5627
325 Ga0207683_10202757 3300026121 Bacteria 1803
326 Ga0207698_10277406 3300026142 Bacteria 1549
327 Ga0207698_10359904 3300026142 Bacteria 1377
328 Ga0207698_10933895 3300026142 Bacteria 876
329 Ga0207698_11816804 3300026142 Bacteria 625
330 Ga0209969_1031567 3300027360 Bacteria 810
331 Ga0209981_1028707 3300027378 Bacteria 812
332 Ga0209995_1019364 3300027471 Bacteria 1123
333 Ga0209968_1075956 3300027526 Bacteria 601
334 Ga0209999_1029269 3300027543 Bacteria 1022
335 Ga0209974_10239380 3300027876 Bacteria 680
336 Ga0207428_10042352 3300027907 Unclassified 3682
337 Ga0268266_10278418 3300028379 Bacteria 1555
338 Ga0268266_10411802 3300028379 Bacteria 1280
339 Ga0268266_10765760 3300028379 Bacteria 932
340 Ga0268266_11045934 3300028379 Bacteria 790
341 Ga0268264_10018690 3300028381 Bacteria 5666
342 Ga0268264_10958800 3300028381 Bacteria 861
343 Ga0307517_10410946 3300028786 Bacteria 713
344 Ga0307515_10431508 3300028794 Bacteria 936
345 Ga0265327_10000254 3300031251 Bacteria 106076
346 Ga0265327_10082917 3300031251 Bacteria 1579
347 Ga0307513_10255684 3300031456 Bacteria 1545
348 Ga0307509_10828490 3300031507 Unclassified 590
349 Ga0307408_100005435 3300031548 Bacteria 8532
350 Ga0316576_10549858 3300031727 Bacteria 846
351 Ga0307405_10087254 3300031731 Bacteria 2056
352 Ga0307406_10000094 3300031901 Bacteria 50309
353 Ga0307407_10014946 3300031903 Bacteria 3817
354 Ga0307412_10410982 3300031911 Bacteria 1104
355 Ga0307416_102589836 3300032002 Bacteria 605
356 Ga0307414_10000011 3300032004 Bacteria 338253
357 Ga0373928_0164818 3300035084 Bacteria 622
358 Ga0373946_0305313 3300035171 Bacteria 788
359 Ga0373937_0512346 3300036401 Bacteria 1140
360 Ga0316584_0094994 3300036712 Bacteria 2232
361 Ga0316584_0794115 3300036712 Bacteria 643
362 Ga0373925_0832368 3300037068 Bacteria 761
363 Ga0395899_0076014 3300037312 Bacteria 2452
364 Ga0395899_0914801 3300037312 Bacteria 534
365 Ga0395898_0345340 3300037466 Bacteria 1419
366 Ga0395905_0420973 3300037471 Bacteria 1232
367 Ga0395901_0738715 3300038443 Bacteria 978
368 Ga0242420_032401 3300038996 Bacteria 974
369 Ga0436365_1048186 3300039437 Bacteria 1992
370 Ga0451793_1606476 3300041452 Bacteria 1295
371 Ga0451798_0224035 3300041458 Bacteria 1008
372 Ga0451855_0007143 3300041511 Bacteria 511
373 Ga0439449_0410455 3300042007 Bacteria 514
374 Ga0439462_0182132 3300042015 Bacteria 596
375 Ga0451577_0140797 3300042876 Bacteria 2167
376 Ga0451577_0378717 3300042876 Bacteria 1284
377 Ga0451577_1122534 3300042876 Bacteria 703
378 Ga0453684_0000462 3300044712 Bacteria 162338
379 Ga0453684_0022557 3300044712 Bacteria 9331
380 Ga0453684_0033523 3300044712 Bacteria 7156
381 Ga0453684_0219449 3300044712 Unclassified 2203
382 Ga0453684_0430392 3300044712 Unclassified 1472
383 Ga0451576_0634985 3300045051 Bacteria 1122
384 Ga0495629_0113581 3300046459 Bacteria 1888
385 Ga0495653_0358161 3300046463 Bacteria 937
386 Ga0495664_0591444 3300046477 Bacteria 660
387 Ga0495584_0555588 3300046491 Bacteria 585
388 Ga0495585_0612162 3300046492 Bacteria 512
389 Ga0495608_0734660 3300046511 Bacteria 586
390 Ga0495666_0549433 3300046526 Bacteria 515
391 Ga0495652_0877708 3300046529 Bacteria 593
392 Ga0495667_0053641 3300046559 Bacteria 2655
393 Ga0495634_0809044 3300046642 Bacteria 534
394 Ga0495635_0104064 3300046663 Bacteria 1940
395 Ga0495659_0082961 3300046664 Bacteria 1220
396 Ga0495657_0143447 3300046675 Bacteria 1487
397 Ga0495623_0046310 3300046679 Bacteria 2761
398 Ga0495658_0375827 3300046683 Bacteria 904
399 Ga0495613_0131313 3300046689 Bacteria 1793
400 Ga0495600_0176547 3300046809 Bacteria 1377
401 Ga0495581_0039403 3300047315 Bacteria 2735
402 Ga0495604_0035817 3300047317 Bacteria 3917
403 Ga0495674_1256494 3300047319 Bacteria 557
404 Ga0495672_0016866 3300047320 Bacteria 4902
405 Ga0495687_000879 3300047443 Bacteria 31853
406 Ga0495675_0044611 3300047444 Bacteria 2824
407 Ga0495684_0020719 3300047471 Bacteria 5066
408 Ga0495684_0039006 3300047471 Bacteria 3641
409 Ga0495686_0030504 3300047472 Bacteria 3501
410 Ga0501299_174589 3300049522 Bacteria 558
411 Ga0501032_0490829 3300049569 Unclassified 785
412 Ga0501033_0050754 3300049570 Bacteria 3076
413 Ga0501034_0037401 3300049571 Bacteria 4914
414 Ga0501034_0108785 3300049571 Bacteria 2763
415 Ga0501034_0123155 3300049571 Bacteria 2579
416 Ga0501038_0632702 3300049574 Unclassified 807
417 Ga0501070_0093179 3300049586 Bacteria 2492
418 Ga0501076_1622425 3300049592 Bacteria 531
419 Ga0501233_130830 3300049668 Bacteria 686
420 Ga0501238_000110 3300049671 Bacteria 13246
421 Ga0501238_000454 3300049671 Bacteria 4760
422 Ga0501249_000012 3300049679 Bacteria 153759
423 Ga0501249_075702 3300049679 Bacteria 788
424 Ga0501241_011103 3300049758 Bacteria 1636
425 Ga0501266_006202 3300049763 Bacteria 1488
426 Ga0501280_005919 3300049776 Bacteria 1736
427 Ga0501035_0004612 3300049822 Bacteria 13073
428 Ga0501044_0127304 3300049823 Bacteria 2543
429 nmdc:mga00v17_102209_c1 3300050491 Bacteria 1810
430 nmdc:mga09592_1484704_c1 3300050508 Bacteria 552
431 nmdc:mga08y16_37064_c1 3300050511 Bacteria 5120
432 nmdc:mga08y16_78724_c1 3300050511 Bacteria 3436
433 nmdc:mga0a205_262389_c1 3300050515 Bacteria 1605
434 Ga0500650_0300122 3300053098 Bacteria 711
435 Ga0500607_000146 3300053121 Bacteria 59939
436 Ga0500568_0030729 3300053139 Bacteria 2222
437 Ga0500573_0174674 3300053140 Bacteria 1159

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_101930982 Ga0068868_1019309821 104
2 3300025321 Ga0207656_10356564 Ga0207656_103565642 104
3 3300021384 Ga0213876_10179589 Ga0213876_101795892 106
4 3300039437 Ga0436365_1048186 Ga0436365_1048186_1169_1519 106
5 3300026142 Ga0207698_11816804 Ga0207698_118168042 107
6 3300032002 Ga0307416_102589836 Ga0307416_1025898362 107
7 3300053098 Ga0500650_0300122 Ga0500650_0300122_180_503 107
8 3300005290 Ga0065712_10071173 Ga0065712_100711734 108
9 3300005338 Ga0068868_100119292 Ga0068868_1001192922 108
10 3300005340 Ga0070689_100038671 Ga0070689_1000386714 108
11 3300005354 Ga0070675_100315212 Ga0070675_1003152121 108
12 3300005354 Ga0070675_101007968 Ga0070675_1010079681 108
13 3300005365 Ga0070688_100051357 Ga0070688_1000513572 108
14 3300005366 Ga0070659_100007954 Ga0070659_1000079547 108
15 3300005367 Ga0070667_100752091 Ga0070667_1007520911 108
16 3300005466 Ga0070685_10020865 Ga0070685_100208654 108
17 3300005548 Ga0070665_101802010 Ga0070665_1018020101 108
18 3300005577 Ga0068857_100380853 Ga0068857_1003808532 108
19 3300005618 Ga0068864_102355698 Ga0068864_1023556982 108
20 3300005719 Ga0068861_100052171 Ga0068861_1000521714 108
21 3300005841 Ga0068863_100147532 Ga0068863_1001475324 108
22 3300005842 Ga0068858_100350607 Ga0068858_1003506071 108
23 3300005844 Ga0068862_100572676 Ga0068862_1005726761 108
24 3300006358 Ga0068871_100669078 Ga0068871_1006690782 108
25 3300009093 Ga0105240_10078354 Ga0105240_100783544 108
26 3300009174 Ga0105241_10004950 Ga0105241_100049503 108
27 3300009174 Ga0105241_10164105 Ga0105241_101641052 108
28 3300009176 Ga0105242_10101319 Ga0105242_101013194 108
29 3300009176 Ga0105242_10600940 Ga0105242_106009402 108
30 3300009176 Ga0105242_11546808 Ga0105242_115468081 108
31 3300009177 Ga0105248_10174783 Ga0105248_101747833 108
32 3300009545 Ga0105237_10314787 Ga0105237_103147872 108
33 3300009553 Ga0105249_10002726 Ga0105249_1000272617 108
34 3300009553 Ga0105249_10109296 Ga0105249_101092963 108
35 3300010375 Ga0105239_10123266 Ga0105239_101232663 108
36 3300011119 Ga0105246_10021614 Ga0105246_100216143 108
37 3300011119 Ga0105246_10101427 Ga0105246_101014273 108
38 3300013100 Ga0157373_10002675 Ga0157373_1000267517 108
39 3300013100 Ga0157373_10025190 Ga0157373_100251903 108
40 3300013104 Ga0157370_10198550 Ga0157370_101985502 108
41 3300013105 Ga0157369_10176551 Ga0157369_101765513 108
42 3300013105 Ga0157369_10594352 Ga0157369_105943522 108
43 3300013296 Ga0157374_10004368 Ga0157374_1000436810 108
44 3300013296 Ga0157374_10022899 Ga0157374_100228995 108
45 3300013296 Ga0157374_10411932 Ga0157374_104119321 108
46 3300013297 Ga0157378_10469528 Ga0157378_104695281 108
47 3300013306 Ga0163162_10054907 Ga0163162_100549074 108
48 3300013306 Ga0163162_10158765 Ga0163162_101587653 108
49 3300013306 Ga0163162_10623713 Ga0163162_106237131 108
50 3300013307 Ga0157372_10066962 Ga0157372_100669623 108
51 3300013307 Ga0157372_10953286 Ga0157372_109532862 108
52 3300013308 Ga0157375_10015620 Ga0157375_100156202 108
53 3300013308 Ga0157375_10033149 Ga0157375_100331495 108
54 3300013308 Ga0157375_10231747 Ga0157375_102317473 108
55 3300013308 Ga0157375_11819966 Ga0157375_118199662 108
56 3300014326 Ga0157380_10041358 Ga0157380_100413582 108
57 3300014745 Ga0157377_10324748 Ga0157377_103247481 108
58 3300014969 Ga0157376_10427167 Ga0157376_104271671 108
59 3300014969 Ga0157376_10937604 Ga0157376_109376042 108
60 3300015262 Ga0182007_10055918 Ga0182007_100559182 108
61 3300017792 Ga0163161_10010043 Ga0163161_100100436 108
62 3300025893 Ga0207682_10155554 Ga0207682_101555542 108
63 3300025899 Ga0207642_10481911 Ga0207642_104819112 108
64 3300025934 Ga0207686_11191466 Ga0207686_111914661 108
65 3300025936 Ga0207670_10026209 Ga0207670_100262092 108
66 3300025961 Ga0207712_10001133 Ga0207712_1000113317 108
67 3300025972 Ga0207668_11305609 Ga0207668_113056091 108
68 3300026023 Ga0207677_10946715 Ga0207677_109467152 108
69 3300026035 Ga0207703_10137466 Ga0207703_101374664 108
70 3300026088 Ga0207641_10485437 Ga0207641_104854372 108
71 3300026088 Ga0207641_11718194 Ga0207641_117181941 108
72 3300026095 Ga0207676_10734683 Ga0207676_107346832 108
73 3300026095 Ga0207676_12031611 Ga0207676_120316111 108
74 3300026116 Ga0207674_11709487 Ga0207674_117094871 108
75 3300026118 Ga0207675_100110326 Ga0207675_1001103264 108
76 3300026142 Ga0207698_10933895 Ga0207698_109338951 108
77 3300028381 Ga0268264_10958800 Ga0268264_109588002 108
78 3300031251 Ga0265327_10000254 Ga0265327_100002544 108
79 3300036401 Ga0373937_0512346 Ga0373937_0512346_405_731 108
80 3300037068 Ga0373925_0832368 Ga0373925_0832368_76_402 108
81 3300037471 Ga0395905_0420973 Ga0395905_0420973_807_1133 108
82 3300038996 Ga0242420_032401 Ga0242420_032401_157_483 108
83 3300042007 Ga0439449_0410455 Ga0439449_0410455_71_397 108
84 3300042015 Ga0439462_0182132 Ga0439462_0182132_210_536 108
85 3300044712 Ga0453684_0033523 Ga0453684_0033523_3622_3948 108
86 3300046463 Ga0495653_0358161 Ga0495653_0358161_589_915 108
87 3300046491 Ga0495584_0555588 Ga0495584_0555588_97_423 108
88 3300046526 Ga0495666_0549433 Ga0495666_0549433_100_426 108
89 3300046663 Ga0495635_0104064 Ga0495635_0104064_533_859 108
90 3300046679 Ga0495623_0046310 Ga0495623_0046310_1857_2183 108
91 3300047443 Ga0495687_000879 Ga0495687_000879_2526_2852 108
92 3300047471 Ga0495684_0039006 Ga0495684_0039006_3018_3344 108
93 3300047472 Ga0495686_0030504 Ga0495686_0030504_2349_2675 108
94 3300049571 Ga0501034_0123155 Ga0501034_0123155_2202_2528 108
95 3300053140 Ga0500573_0174674 Ga0500573_0174674_436_762 108
96 3300014969 Ga0157376_10146603 Ga0157376_101466033 109
97 iso_pu_bacteria 2857613821 2857617903 112
98 iso_pu_bacteria 2904419702 2904423096 112
99 3300005344 Ga0070661_100015586 Ga0070661_1000155863 113
100 3300005366 Ga0070659_100486372 Ga0070659_1004863722 113
101 3300005455 Ga0070663_100229321 Ga0070663_1002293212 113
102 3300025315 Ga0207697_10023313 Ga0207697_100233131 113
103 3300025945 Ga0207679_10061272 Ga0207679_100612721 113
104 3300026067 Ga0207678_10038539 Ga0207678_100385392 113
105 3300042876 Ga0451577_0378717 Ga0451577_0378717_633_974 113
106 iso_pu_bacteria 2643221699 2644548488 113
107 iso_pu_bacteria 2919462493 2919466772 113
108 3300005290 Ga0065712_10076109 Ga0065712_100761095 115
109 3300005331 Ga0070670_101486591 Ga0070670_1014865911 115
110 3300005334 Ga0068869_100000824 Ga0068869_1000008243 115
111 3300005353 Ga0070669_101788444 Ga0070669_1017884441 115
112 3300005354 Ga0070675_100054564 Ga0070675_1000545642 115
113 3300005364 Ga0070673_100632266 Ga0070673_1006322662 115
114 3300005543 Ga0070672_100558009 Ga0070672_1005580093 115
115 3300005563 Ga0068855_100536309 Ga0068855_1005363091 115
116 3300014326 Ga0157380_10161953 Ga0157380_101619532 115
117 3300025923 Ga0207681_11074225 Ga0207681_110742251 115
118 3300025925 Ga0207650_10814087 Ga0207650_108140872 115
119 3300025926 Ga0207659_10084624 Ga0207659_100846242 115
120 3300025942 Ga0207689_10007844 Ga0207689_100078442 115
121 3300025945 Ga0207679_10374348 Ga0207679_103743482 115
122 3300025949 Ga0207667_10765610 Ga0207667_107656102 115
123 3300041452 Ga0451793_1606476 Ga0451793_1606476_475_822 115
124 3300049570 Ga0501033_0050754 Ga0501033_0050754_2207_2554 115
125 3300049671 Ga0501238_000454 Ga0501238_000454_3084_3431 115
126 3300053139 Ga0500568_0030729 Ga0500568_0030729_524_904 115
127 3300003320 rootH2_10011515 rootH2_100115159 116
128 3300003320 rootH2_10063812 rootH2_100638124 116
129 3300003323 rootH1_10001123 rootH1_100011235 116
130 3300003323 rootH1_10013541 rootH1_1001354114 116
131 3300005288 Ga0065714_10002194 Ga0065714_1000219411 116
132 3300005327 Ga0070658_11008621 Ga0070658_110086212 116
133 3300005327 Ga0070658_11710277 Ga0070658_117102771 116
134 3300005328 Ga0070676_10015570 Ga0070676_100155704 116
135 3300005329 Ga0070683_100147357 Ga0070683_1001473573 116
136 3300005329 Ga0070683_100160243 Ga0070683_1001602432 116
137 3300005329 Ga0070683_100407974 Ga0070683_1004079742 116
138 3300005331 Ga0070670_100214041 Ga0070670_1002140412 116
139 3300005331 Ga0070670_100862606 Ga0070670_1008626062 116
140 3300005334 Ga0068869_100117825 Ga0068869_1001178252 116
141 3300005334 Ga0068869_100219986 Ga0068869_1002199863 116
142 3300005334 Ga0068869_100673088 Ga0068869_1006730882 116
143 3300005334 Ga0068869_100909971 Ga0068869_1009099712 116
144 3300005335 Ga0070666_10012781 Ga0070666_100127814 116
145 3300005335 Ga0070666_10078447 Ga0070666_100784474 116
146 3300005336 Ga0070680_100091839 Ga0070680_1000918392 116
147 3300005336 Ga0070680_100261036 Ga0070680_1002610361 116
148 3300005339 Ga0070660_100270886 Ga0070660_1002708862 116
149 3300005339 Ga0070660_100471046 Ga0070660_1004710462 116
150 3300005341 Ga0070691_11007904 Ga0070691_110079041 116
151 3300005343 Ga0070687_100286701 Ga0070687_1002867012 116
152 3300005347 Ga0070668_100086398 Ga0070668_1000863984 116
153 3300005353 Ga0070669_100053889 Ga0070669_1000538893 116
154 3300005353 Ga0070669_101338167 Ga0070669_1013381671 116
155 3300005354 Ga0070675_100000132 Ga0070675_10000013233 116
156 3300005354 Ga0070675_100998843 Ga0070675_1009988431 116
157 3300005355 Ga0070671_100111911 Ga0070671_1001119113 116
158 3300005355 Ga0070671_100704122 Ga0070671_1007041221 116
159 3300005356 Ga0070674_100138042 Ga0070674_1001380422 116
160 3300005364 Ga0070673_100012041 Ga0070673_1000120414 116
161 3300005364 Ga0070673_100316294 Ga0070673_1003162942 116
162 3300005365 Ga0070688_100735675 Ga0070688_1007356751 116
163 3300005366 Ga0070659_100541122 Ga0070659_1005411222 116
164 3300005367 Ga0070667_100010737 Ga0070667_1000107372 116
165 3300005367 Ga0070667_100424371 Ga0070667_1004243712 116
166 3300005367 Ga0070667_101167491 Ga0070667_1011674911 116
167 3300005436 Ga0070713_100299041 Ga0070713_1002990412 116
168 3300005436 Ga0070713_100329699 Ga0070713_1003296991 116
169 3300005438 Ga0070701_10903567 Ga0070701_109035671 116
170 3300005441 Ga0070700_101768796 Ga0070700_1017687961 116
171 3300005445 Ga0070708_101301136 Ga0070708_1013011362 116
172 3300005456 Ga0070678_100071188 Ga0070678_1000711884 116
173 3300005456 Ga0070678_100347707 Ga0070678_1003477071 116
174 3300005458 Ga0070681_10147045 Ga0070681_101470453 116
175 3300005466 Ga0070685_10060162 Ga0070685_100601622 116
176 3300005466 Ga0070685_10121234 Ga0070685_101212342 116
177 3300005467 Ga0070706_100528396 Ga0070706_1005283962 116
178 3300005530 Ga0070679_100179567 Ga0070679_1001795673 116
179 3300005530 Ga0070679_100179736 Ga0070679_1001797362 116
180 3300005535 Ga0070684_100141367 Ga0070684_1001413673 116
181 3300005535 Ga0070684_101498158 Ga0070684_1014981581 116
182 3300005543 Ga0070672_100010123 Ga0070672_1000101232 116
183 3300005543 Ga0070672_100091930 Ga0070672_1000919302 116
184 3300005543 Ga0070672_100455235 Ga0070672_1004552353 116
185 3300005543 Ga0070672_100474672 Ga0070672_1004746722 116
186 3300005544 Ga0070686_100269992 Ga0070686_1002699922 116
187 3300005548 Ga0070665_100000442 Ga0070665_10000044220 116
188 3300005548 Ga0070665_100173433 Ga0070665_1001734333 116
189 3300005548 Ga0070665_100277243 Ga0070665_1002772433 116
190 3300005549 Ga0070704_100635048 Ga0070704_1006350481 116
191 3300005549 Ga0070704_100936074 Ga0070704_1009360742 116
192 3300005563 Ga0068855_100113043 Ga0068855_1001130434 116
193 3300005563 Ga0068855_100697031 Ga0068855_1006970312 116
194 3300005564 Ga0070664_100019667 Ga0070664_1000196676 116
195 3300005577 Ga0068857_100390915 Ga0068857_1003909151 116
196 3300005577 Ga0068857_101623057 Ga0068857_1016230572 116
197 3300005577 Ga0068857_102292657 Ga0068857_1022926571 116
198 3300005578 Ga0068854_100151671 Ga0068854_1001516713 116
199 3300005614 Ga0068856_100003990 Ga0068856_1000039904 116
200 3300005614 Ga0068856_100642478 Ga0068856_1006424781 116
201 3300005615 Ga0070702_100997944 Ga0070702_1009979442 116
202 3300005616 Ga0068852_101473255 Ga0068852_1014732551 116
203 3300005617 Ga0068859_100008549 Ga0068859_1000085495 116
204 3300005617 Ga0068859_100029283 Ga0068859_1000292832 116
205 3300005617 Ga0068859_100058913 Ga0068859_1000589134 116
206 3300005617 Ga0068859_102365791 Ga0068859_1023657912 116
207 3300005618 Ga0068864_100204361 Ga0068864_1002043613 116
208 3300005618 Ga0068864_100523989 Ga0068864_1005239892 116
209 3300005718 Ga0068866_10116656 Ga0068866_101166563 116
210 3300005840 Ga0068870_10223347 Ga0068870_102233472 116
211 3300005841 Ga0068863_100199136 Ga0068863_1001991363 116
212 3300005841 Ga0068863_100869250 Ga0068863_1008692501 116
213 3300005842 Ga0068858_100101040 Ga0068858_1001010402 116
214 3300005842 Ga0068858_101353256 Ga0068858_1013532562 116
215 3300005843 Ga0068860_100025373 Ga0068860_1000253735 116
216 3300005843 Ga0068860_100161201 Ga0068860_1001612012 116
217 3300006042 Ga0075368_10470770 Ga0075368_104707702 116
218 3300006051 Ga0075364_10067455 Ga0075364_100674552 116
219 3300006058 Ga0075432_10365355 Ga0075432_103653551 116
220 3300006177 Ga0075362_10135882 Ga0075362_101358823 116
221 3300006237 Ga0097621_100021727 Ga0097621_1000217272 116
222 3300006237 Ga0097621_100069948 Ga0097621_1000699482 116
223 3300006237 Ga0097621_100194731 Ga0097621_1001947314 116
224 3300006237 Ga0097621_100560655 Ga0097621_1005606551 116
225 3300006237 Ga0097621_100664845 Ga0097621_1006648451 116
226 3300006358 Ga0068871_100001750 Ga0068871_10000175017 116
227 3300006358 Ga0068871_100064806 Ga0068871_1000648064 116
228 3300006358 Ga0068871_100103942 Ga0068871_1001039422 116
229 3300006358 Ga0068871_100209430 Ga0068871_1002094304 116
230 3300006844 Ga0075428_100068233 Ga0075428_1000682333 116
231 3300006844 Ga0075428_100350047 Ga0075428_1003500473 116
232 3300006846 Ga0075430_100006345 Ga0075430_10000634512 116
233 3300006847 Ga0075431_100035304 Ga0075431_1000353045 116
234 3300006852 Ga0075433_10793634 Ga0075433_107936342 116
235 3300006871 Ga0075434_100149350 Ga0075434_1001493502 116
236 3300006880 Ga0075429_100147349 Ga0075429_1001473491 116
237 3300006880 Ga0075429_100455107 Ga0075429_1004551072 116
238 3300006881 Ga0068865_100256562 Ga0068865_1002565621 116
239 3300006914 Ga0075436_100463698 Ga0075436_1004636981 116
240 3300006931 Ga0097620_100008549 Ga0097620_1000085498 116
241 3300006931 Ga0097620_100029283 Ga0097620_1000292832 116
242 3300006931 Ga0097620_100058913 Ga0097620_1000589134 116
243 3300006931 Ga0097620_102365544 Ga0097620_1023655441 116
244 3300009093 Ga0105240_10234083 Ga0105240_102340832 116
245 3300009093 Ga0105240_10356823 Ga0105240_103568232 116
246 3300009093 Ga0105240_12281855 Ga0105240_122818551 116
247 3300009094 Ga0111539_10420346 Ga0111539_104203462 116
248 3300009094 Ga0111539_11599377 Ga0111539_115993771 116
249 3300009098 Ga0105245_10371948 Ga0105245_103719483 116
250 3300009147 Ga0114129_11523455 Ga0114129_115234551 116
251 3300009148 Ga0105243_11298410 Ga0105243_112984102 116
252 3300009174 Ga0105241_10719624 Ga0105241_107196241 116
253 3300009176 Ga0105242_10071789 Ga0105242_100717892 116
254 3300009177 Ga0105248_10042830 Ga0105248_100428302 116
255 3300009553 Ga0105249_10049822 Ga0105249_100498227 116
256 3300009553 Ga0105249_10234172 Ga0105249_102341723 116
257 3300009553 Ga0105249_10535907 Ga0105249_105359072 116
258 3300010375 Ga0105239_11771551 Ga0105239_117715512 116
259 3300011119 Ga0105246_10774384 Ga0105246_107743842 116
260 3300013100 Ga0157373_10205524 Ga0157373_102055241 116
261 3300013102 Ga0157371_10178916 Ga0157371_101789163 116
262 3300013104 Ga0157370_10015874 Ga0157370_100158742 116
263 3300013104 Ga0157370_10174927 Ga0157370_101749272 116
264 3300013105 Ga0157369_10770043 Ga0157369_107700432 116
265 3300013105 Ga0157369_10882656 Ga0157369_108826562 116
266 3300013297 Ga0157378_10288020 Ga0157378_102880203 116
267 3300013306 Ga0163162_10030639 Ga0163162_100306397 116
268 3300013307 Ga0157372_10284611 Ga0157372_102846113 116
269 3300013307 Ga0157372_10301862 Ga0157372_103018623 116
270 3300013307 Ga0157372_10410949 Ga0157372_104109492 116
271 3300013308 Ga0157375_10696872 Ga0157375_106968721 116
272 3300014325 Ga0163163_10019486 Ga0163163_100194862 116
273 3300014326 Ga0157380_10122869 Ga0157380_101228691 116
274 3300014326 Ga0157380_10417518 Ga0157380_104175181 116
275 3300014745 Ga0157377_10043132 Ga0157377_100431322 116
276 3300014968 Ga0157379_10022917 Ga0157379_100229174 116
277 3300014969 Ga0157376_10007990 Ga0157376_100079906 116
278 3300014969 Ga0157376_10160754 Ga0157376_101607542 116
279 3300014969 Ga0157376_12873484 Ga0157376_128734841 116
280 3300017792 Ga0163161_11066603 Ga0163161_110666032 116
281 3300025250 Ga0209026_1000844 Ga0209026_100084413 116
282 3300025315 Ga0207697_10068244 Ga0207697_100682441 116
283 3300025901 Ga0207688_10581396 Ga0207688_105813962 116
284 3300025903 Ga0207680_10156424 Ga0207680_101564242 116
285 3300025903 Ga0207680_10708643 Ga0207680_107086431 116
286 3300025904 Ga0207647_10013145 Ga0207647_100131451 116
287 3300025904 Ga0207647_10208701 Ga0207647_102087012 116
288 3300025907 Ga0207645_10018735 Ga0207645_100187354 116
289 3300025908 Ga0207643_10089829 Ga0207643_100898292 116
290 3300025908 Ga0207643_10440260 Ga0207643_104402601 116
291 3300025911 Ga0207654_10378183 Ga0207654_103781832 116
292 3300025911 Ga0207654_10930184 Ga0207654_109301841 116
293 3300025912 Ga0207707_10302961 Ga0207707_103029611 116
294 3300025913 Ga0207695_10005702 Ga0207695_100057024 116
295 3300025913 Ga0207695_10452288 Ga0207695_104522882 116
296 3300025913 Ga0207695_10761023 Ga0207695_107610232 116
297 3300025917 Ga0207660_10032554 Ga0207660_100325544 116
298 3300025918 Ga0207662_10104850 Ga0207662_101048502 116
299 3300025919 Ga0207657_10082599 Ga0207657_100825992 116
300 3300025919 Ga0207657_10666564 Ga0207657_106665641 116
301 3300025921 Ga0207652_10001149 Ga0207652_100011498 116
302 3300025921 Ga0207652_10194317 Ga0207652_101943173 116
303 3300025921 Ga0207652_11395279 Ga0207652_113952792 116
304 3300025923 Ga0207681_10407946 Ga0207681_104079462 116
305 3300025923 Ga0207681_10524906 Ga0207681_105249062 116
306 3300025925 Ga0207650_10026536 Ga0207650_100265362 116
307 3300025925 Ga0207650_10110949 Ga0207650_101109492 116
308 3300025925 Ga0207650_10314681 Ga0207650_103146812 116
309 3300025926 Ga0207659_10000063 Ga0207659_1000006326 116
310 3300025926 Ga0207659_10703367 Ga0207659_107033671 116
311 3300025926 Ga0207659_10854862 Ga0207659_108548621 116
312 3300025926 Ga0207659_10970915 Ga0207659_109709151 116
313 3300025926 Ga0207659_11844057 Ga0207659_118440571 116
314 3300025931 Ga0207644_10129606 Ga0207644_101296062 116
315 3300025933 Ga0207706_10224631 Ga0207706_102246312 116
316 3300025934 Ga0207686_10083911 Ga0207686_100839113 116
317 3300025935 Ga0207709_10727319 Ga0207709_107273192 116
318 3300025936 Ga0207670_10233657 Ga0207670_102336573 116
319 3300025937 Ga0207669_10326463 Ga0207669_103264632 116
320 3300025937 Ga0207669_10488609 Ga0207669_104886091 116
321 3300025937 Ga0207669_10662113 Ga0207669_106621132 116
322 3300025938 Ga0207704_10180202 Ga0207704_101802023 116
323 3300025940 Ga0207691_10021716 Ga0207691_100217162 116
324 3300025940 Ga0207691_10197266 Ga0207691_101972661 116
325 3300025941 Ga0207711_10001259 Ga0207711_1000125913 116
326 3300025942 Ga0207689_10002805 Ga0207689_100028052 116
327 3300025942 Ga0207689_10145969 Ga0207689_101459692 116
328 3300025942 Ga0207689_10577328 Ga0207689_105773282 116
329 3300025942 Ga0207689_11639733 Ga0207689_116397331 116
330 3300025944 Ga0207661_10254858 Ga0207661_102548581 116
331 3300025944 Ga0207661_10302569 Ga0207661_103025691 116
332 3300025944 Ga0207661_10831199 Ga0207661_108311992 116
333 3300025949 Ga0207667_10001143 Ga0207667_1000114318 116
334 3300025949 Ga0207667_10173377 Ga0207667_101733772 116
335 3300025960 Ga0207651_10032769 Ga0207651_100327692 116
336 3300025960 Ga0207651_11614893 Ga0207651_116148931 116
337 3300025961 Ga0207712_10313326 Ga0207712_103133262 116
338 3300025961 Ga0207712_10469136 Ga0207712_104691362 116
339 3300025972 Ga0207668_11695097 Ga0207668_116950971 116
340 3300025981 Ga0207640_10249148 Ga0207640_102491482 116
341 3300025986 Ga0207658_10023121 Ga0207658_100231214 116
342 3300025986 Ga0207658_10817970 Ga0207658_108179701 116
343 3300026023 Ga0207677_10208040 Ga0207677_102080402 116
344 3300026035 Ga0207703_10017470 Ga0207703_100174704 116
345 3300026035 Ga0207703_12341906 Ga0207703_123419061 116
346 3300026041 Ga0207639_11926498 Ga0207639_119264981 116
347 3300026078 Ga0207702_10000196 Ga0207702_1000019626 116
348 3300026078 Ga0207702_10677096 Ga0207702_106770961 116
349 3300026088 Ga0207641_10028597 Ga0207641_100285974 116
350 3300026088 Ga0207641_10227736 Ga0207641_102277364 116
351 3300026089 Ga0207648_10002623 Ga0207648_1000262310 116
352 3300026089 Ga0207648_11576673 Ga0207648_115766731 116
353 3300026095 Ga0207676_10096862 Ga0207676_100968624 116
354 3300026095 Ga0207676_10390189 Ga0207676_103901892 116
355 3300026116 Ga0207674_12135809 Ga0207674_121358092 116
356 3300026118 Ga0207675_102584564 Ga0207675_1025845641 116
357 3300026121 Ga0207683_10020712 Ga0207683_100207124 116
358 3300026121 Ga0207683_10202757 Ga0207683_102027573 116
359 3300026142 Ga0207698_10277406 Ga0207698_102774063 116
360 3300026142 Ga0207698_10359904 Ga0207698_103599041 116
361 3300027360 Ga0209969_1031567 Ga0209969_10315672 116
362 3300027378 Ga0209981_1028707 Ga0209981_10287071 116
363 3300027471 Ga0209995_1019364 Ga0209995_10193642 116
364 3300027526 Ga0209968_1075956 Ga0209968_10759561 116
365 3300027543 Ga0209999_1029269 Ga0209999_10292692 116
366 3300027876 Ga0209974_10239380 Ga0209974_102393801 116
367 3300027907 Ga0207428_10042352 Ga0207428_100423524 116
368 3300028379 Ga0268266_10278418 Ga0268266_102784182 116
369 3300028379 Ga0268266_10411802 Ga0268266_104118021 116
370 3300028379 Ga0268266_10765760 Ga0268266_107657602 116
371 3300028379 Ga0268266_11045934 Ga0268266_110459341 116
372 3300028381 Ga0268264_10018690 Ga0268264_100186904 116
373 3300028786 Ga0307517_10410946 Ga0307517_104109462 116
374 3300028794 Ga0307515_10431508 Ga0307515_104315081 116
375 3300031251 Ga0265327_10082917 Ga0265327_100829172 116
376 3300031456 Ga0307513_10255684 Ga0307513_102556842 116
377 3300031507 Ga0307509_10828490 Ga0307509_108284901 116
378 3300031548 Ga0307408_100005435 Ga0307408_1000054355 116
379 3300031727 Ga0316576_10549858 Ga0316576_105498582 116
380 3300031731 Ga0307405_10087254 Ga0307405_100872543 116
381 3300031901 Ga0307406_10000094 Ga0307406_1000009448 116
382 3300031903 Ga0307407_10014946 Ga0307407_100149466 116
383 3300031911 Ga0307412_10410982 Ga0307412_104109822 116
384 3300032004 Ga0307414_10000011 Ga0307414_10000011130 116
385 3300035084 Ga0373928_0164818 Ga0373928_0164818_245_595 116
386 3300035171 Ga0373946_0305313 Ga0373946_0305313_154_504 116
387 3300036712 Ga0316584_0094994 Ga0316584_0094994_415_765 116
388 3300036712 Ga0316584_0794115 Ga0316584_0794115_126_476 116
389 3300037312 Ga0395899_0076014 Ga0395899_0076014_508_858 116
390 3300037312 Ga0395899_0914801 Ga0395899_0914801_31_381 116
391 3300037466 Ga0395898_0345340 Ga0395898_0345340_738_1088 116
392 3300038443 Ga0395901_0738715 Ga0395901_0738715_533_883 116
393 3300041458 Ga0451798_0224035 Ga0451798_0224035_583_933 116
394 3300041511 Ga0451855_0007143 Ga0451855_0007143_96_446 116
395 3300042876 Ga0451577_0140797 Ga0451577_0140797_143_493 116
396 3300042876 Ga0451577_1122534 Ga0451577_1122534_178_528 116
397 3300044712 Ga0453684_0000462 Ga0453684_0000462_61136_61489 116
398 3300044712 Ga0453684_0022557 Ga0453684_0022557_7718_8092 116
399 3300044712 Ga0453684_0219449 Ga0453684_0219449_870_1220 116
400 3300044712 Ga0453684_0430392 Ga0453684_0430392_878_1228 116
401 3300045051 Ga0451576_0634985 Ga0451576_0634985_336_686 116
402 3300046459 Ga0495629_0113581 Ga0495629_0113581_218_568 116
403 3300046477 Ga0495664_0591444 Ga0495664_0591444_212_562 116
404 3300046492 Ga0495585_0612162 Ga0495585_0612162_118_468 116
405 3300046511 Ga0495608_0734660 Ga0495608_0734660_224_574 116
406 3300046529 Ga0495652_0877708 Ga0495652_0877708_165_515 116
407 3300046559 Ga0495667_0053641 Ga0495667_0053641_1791_2141 116
408 3300046642 Ga0495634_0809044 Ga0495634_0809044_40_390 116
409 3300046664 Ga0495659_0082961 Ga0495659_0082961_222_572 116
410 3300046675 Ga0495657_0143447 Ga0495657_0143447_530_880 116
411 3300046683 Ga0495658_0375827 Ga0495658_0375827_256_606 116
412 3300046689 Ga0495613_0131313 Ga0495613_0131313_431_781 116
413 3300046809 Ga0495600_0176547 Ga0495600_0176547_533_883 116
414 3300047315 Ga0495581_0039403 Ga0495581_0039403_2316_2666 116
415 3300047317 Ga0495604_0035817 Ga0495604_0035817_1925_2275 116
416 3300047319 Ga0495674_1256494 Ga0495674_1256494_146_496 116
417 3300047320 Ga0495672_0016866 Ga0495672_0016866_4212_4562 116
418 3300047444 Ga0495675_0044611 Ga0495675_0044611_67_417 116
419 3300047471 Ga0495684_0020719 Ga0495684_0020719_909_1259 116
420 3300049522 Ga0501299_174589 Ga0501299_174589_91_441 116
421 3300049569 Ga0501032_0490829 Ga0501032_0490829_353_703 116
422 3300049571 Ga0501034_0037401 Ga0501034_0037401_3641_3991 116
423 3300049571 Ga0501034_0108785 Ga0501034_0108785_1220_1570 116
424 3300049574 Ga0501038_0632702 Ga0501038_0632702_287_637 116
425 3300049586 Ga0501070_0093179 Ga0501070_0093179_35_385 116
426 3300049592 Ga0501076_1622425 Ga0501076_1622425_112_462 116
427 3300049668 Ga0501233_130830 Ga0501233_130830_36_386 116
428 3300049671 Ga0501238_000110 Ga0501238_000110_10537_10887 116
429 3300049679 Ga0501249_000012 Ga0501249_000012_60212_60562 116
430 3300049679 Ga0501249_075702 Ga0501249_075702_342_692 116
431 3300049758 Ga0501241_011103 Ga0501241_011103_1142_1492 116
432 3300049763 Ga0501266_006202 Ga0501266_006202_686_1036 116
433 3300049776 Ga0501280_005919 Ga0501280_005919_151_501 116
434 3300049822 Ga0501035_0004612 Ga0501035_0004612_9227_9577 116
435 3300049823 Ga0501044_0127304 Ga0501044_0127304_2115_2465 116
436 3300050491 nmdc:mga00v17_102209_c1 nmdc:mga00v17_102209_c1_140_496 116
437 3300050508 nmdc:mga09592_1484704_c1 nmdc:mga09592_1484704_c1_147_497 116
438 3300050511 nmdc:mga08y16_37064_c1 nmdc:mga08y16_37064_c1_1199_1549 116
439 3300050511 nmdc:mga08y16_78724_c1 nmdc:mga08y16_78724_c1_2311_2661 116
440 3300050515 nmdc:mga0a205_262389_c1 nmdc:mga0a205_262389_c1_1059_1409 116
441 3300053121 Ga0500607_000146 Ga0500607_000146_20961_21317 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

15

125

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9363 1 115
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9134 1 115
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.3412 30 115
7rcx-assembly1.cif.gz_A crystal structure of c. difficile penicillin-binding protein 2 in apo form 0.3318 15 115
7rcx-assembly1.cif.gz_A crystal structure of c. difficile penicillin-binding protein 2 in apo form 0.2904 15 115
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9399 4 115 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8862 4 115 1.10.8.290
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.8009 9 115 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7909 9 115 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7626 9 115 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A7I7ZNW3-F1-model_v4 deleted 1.002 4 116
AF-A0A1A3MNP2-F1-model_v4 deleted 1.002 5 115
AF-A0A560WHY9-F1-model_v4 DUF2200 family protein 1.002 5 116
AF-A0A200HG91-F1-model_v4 DUF2200 domain-containing protein 1.002 9 116
AF-A0A1H4HYB9-F1-model_v4 deleted 1.001 4 116

Feature Viewer

pLDDT pTM Quality
92.71 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map