F444652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 441 | 244 | 437 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10178916|Ga0157371_101789163 |
| Length | 126 |
| Sequence | LLKLTLKTASMDQTRVFKMSFAGVYPLYIKKAERKGRTKEEVDAIICWLTGYDQQALQNQIDKKIDLQTFFDEAPALNPNATKITGVICGYRVEEIEDKLMQKIRYMDKLVDELAKGKALEKILRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 2 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 3 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 4 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 231 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 232 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 233 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 234 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 242 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 243 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 244 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0 |
| Isolates | 0.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.81 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 94.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10011515 | 3300003320 | Bacteria | 9709 |
| 2 | rootH2_10063812 | 3300003320 | Bacteria | 4652 |
| 3 | rootH1_10001123 | 3300003323 | Bacteria | 32582 |
| 4 | rootH1_10013541 | 3300003323 | Bacteria | 10239 |
| 5 | Ga0065714_10002194 | 3300005288 | Bacteria | 111067 |
| 6 | Ga0065712_10071173 | 3300005290 | Bacteria | 5439 |
| 7 | Ga0065712_10076109 | 3300005290 | Bacteria | 3704 |
| 8 | Ga0070658_11008621 | 3300005327 | Bacteria | 724 |
| 9 | Ga0070658_11710277 | 3300005327 | Unclassified | 544 |
| 10 | Ga0070676_10015570 | 3300005328 | Bacteria | 4196 |
| 11 | Ga0070683_100147357 | 3300005329 | Bacteria | 2231 |
| 12 | Ga0070683_100160243 | 3300005329 | Bacteria | 2135 |
| 13 | Ga0070683_100407974 | 3300005329 | Bacteria | 1296 |
| 14 | Ga0070670_100214041 | 3300005331 | Bacteria | 1676 |
| 15 | Ga0070670_100862606 | 3300005331 | Bacteria | 819 |
| 16 | Ga0070670_101486591 | 3300005331 | Bacteria | 622 |
| 17 | Ga0068869_100000824 | 3300005334 | Bacteria | 17695 |
| 18 | Ga0068869_100117825 | 3300005334 | Bacteria | 2027 |
| 19 | Ga0068869_100219986 | 3300005334 | Bacteria | 1505 |
| 20 | Ga0068869_100673088 | 3300005334 | Bacteria | 880 |
| 21 | Ga0068869_100909971 | 3300005334 | Bacteria | 762 |
| 22 | Ga0070666_10012781 | 3300005335 | Bacteria | 5307 |
| 23 | Ga0070666_10078447 | 3300005335 | Bacteria | 2254 |
| 24 | Ga0070680_100091839 | 3300005336 | Bacteria | 2513 |
| 25 | Ga0070680_100261036 | 3300005336 | Bacteria | 1465 |
| 26 | Ga0068868_100119292 | 3300005338 | Bacteria | 2150 |
| 27 | Ga0068868_101930982 | 3300005338 | Bacteria | 559 |
| 28 | Ga0070660_100270886 | 3300005339 | Bacteria | 1388 |
| 29 | Ga0070660_100471046 | 3300005339 | Bacteria | 1043 |
| 30 | Ga0070689_100038671 | 3300005340 | Bacteria | 3651 |
| 31 | Ga0070691_11007904 | 3300005341 | Unclassified | 520 |
| 32 | Ga0070687_100286701 | 3300005343 | Bacteria | 1039 |
| 33 | Ga0070661_100015586 | 3300005344 | Bacteria | 5364 |
| 34 | Ga0070668_100086398 | 3300005347 | Bacteria | 2466 |
| 35 | Ga0070669_100053889 | 3300005353 | Bacteria | 2945 |
| 36 | Ga0070669_101338167 | 3300005353 | Bacteria | 621 |
| 37 | Ga0070669_101788444 | 3300005353 | Bacteria | 536 |
| 38 | Ga0070675_100000132 | 3300005354 | Bacteria | 44955 |
| 39 | Ga0070675_100054564 | 3300005354 | Bacteria | 3288 |
| 40 | Ga0070675_100315212 | 3300005354 | Bacteria | 1381 |
| 41 | Ga0070675_100998843 | 3300005354 | Bacteria | 768 |
| 42 | Ga0070675_101007968 | 3300005354 | Bacteria | 765 |
| 43 | Ga0070671_100111911 | 3300005355 | Bacteria | 2293 |
| 44 | Ga0070671_100704122 | 3300005355 | Bacteria | 876 |
| 45 | Ga0070674_100138042 | 3300005356 | Bacteria | 1826 |
| 46 | Ga0070673_100012041 | 3300005364 | Bacteria | 5926 |
| 47 | Ga0070673_100316294 | 3300005364 | Bacteria | 1378 |
| 48 | Ga0070673_100632266 | 3300005364 | Unclassified | 978 |
| 49 | Ga0070688_100051357 | 3300005365 | Bacteria | 2572 |
| 50 | Ga0070688_100735675 | 3300005365 | Bacteria | 767 |
| 51 | Ga0070659_100007954 | 3300005366 | Bacteria | 7726 |
| 52 | Ga0070659_100486372 | 3300005366 | Bacteria | 1051 |
| 53 | Ga0070659_100541122 | 3300005366 | Bacteria | 996 |
| 54 | Ga0070667_100010737 | 3300005367 | Bacteria | 7568 |
| 55 | Ga0070667_100424371 | 3300005367 | Bacteria | 1213 |
| 56 | Ga0070667_100752091 | 3300005367 | Bacteria | 903 |
| 57 | Ga0070667_101167491 | 3300005367 | Unclassified | 720 |
| 58 | Ga0070713_100299041 | 3300005436 | Bacteria | 1481 |
| 59 | Ga0070713_100329699 | 3300005436 | Bacteria | 1411 |
| 60 | Ga0070701_10903567 | 3300005438 | Bacteria | 610 |
| 61 | Ga0070700_101768796 | 3300005441 | Bacteria | 532 |
| 62 | Ga0070708_101301136 | 3300005445 | Bacteria | 679 |
| 63 | Ga0070663_100229321 | 3300005455 | Bacteria | 1462 |
| 64 | Ga0070678_100071188 | 3300005456 | Bacteria | 2603 |
| 65 | Ga0070678_100347707 | 3300005456 | Bacteria | 1274 |
| 66 | Ga0070681_10147045 | 3300005458 | Bacteria | 2285 |
| 67 | Ga0070685_10020865 | 3300005466 | Bacteria | 3551 |
| 68 | Ga0070685_10060162 | 3300005466 | Bacteria | 2220 |
| 69 | Ga0070685_10121234 | 3300005466 | Bacteria | 1624 |
| 70 | Ga0070706_100528396 | 3300005467 | Bacteria | 1097 |
| 71 | Ga0070679_100179567 | 3300005530 | Bacteria | 2089 |
| 72 | Ga0070679_100179736 | 3300005530 | Bacteria | 2088 |
| 73 | Ga0070684_100141367 | 3300005535 | Bacteria | 2177 |
| 74 | Ga0070684_101498158 | 3300005535 | Bacteria | 636 |
| 75 | Ga0070672_100010123 | 3300005543 | Bacteria | 6530 |
| 76 | Ga0070672_100091930 | 3300005543 | Bacteria | 2449 |
| 77 | Ga0070672_100455235 | 3300005543 | Bacteria | 1103 |
| 78 | Ga0070672_100474672 | 3300005543 | Bacteria | 1079 |
| 79 | Ga0070672_100558009 | 3300005543 | Bacteria | 995 |
| 80 | Ga0070686_100269992 | 3300005544 | Bacteria | 1250 |
| 81 | Ga0070665_100000442 | 3300005548 | Bacteria | 60619 |
| 82 | Ga0070665_100173433 | 3300005548 | Bacteria | 2158 |
| 83 | Ga0070665_100277243 | 3300005548 | Bacteria | 1679 |
| 84 | Ga0070665_101802010 | 3300005548 | Bacteria | 619 |
| 85 | Ga0070704_100635048 | 3300005549 | Bacteria | 941 |
| 86 | Ga0070704_100936074 | 3300005549 | Bacteria | 781 |
| 87 | Ga0068855_100113043 | 3300005563 | Bacteria | 3116 |
| 88 | Ga0068855_100536309 | 3300005563 | Bacteria | 1268 |
| 89 | Ga0068855_100697031 | 3300005563 | Bacteria | 1087 |
| 90 | Ga0070664_100019667 | 3300005564 | Bacteria | 5557 |
| 91 | Ga0068857_100380853 | 3300005577 | Bacteria | 1310 |
| 92 | Ga0068857_100390915 | 3300005577 | Bacteria | 1293 |
| 93 | Ga0068857_101623057 | 3300005577 | Bacteria | 631 |
| 94 | Ga0068857_102292657 | 3300005577 | Bacteria | 530 |
| 95 | Ga0068854_100151671 | 3300005578 | Bacteria | 1788 |
| 96 | Ga0068856_100003990 | 3300005614 | Bacteria | 14784 |
| 97 | Ga0068856_100642478 | 3300005614 | Bacteria | 1082 |
| 98 | Ga0070702_100997944 | 3300005615 | Bacteria | 662 |
| 99 | Ga0068852_101473255 | 3300005616 | Unclassified | 703 |
| 100 | Ga0068859_100008549 | 3300005617 | Bacteria | 10356 |
| 101 | Ga0068859_100029283 | 3300005617 | Bacteria | 5525 |
| 102 | Ga0068859_100058913 | 3300005617 | Bacteria | 3869 |
| 103 | Ga0068859_102365791 | 3300005617 | Unclassified | 586 |
| 104 | Ga0068864_100204361 | 3300005618 | Bacteria | 1816 |
| 105 | Ga0068864_100523989 | 3300005618 | Bacteria | 1143 |
| 106 | Ga0068864_102355698 | 3300005618 | Bacteria | 539 |
| 107 | Ga0068866_10116656 | 3300005718 | Bacteria | 1498 |
| 108 | Ga0068861_100052171 | 3300005719 | Bacteria | 3108 |
| 109 | Ga0068870_10223347 | 3300005840 | Bacteria | 1154 |
| 110 | Ga0068863_100147532 | 3300005841 | Bacteria | 2250 |
| 111 | Ga0068863_100199136 | 3300005841 | Unclassified | 1926 |
| 112 | Ga0068863_100869250 | 3300005841 | Bacteria | 901 |
| 113 | Ga0068858_100101040 | 3300005842 | Bacteria | 2690 |
| 114 | Ga0068858_100350607 | 3300005842 | Bacteria | 1414 |
| 115 | Ga0068858_101353256 | 3300005842 | Bacteria | 701 |
| 116 | Ga0068860_100025373 | 3300005843 | Bacteria | 5719 |
| 117 | Ga0068860_100161201 | 3300005843 | Bacteria | 2162 |
| 118 | Ga0068862_100572676 | 3300005844 | Bacteria | 1081 |
| 119 | Ga0075368_10470770 | 3300006042 | Bacteria | 558 |
| 120 | Ga0075364_10067455 | 3300006051 | Bacteria | 2351 |
| 121 | Ga0075432_10365355 | 3300006058 | Bacteria | 615 |
| 122 | Ga0075362_10135882 | 3300006177 | Bacteria | 1173 |
| 123 | Ga0097621_100021727 | 3300006237 | Bacteria | 4971 |
| 124 | Ga0097621_100069948 | 3300006237 | Bacteria | 2898 |
| 125 | Ga0097621_100194731 | 3300006237 | Bacteria | 1757 |
| 126 | Ga0097621_100560655 | 3300006237 | Bacteria | 1041 |
| 127 | Ga0097621_100664845 | 3300006237 | Bacteria | 957 |
| 128 | Ga0068871_100001750 | 3300006358 | Bacteria | 14634 |
| 129 | Ga0068871_100064806 | 3300006358 | Bacteria | 2992 |
| 130 | Ga0068871_100103942 | 3300006358 | Bacteria | 2382 |
| 131 | Ga0068871_100209430 | 3300006358 | Bacteria | 1686 |
| 132 | Ga0068871_100669078 | 3300006358 | Bacteria | 949 |
| 133 | Ga0075428_100068233 | 3300006844 | Bacteria | 3890 |
| 134 | Ga0075428_100350047 | 3300006844 | Bacteria | 1586 |
| 135 | Ga0075430_100006345 | 3300006846 | Bacteria | 9974 |
| 136 | Ga0075431_100035304 | 3300006847 | Bacteria | 5146 |
| 137 | Ga0075433_10793634 | 3300006852 | Bacteria | 827 |
| 138 | Ga0075434_100149350 | 3300006871 | Bacteria | 2357 |
| 139 | Ga0075429_100147349 | 3300006880 | Bacteria | 2060 |
| 140 | Ga0075429_100455107 | 3300006880 | Bacteria | 1121 |
| 141 | Ga0068865_100256562 | 3300006881 | Bacteria | 1382 |
| 142 | Ga0075436_100463698 | 3300006914 | Bacteria | 924 |
| 143 | Ga0097620_100008549 | 3300006931 | Bacteria | 10356 |
| 144 | Ga0097620_100029283 | 3300006931 | Bacteria | 5525 |
| 145 | Ga0097620_100058913 | 3300006931 | Bacteria | 3869 |
| 146 | Ga0097620_102365544 | 3300006931 | Unclassified | 586 |
| 147 | Ga0105240_10078354 | 3300009093 | Bacteria | 4070 |
| 148 | Ga0105240_10234083 | 3300009093 | Bacteria | 2133 |
| 149 | Ga0105240_10356823 | 3300009093 | Bacteria | 1657 |
| 150 | Ga0105240_12281855 | 3300009093 | Bacteria | 561 |
| 151 | Ga0111539_10420346 | 3300009094 | Bacteria | 1557 |
| 152 | Ga0111539_11599377 | 3300009094 | Bacteria | 756 |
| 153 | Ga0105245_10371948 | 3300009098 | Bacteria | 1421 |
| 154 | Ga0114129_11523455 | 3300009147 | Bacteria | 821 |
| 155 | Ga0105243_11298410 | 3300009148 | Bacteria | 745 |
| 156 | Ga0105241_10004950 | 3300009174 | Bacteria | 9827 |
| 157 | Ga0105241_10164105 | 3300009174 | Bacteria | 1829 |
| 158 | Ga0105241_10719624 | 3300009174 | Unclassified | 913 |
| 159 | Ga0105242_10071789 | 3300009176 | Bacteria | 2874 |
| 160 | Ga0105242_10101319 | 3300009176 | Bacteria | 2440 |
| 161 | Ga0105242_10600940 | 3300009176 | Bacteria | 1063 |
| 162 | Ga0105242_11546808 | 3300009176 | Bacteria | 695 |
| 163 | Ga0105248_10042830 | 3300009177 | Bacteria | 5076 |
| 164 | Ga0105248_10174783 | 3300009177 | Bacteria | 2421 |
| 165 | Ga0105237_10314787 | 3300009545 | Bacteria | 1568 |
| 166 | Ga0105249_10002726 | 3300009553 | Bacteria | 15275 |
| 167 | Ga0105249_10049822 | 3300009553 | Bacteria | 3819 |
| 168 | Ga0105249_10109296 | 3300009553 | Bacteria | 2611 |
| 169 | Ga0105249_10234172 | 3300009553 | Bacteria | 1812 |
| 170 | Ga0105249_10535907 | 3300009553 | Bacteria | 1220 |
| 171 | Ga0105239_10123266 | 3300010375 | Bacteria | 2880 |
| 172 | Ga0105239_11771551 | 3300010375 | Bacteria | 715 |
| 173 | Ga0105246_10021614 | 3300011119 | Bacteria | 4142 |
| 174 | Ga0105246_10101427 | 3300011119 | Bacteria | 2096 |
| 175 | Ga0105246_10774384 | 3300011119 | Bacteria | 849 |
| 176 | Ga0157373_10002675 | 3300013100 | Bacteria | 13513 |
| 177 | Ga0157373_10025190 | 3300013100 | Bacteria | 4306 |
| 178 | Ga0157373_10205524 | 3300013100 | Bacteria | 1389 |
| 179 | Ga0157371_10178916 | 3300013102 | Bacteria | 1517 |
| 180 | Ga0157370_10015874 | 3300013104 | Bacteria | 7641 |
| 181 | Ga0157370_10174927 | 3300013104 | Bacteria | 1995 |
| 182 | Ga0157370_10198550 | 3300013104 | Bacteria | 1861 |
| 183 | Ga0157369_10176551 | 3300013105 | Bacteria | 2249 |
| 184 | Ga0157369_10594352 | 3300013105 | Bacteria | 1143 |
| 185 | Ga0157369_10770043 | 3300013105 | Bacteria | 989 |
| 186 | Ga0157369_10882656 | 3300013105 | Bacteria | 917 |
| 187 | Ga0157374_10004368 | 3300013296 | Bacteria | 11900 |
| 188 | Ga0157374_10022899 | 3300013296 | Bacteria | 5579 |
| 189 | Ga0157374_10411932 | 3300013296 | Bacteria | 1349 |
| 190 | Ga0157378_10288020 | 3300013297 | Bacteria | 1585 |
| 191 | Ga0157378_10469528 | 3300013297 | Bacteria | 1252 |
| 192 | Ga0163162_10030639 | 3300013306 | Bacteria | 5330 |
| 193 | Ga0163162_10054907 | 3300013306 | Bacteria | 4008 |
| 194 | Ga0163162_10158765 | 3300013306 | Bacteria | 2382 |
| 195 | Ga0163162_10623713 | 3300013306 | Bacteria | 1203 |
| 196 | Ga0157372_10066962 | 3300013307 | Bacteria | 4035 |
| 197 | Ga0157372_10284611 | 3300013307 | Bacteria | 1922 |
| 198 | Ga0157372_10301862 | 3300013307 | Bacteria | 1862 |
| 199 | Ga0157372_10410949 | 3300013307 | Bacteria | 1577 |
| 200 | Ga0157372_10953286 | 3300013307 | Bacteria | 995 |
| 201 | Ga0157375_10015620 | 3300013308 | Bacteria | 6802 |
| 202 | Ga0157375_10033149 | 3300013308 | Bacteria | 4905 |
| 203 | Ga0157375_10231747 | 3300013308 | Bacteria | 2006 |
| 204 | Ga0157375_10696872 | 3300013308 | Unclassified | 1169 |
| 205 | Ga0157375_11819966 | 3300013308 | Bacteria | 722 |
| 206 | Ga0163163_10019486 | 3300014325 | Bacteria | 6372 |
| 207 | Ga0157380_10041358 | 3300014326 | Bacteria | 3597 |
| 208 | Ga0157380_10122869 | 3300014326 | Bacteria | 2202 |
| 209 | Ga0157380_10161953 | 3300014326 | Bacteria | 1945 |
| 210 | Ga0157380_10417518 | 3300014326 | Bacteria | 1278 |
| 211 | Ga0157377_10043132 | 3300014745 | Bacteria | 2509 |
| 212 | Ga0157377_10324748 | 3300014745 | Bacteria | 1024 |
| 213 | Ga0157379_10022917 | 3300014968 | Bacteria | 5535 |
| 214 | Ga0157376_10007990 | 3300014969 | Bacteria | 7593 |
| 215 | Ga0157376_10146603 | 3300014969 | Bacteria | 2124 |
| 216 | Ga0157376_10160754 | 3300014969 | Bacteria | 2036 |
| 217 | Ga0157376_10427167 | 3300014969 | Unclassified | 1287 |
| 218 | Ga0157376_10937604 | 3300014969 | Bacteria | 886 |
| 219 | Ga0157376_12873484 | 3300014969 | Bacteria | 521 |
| 220 | Ga0182007_10055918 | 3300015262 | Bacteria | 1296 |
| 221 | Ga0163161_10010043 | 3300017792 | Bacteria | 6554 |
| 222 | Ga0163161_11066603 | 3300017792 | Bacteria | 693 |
| 223 | Ga0213876_10179589 | 3300021384 | Bacteria | 1126 |
| 224 | Ga0209026_1000844 | 3300025250 | Bacteria | 16149 |
| 225 | Ga0207697_10023313 | 3300025315 | Bacteria | 2534 |
| 226 | Ga0207697_10068244 | 3300025315 | Bacteria | 1487 |
| 227 | Ga0207656_10356564 | 3300025321 | Bacteria | 731 |
| 228 | Ga0207682_10155554 | 3300025893 | Bacteria | 1033 |
| 229 | Ga0207642_10481911 | 3300025899 | Bacteria | 757 |
| 230 | Ga0207688_10581396 | 3300025901 | Bacteria | 705 |
| 231 | Ga0207680_10156424 | 3300025903 | Bacteria | 1524 |
| 232 | Ga0207680_10708643 | 3300025903 | Bacteria | 721 |
| 233 | Ga0207647_10013145 | 3300025904 | Bacteria | 5750 |
| 234 | Ga0207647_10208701 | 3300025904 | Bacteria | 1128 |
| 235 | Ga0207645_10018735 | 3300025907 | Bacteria | 4547 |
| 236 | Ga0207643_10089829 | 3300025908 | Bacteria | 1790 |
| 237 | Ga0207643_10440260 | 3300025908 | Bacteria | 828 |
| 238 | Ga0207654_10378183 | 3300025911 | Bacteria | 980 |
| 239 | Ga0207654_10930184 | 3300025911 | Unclassified | 631 |
| 240 | Ga0207707_10302961 | 3300025912 | Bacteria | 1382 |
| 241 | Ga0207695_10005702 | 3300025913 | Bacteria | 16420 |
| 242 | Ga0207695_10452288 | 3300025913 | Bacteria | 1167 |
| 243 | Ga0207695_10761023 | 3300025913 | Bacteria | 849 |
| 244 | Ga0207660_10032554 | 3300025917 | Bacteria | 3599 |
| 245 | Ga0207662_10104850 | 3300025918 | Bacteria | 1756 |
| 246 | Ga0207657_10082599 | 3300025919 | Unclassified | 2697 |
| 247 | Ga0207657_10666564 | 3300025919 | Bacteria | 809 |
| 248 | Ga0207652_10001149 | 3300025921 | Bacteria | 23813 |
| 249 | Ga0207652_10194317 | 3300025921 | Bacteria | 1825 |
| 250 | Ga0207652_11395279 | 3300025921 | Unclassified | 604 |
| 251 | Ga0207681_10407946 | 3300025923 | Bacteria | 1099 |
| 252 | Ga0207681_10524906 | 3300025923 | Bacteria | 972 |
| 253 | Ga0207681_11074225 | 3300025923 | Bacteria | 676 |
| 254 | Ga0207650_10026536 | 3300025925 | Bacteria | 4133 |
| 255 | Ga0207650_10110949 | 3300025925 | Bacteria | 2123 |
| 256 | Ga0207650_10314681 | 3300025925 | Bacteria | 1281 |
| 257 | Ga0207650_10814087 | 3300025925 | Bacteria | 792 |
| 258 | Ga0207659_10000063 | 3300025926 | Bacteria | 67205 |
| 259 | Ga0207659_10084624 | 3300025926 | Bacteria | 2354 |
| 260 | Ga0207659_10703367 | 3300025926 | Bacteria | 865 |
| 261 | Ga0207659_10854862 | 3300025926 | Bacteria | 782 |
| 262 | Ga0207659_10970915 | 3300025926 | Bacteria | 731 |
| 263 | Ga0207659_11844057 | 3300025926 | Bacteria | 513 |
| 264 | Ga0207644_10129606 | 3300025931 | Bacteria | 1929 |
| 265 | Ga0207706_10224631 | 3300025933 | Bacteria | 1644 |
| 266 | Ga0207686_10083911 | 3300025934 | Bacteria | 2086 |
| 267 | Ga0207686_11191466 | 3300025934 | Bacteria | 623 |
| 268 | Ga0207709_10727319 | 3300025935 | Bacteria | 796 |
| 269 | Ga0207670_10026209 | 3300025936 | Bacteria | 3671 |
| 270 | Ga0207670_10233657 | 3300025936 | Bacteria | 1413 |
| 271 | Ga0207669_10326463 | 3300025937 | Bacteria | 1176 |
| 272 | Ga0207669_10488609 | 3300025937 | Bacteria | 983 |
| 273 | Ga0207669_10662113 | 3300025937 | Bacteria | 855 |
| 274 | Ga0207704_10180202 | 3300025938 | Bacteria | 1526 |
| 275 | Ga0207691_10021716 | 3300025940 | Bacteria | 6059 |
| 276 | Ga0207691_10197266 | 3300025940 | Bacteria | 1753 |
| 277 | Ga0207711_10001259 | 3300025941 | Bacteria | 24037 |
| 278 | Ga0207689_10002805 | 3300025942 | Bacteria | 16095 |
| 279 | Ga0207689_10007844 | 3300025942 | Bacteria | 9332 |
| 280 | Ga0207689_10145969 | 3300025942 | Bacteria | 1949 |
| 281 | Ga0207689_10577328 | 3300025942 | Bacteria | 945 |
| 282 | Ga0207689_11639733 | 3300025942 | Bacteria | 534 |
| 283 | Ga0207661_10254858 | 3300025944 | Bacteria | 1561 |
| 284 | Ga0207661_10302569 | 3300025944 | Bacteria | 1434 |
| 285 | Ga0207661_10831199 | 3300025944 | Bacteria | 850 |
| 286 | Ga0207679_10061272 | 3300025945 | Bacteria | 2800 |
| 287 | Ga0207679_10374348 | 3300025945 | Bacteria | 1247 |
| 288 | Ga0207667_10001143 | 3300025949 | Bacteria | 33339 |
| 289 | Ga0207667_10173377 | 3300025949 | Bacteria | 2217 |
| 290 | Ga0207667_10765610 | 3300025949 | Bacteria | 964 |
| 291 | Ga0207651_10032769 | 3300025960 | Bacteria | 3342 |
| 292 | Ga0207651_11614893 | 3300025960 | Bacteria | 584 |
| 293 | Ga0207712_10001133 | 3300025961 | Bacteria | 18560 |
| 294 | Ga0207712_10313326 | 3300025961 | Bacteria | 1292 |
| 295 | Ga0207712_10469136 | 3300025961 | Bacteria | 1071 |
| 296 | Ga0207668_11305609 | 3300025972 | Bacteria | 653 |
| 297 | Ga0207668_11695097 | 3300025972 | Bacteria | 571 |
| 298 | Ga0207640_10249148 | 3300025981 | Bacteria | 1377 |
| 299 | Ga0207658_10023121 | 3300025986 | Bacteria | 4335 |
| 300 | Ga0207658_10817970 | 3300025986 | Unclassified | 846 |
| 301 | Ga0207677_10208040 | 3300026023 | Bacteria | 1560 |
| 302 | Ga0207677_10946715 | 3300026023 | Bacteria | 779 |
| 303 | Ga0207703_10017470 | 3300026035 | Bacteria | 5598 |
| 304 | Ga0207703_10137466 | 3300026035 | Bacteria | 2117 |
| 305 | Ga0207703_12341906 | 3300026035 | Bacteria | 510 |
| 306 | Ga0207639_11926498 | 3300026041 | Bacteria | 552 |
| 307 | Ga0207678_10038539 | 3300026067 | Unclassified | 4153 |
| 308 | Ga0207702_10000196 | 3300026078 | Bacteria | 71703 |
| 309 | Ga0207702_10677096 | 3300026078 | Bacteria | 1016 |
| 310 | Ga0207641_10028597 | 3300026088 | Bacteria | 4606 |
| 311 | Ga0207641_10227736 | 3300026088 | Bacteria | 1731 |
| 312 | Ga0207641_10485437 | 3300026088 | Unclassified | 1198 |
| 313 | Ga0207641_11718194 | 3300026088 | Bacteria | 629 |
| 314 | Ga0207648_10002623 | 3300026089 | Bacteria | 19251 |
| 315 | Ga0207648_11576673 | 3300026089 | Bacteria | 617 |
| 316 | Ga0207676_10096862 | 3300026095 | Bacteria | 2436 |
| 317 | Ga0207676_10390189 | 3300026095 | Bacteria | 1298 |
| 318 | Ga0207676_10734683 | 3300026095 | Bacteria | 959 |
| 319 | Ga0207676_12031611 | 3300026095 | Bacteria | 573 |
| 320 | Ga0207674_11709487 | 3300026116 | Bacteria | 597 |
| 321 | Ga0207674_12135809 | 3300026116 | Bacteria | 524 |
| 322 | Ga0207675_100110326 | 3300026118 | Bacteria | 2596 |
| 323 | Ga0207675_102584564 | 3300026118 | Bacteria | 518 |
| 324 | Ga0207683_10020712 | 3300026121 | Bacteria | 5627 |
| 325 | Ga0207683_10202757 | 3300026121 | Bacteria | 1803 |
| 326 | Ga0207698_10277406 | 3300026142 | Bacteria | 1549 |
| 327 | Ga0207698_10359904 | 3300026142 | Bacteria | 1377 |
| 328 | Ga0207698_10933895 | 3300026142 | Bacteria | 876 |
| 329 | Ga0207698_11816804 | 3300026142 | Bacteria | 625 |
| 330 | Ga0209969_1031567 | 3300027360 | Bacteria | 810 |
| 331 | Ga0209981_1028707 | 3300027378 | Bacteria | 812 |
| 332 | Ga0209995_1019364 | 3300027471 | Bacteria | 1123 |
| 333 | Ga0209968_1075956 | 3300027526 | Bacteria | 601 |
| 334 | Ga0209999_1029269 | 3300027543 | Bacteria | 1022 |
| 335 | Ga0209974_10239380 | 3300027876 | Bacteria | 680 |
| 336 | Ga0207428_10042352 | 3300027907 | Unclassified | 3682 |
| 337 | Ga0268266_10278418 | 3300028379 | Bacteria | 1555 |
| 338 | Ga0268266_10411802 | 3300028379 | Bacteria | 1280 |
| 339 | Ga0268266_10765760 | 3300028379 | Bacteria | 932 |
| 340 | Ga0268266_11045934 | 3300028379 | Bacteria | 790 |
| 341 | Ga0268264_10018690 | 3300028381 | Bacteria | 5666 |
| 342 | Ga0268264_10958800 | 3300028381 | Bacteria | 861 |
| 343 | Ga0307517_10410946 | 3300028786 | Bacteria | 713 |
| 344 | Ga0307515_10431508 | 3300028794 | Bacteria | 936 |
| 345 | Ga0265327_10000254 | 3300031251 | Bacteria | 106076 |
| 346 | Ga0265327_10082917 | 3300031251 | Bacteria | 1579 |
| 347 | Ga0307513_10255684 | 3300031456 | Bacteria | 1545 |
| 348 | Ga0307509_10828490 | 3300031507 | Unclassified | 590 |
| 349 | Ga0307408_100005435 | 3300031548 | Bacteria | 8532 |
| 350 | Ga0316576_10549858 | 3300031727 | Bacteria | 846 |
| 351 | Ga0307405_10087254 | 3300031731 | Bacteria | 2056 |
| 352 | Ga0307406_10000094 | 3300031901 | Bacteria | 50309 |
| 353 | Ga0307407_10014946 | 3300031903 | Bacteria | 3817 |
| 354 | Ga0307412_10410982 | 3300031911 | Bacteria | 1104 |
| 355 | Ga0307416_102589836 | 3300032002 | Bacteria | 605 |
| 356 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 357 | Ga0373928_0164818 | 3300035084 | Bacteria | 622 |
| 358 | Ga0373946_0305313 | 3300035171 | Bacteria | 788 |
| 359 | Ga0373937_0512346 | 3300036401 | Bacteria | 1140 |
| 360 | Ga0316584_0094994 | 3300036712 | Bacteria | 2232 |
| 361 | Ga0316584_0794115 | 3300036712 | Bacteria | 643 |
| 362 | Ga0373925_0832368 | 3300037068 | Bacteria | 761 |
| 363 | Ga0395899_0076014 | 3300037312 | Bacteria | 2452 |
| 364 | Ga0395899_0914801 | 3300037312 | Bacteria | 534 |
| 365 | Ga0395898_0345340 | 3300037466 | Bacteria | 1419 |
| 366 | Ga0395905_0420973 | 3300037471 | Bacteria | 1232 |
| 367 | Ga0395901_0738715 | 3300038443 | Bacteria | 978 |
| 368 | Ga0242420_032401 | 3300038996 | Bacteria | 974 |
| 369 | Ga0436365_1048186 | 3300039437 | Bacteria | 1992 |
| 370 | Ga0451793_1606476 | 3300041452 | Bacteria | 1295 |
| 371 | Ga0451798_0224035 | 3300041458 | Bacteria | 1008 |
| 372 | Ga0451855_0007143 | 3300041511 | Bacteria | 511 |
| 373 | Ga0439449_0410455 | 3300042007 | Bacteria | 514 |
| 374 | Ga0439462_0182132 | 3300042015 | Bacteria | 596 |
| 375 | Ga0451577_0140797 | 3300042876 | Bacteria | 2167 |
| 376 | Ga0451577_0378717 | 3300042876 | Bacteria | 1284 |
| 377 | Ga0451577_1122534 | 3300042876 | Bacteria | 703 |
| 378 | Ga0453684_0000462 | 3300044712 | Bacteria | 162338 |
| 379 | Ga0453684_0022557 | 3300044712 | Bacteria | 9331 |
| 380 | Ga0453684_0033523 | 3300044712 | Bacteria | 7156 |
| 381 | Ga0453684_0219449 | 3300044712 | Unclassified | 2203 |
| 382 | Ga0453684_0430392 | 3300044712 | Unclassified | 1472 |
| 383 | Ga0451576_0634985 | 3300045051 | Bacteria | 1122 |
| 384 | Ga0495629_0113581 | 3300046459 | Bacteria | 1888 |
| 385 | Ga0495653_0358161 | 3300046463 | Bacteria | 937 |
| 386 | Ga0495664_0591444 | 3300046477 | Bacteria | 660 |
| 387 | Ga0495584_0555588 | 3300046491 | Bacteria | 585 |
| 388 | Ga0495585_0612162 | 3300046492 | Bacteria | 512 |
| 389 | Ga0495608_0734660 | 3300046511 | Bacteria | 586 |
| 390 | Ga0495666_0549433 | 3300046526 | Bacteria | 515 |
| 391 | Ga0495652_0877708 | 3300046529 | Bacteria | 593 |
| 392 | Ga0495667_0053641 | 3300046559 | Bacteria | 2655 |
| 393 | Ga0495634_0809044 | 3300046642 | Bacteria | 534 |
| 394 | Ga0495635_0104064 | 3300046663 | Bacteria | 1940 |
| 395 | Ga0495659_0082961 | 3300046664 | Bacteria | 1220 |
| 396 | Ga0495657_0143447 | 3300046675 | Bacteria | 1487 |
| 397 | Ga0495623_0046310 | 3300046679 | Bacteria | 2761 |
| 398 | Ga0495658_0375827 | 3300046683 | Bacteria | 904 |
| 399 | Ga0495613_0131313 | 3300046689 | Bacteria | 1793 |
| 400 | Ga0495600_0176547 | 3300046809 | Bacteria | 1377 |
| 401 | Ga0495581_0039403 | 3300047315 | Bacteria | 2735 |
| 402 | Ga0495604_0035817 | 3300047317 | Bacteria | 3917 |
| 403 | Ga0495674_1256494 | 3300047319 | Bacteria | 557 |
| 404 | Ga0495672_0016866 | 3300047320 | Bacteria | 4902 |
| 405 | Ga0495687_000879 | 3300047443 | Bacteria | 31853 |
| 406 | Ga0495675_0044611 | 3300047444 | Bacteria | 2824 |
| 407 | Ga0495684_0020719 | 3300047471 | Bacteria | 5066 |
| 408 | Ga0495684_0039006 | 3300047471 | Bacteria | 3641 |
| 409 | Ga0495686_0030504 | 3300047472 | Bacteria | 3501 |
| 410 | Ga0501299_174589 | 3300049522 | Bacteria | 558 |
| 411 | Ga0501032_0490829 | 3300049569 | Unclassified | 785 |
| 412 | Ga0501033_0050754 | 3300049570 | Bacteria | 3076 |
| 413 | Ga0501034_0037401 | 3300049571 | Bacteria | 4914 |
| 414 | Ga0501034_0108785 | 3300049571 | Bacteria | 2763 |
| 415 | Ga0501034_0123155 | 3300049571 | Bacteria | 2579 |
| 416 | Ga0501038_0632702 | 3300049574 | Unclassified | 807 |
| 417 | Ga0501070_0093179 | 3300049586 | Bacteria | 2492 |
| 418 | Ga0501076_1622425 | 3300049592 | Bacteria | 531 |
| 419 | Ga0501233_130830 | 3300049668 | Bacteria | 686 |
| 420 | Ga0501238_000110 | 3300049671 | Bacteria | 13246 |
| 421 | Ga0501238_000454 | 3300049671 | Bacteria | 4760 |
| 422 | Ga0501249_000012 | 3300049679 | Bacteria | 153759 |
| 423 | Ga0501249_075702 | 3300049679 | Bacteria | 788 |
| 424 | Ga0501241_011103 | 3300049758 | Bacteria | 1636 |
| 425 | Ga0501266_006202 | 3300049763 | Bacteria | 1488 |
| 426 | Ga0501280_005919 | 3300049776 | Bacteria | 1736 |
| 427 | Ga0501035_0004612 | 3300049822 | Bacteria | 13073 |
| 428 | Ga0501044_0127304 | 3300049823 | Bacteria | 2543 |
| 429 | nmdc:mga00v17_102209_c1 | 3300050491 | Bacteria | 1810 |
| 430 | nmdc:mga09592_1484704_c1 | 3300050508 | Bacteria | 552 |
| 431 | nmdc:mga08y16_37064_c1 | 3300050511 | Bacteria | 5120 |
| 432 | nmdc:mga08y16_78724_c1 | 3300050511 | Bacteria | 3436 |
| 433 | nmdc:mga0a205_262389_c1 | 3300050515 | Bacteria | 1605 |
| 434 | Ga0500650_0300122 | 3300053098 | Bacteria | 711 |
| 435 | Ga0500607_000146 | 3300053121 | Bacteria | 59939 |
| 436 | Ga0500568_0030729 | 3300053139 | Bacteria | 2222 |
| 437 | Ga0500573_0174674 | 3300053140 | Bacteria | 1159 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_101930982 | Ga0068868_1019309821 | 104 |
| 2 | 3300025321 | Ga0207656_10356564 | Ga0207656_103565642 | 104 |
| 3 | 3300021384 | Ga0213876_10179589 | Ga0213876_101795892 | 106 |
| 4 | 3300039437 | Ga0436365_1048186 | Ga0436365_1048186_1169_1519 | 106 |
| 5 | 3300026142 | Ga0207698_11816804 | Ga0207698_118168042 | 107 |
| 6 | 3300032002 | Ga0307416_102589836 | Ga0307416_1025898362 | 107 |
| 7 | 3300053098 | Ga0500650_0300122 | Ga0500650_0300122_180_503 | 107 |
| 8 | 3300005290 | Ga0065712_10071173 | Ga0065712_100711734 | 108 |
| 9 | 3300005338 | Ga0068868_100119292 | Ga0068868_1001192922 | 108 |
| 10 | 3300005340 | Ga0070689_100038671 | Ga0070689_1000386714 | 108 |
| 11 | 3300005354 | Ga0070675_100315212 | Ga0070675_1003152121 | 108 |
| 12 | 3300005354 | Ga0070675_101007968 | Ga0070675_1010079681 | 108 |
| 13 | 3300005365 | Ga0070688_100051357 | Ga0070688_1000513572 | 108 |
| 14 | 3300005366 | Ga0070659_100007954 | Ga0070659_1000079547 | 108 |
| 15 | 3300005367 | Ga0070667_100752091 | Ga0070667_1007520911 | 108 |
| 16 | 3300005466 | Ga0070685_10020865 | Ga0070685_100208654 | 108 |
| 17 | 3300005548 | Ga0070665_101802010 | Ga0070665_1018020101 | 108 |
| 18 | 3300005577 | Ga0068857_100380853 | Ga0068857_1003808532 | 108 |
| 19 | 3300005618 | Ga0068864_102355698 | Ga0068864_1023556982 | 108 |
| 20 | 3300005719 | Ga0068861_100052171 | Ga0068861_1000521714 | 108 |
| 21 | 3300005841 | Ga0068863_100147532 | Ga0068863_1001475324 | 108 |
| 22 | 3300005842 | Ga0068858_100350607 | Ga0068858_1003506071 | 108 |
| 23 | 3300005844 | Ga0068862_100572676 | Ga0068862_1005726761 | 108 |
| 24 | 3300006358 | Ga0068871_100669078 | Ga0068871_1006690782 | 108 |
| 25 | 3300009093 | Ga0105240_10078354 | Ga0105240_100783544 | 108 |
| 26 | 3300009174 | Ga0105241_10004950 | Ga0105241_100049503 | 108 |
| 27 | 3300009174 | Ga0105241_10164105 | Ga0105241_101641052 | 108 |
| 28 | 3300009176 | Ga0105242_10101319 | Ga0105242_101013194 | 108 |
| 29 | 3300009176 | Ga0105242_10600940 | Ga0105242_106009402 | 108 |
| 30 | 3300009176 | Ga0105242_11546808 | Ga0105242_115468081 | 108 |
| 31 | 3300009177 | Ga0105248_10174783 | Ga0105248_101747833 | 108 |
| 32 | 3300009545 | Ga0105237_10314787 | Ga0105237_103147872 | 108 |
| 33 | 3300009553 | Ga0105249_10002726 | Ga0105249_1000272617 | 108 |
| 34 | 3300009553 | Ga0105249_10109296 | Ga0105249_101092963 | 108 |
| 35 | 3300010375 | Ga0105239_10123266 | Ga0105239_101232663 | 108 |
| 36 | 3300011119 | Ga0105246_10021614 | Ga0105246_100216143 | 108 |
| 37 | 3300011119 | Ga0105246_10101427 | Ga0105246_101014273 | 108 |
| 38 | 3300013100 | Ga0157373_10002675 | Ga0157373_1000267517 | 108 |
| 39 | 3300013100 | Ga0157373_10025190 | Ga0157373_100251903 | 108 |
| 40 | 3300013104 | Ga0157370_10198550 | Ga0157370_101985502 | 108 |
| 41 | 3300013105 | Ga0157369_10176551 | Ga0157369_101765513 | 108 |
| 42 | 3300013105 | Ga0157369_10594352 | Ga0157369_105943522 | 108 |
| 43 | 3300013296 | Ga0157374_10004368 | Ga0157374_1000436810 | 108 |
| 44 | 3300013296 | Ga0157374_10022899 | Ga0157374_100228995 | 108 |
| 45 | 3300013296 | Ga0157374_10411932 | Ga0157374_104119321 | 108 |
| 46 | 3300013297 | Ga0157378_10469528 | Ga0157378_104695281 | 108 |
| 47 | 3300013306 | Ga0163162_10054907 | Ga0163162_100549074 | 108 |
| 48 | 3300013306 | Ga0163162_10158765 | Ga0163162_101587653 | 108 |
| 49 | 3300013306 | Ga0163162_10623713 | Ga0163162_106237131 | 108 |
| 50 | 3300013307 | Ga0157372_10066962 | Ga0157372_100669623 | 108 |
| 51 | 3300013307 | Ga0157372_10953286 | Ga0157372_109532862 | 108 |
| 52 | 3300013308 | Ga0157375_10015620 | Ga0157375_100156202 | 108 |
| 53 | 3300013308 | Ga0157375_10033149 | Ga0157375_100331495 | 108 |
| 54 | 3300013308 | Ga0157375_10231747 | Ga0157375_102317473 | 108 |
| 55 | 3300013308 | Ga0157375_11819966 | Ga0157375_118199662 | 108 |
| 56 | 3300014326 | Ga0157380_10041358 | Ga0157380_100413582 | 108 |
| 57 | 3300014745 | Ga0157377_10324748 | Ga0157377_103247481 | 108 |
| 58 | 3300014969 | Ga0157376_10427167 | Ga0157376_104271671 | 108 |
| 59 | 3300014969 | Ga0157376_10937604 | Ga0157376_109376042 | 108 |
| 60 | 3300015262 | Ga0182007_10055918 | Ga0182007_100559182 | 108 |
| 61 | 3300017792 | Ga0163161_10010043 | Ga0163161_100100436 | 108 |
| 62 | 3300025893 | Ga0207682_10155554 | Ga0207682_101555542 | 108 |
| 63 | 3300025899 | Ga0207642_10481911 | Ga0207642_104819112 | 108 |
| 64 | 3300025934 | Ga0207686_11191466 | Ga0207686_111914661 | 108 |
| 65 | 3300025936 | Ga0207670_10026209 | Ga0207670_100262092 | 108 |
| 66 | 3300025961 | Ga0207712_10001133 | Ga0207712_1000113317 | 108 |
| 67 | 3300025972 | Ga0207668_11305609 | Ga0207668_113056091 | 108 |
| 68 | 3300026023 | Ga0207677_10946715 | Ga0207677_109467152 | 108 |
| 69 | 3300026035 | Ga0207703_10137466 | Ga0207703_101374664 | 108 |
| 70 | 3300026088 | Ga0207641_10485437 | Ga0207641_104854372 | 108 |
| 71 | 3300026088 | Ga0207641_11718194 | Ga0207641_117181941 | 108 |
| 72 | 3300026095 | Ga0207676_10734683 | Ga0207676_107346832 | 108 |
| 73 | 3300026095 | Ga0207676_12031611 | Ga0207676_120316111 | 108 |
| 74 | 3300026116 | Ga0207674_11709487 | Ga0207674_117094871 | 108 |
| 75 | 3300026118 | Ga0207675_100110326 | Ga0207675_1001103264 | 108 |
| 76 | 3300026142 | Ga0207698_10933895 | Ga0207698_109338951 | 108 |
| 77 | 3300028381 | Ga0268264_10958800 | Ga0268264_109588002 | 108 |
| 78 | 3300031251 | Ga0265327_10000254 | Ga0265327_100002544 | 108 |
| 79 | 3300036401 | Ga0373937_0512346 | Ga0373937_0512346_405_731 | 108 |
| 80 | 3300037068 | Ga0373925_0832368 | Ga0373925_0832368_76_402 | 108 |
| 81 | 3300037471 | Ga0395905_0420973 | Ga0395905_0420973_807_1133 | 108 |
| 82 | 3300038996 | Ga0242420_032401 | Ga0242420_032401_157_483 | 108 |
| 83 | 3300042007 | Ga0439449_0410455 | Ga0439449_0410455_71_397 | 108 |
| 84 | 3300042015 | Ga0439462_0182132 | Ga0439462_0182132_210_536 | 108 |
| 85 | 3300044712 | Ga0453684_0033523 | Ga0453684_0033523_3622_3948 | 108 |
| 86 | 3300046463 | Ga0495653_0358161 | Ga0495653_0358161_589_915 | 108 |
| 87 | 3300046491 | Ga0495584_0555588 | Ga0495584_0555588_97_423 | 108 |
| 88 | 3300046526 | Ga0495666_0549433 | Ga0495666_0549433_100_426 | 108 |
| 89 | 3300046663 | Ga0495635_0104064 | Ga0495635_0104064_533_859 | 108 |
| 90 | 3300046679 | Ga0495623_0046310 | Ga0495623_0046310_1857_2183 | 108 |
| 91 | 3300047443 | Ga0495687_000879 | Ga0495687_000879_2526_2852 | 108 |
| 92 | 3300047471 | Ga0495684_0039006 | Ga0495684_0039006_3018_3344 | 108 |
| 93 | 3300047472 | Ga0495686_0030504 | Ga0495686_0030504_2349_2675 | 108 |
| 94 | 3300049571 | Ga0501034_0123155 | Ga0501034_0123155_2202_2528 | 108 |
| 95 | 3300053140 | Ga0500573_0174674 | Ga0500573_0174674_436_762 | 108 |
| 96 | 3300014969 | Ga0157376_10146603 | Ga0157376_101466033 | 109 |
| 97 | iso_pu_bacteria | 2857613821 | 2857617903 | 112 |
| 98 | iso_pu_bacteria | 2904419702 | 2904423096 | 112 |
| 99 | 3300005344 | Ga0070661_100015586 | Ga0070661_1000155863 | 113 |
| 100 | 3300005366 | Ga0070659_100486372 | Ga0070659_1004863722 | 113 |
| 101 | 3300005455 | Ga0070663_100229321 | Ga0070663_1002293212 | 113 |
| 102 | 3300025315 | Ga0207697_10023313 | Ga0207697_100233131 | 113 |
| 103 | 3300025945 | Ga0207679_10061272 | Ga0207679_100612721 | 113 |
| 104 | 3300026067 | Ga0207678_10038539 | Ga0207678_100385392 | 113 |
| 105 | 3300042876 | Ga0451577_0378717 | Ga0451577_0378717_633_974 | 113 |
| 106 | iso_pu_bacteria | 2643221699 | 2644548488 | 113 |
| 107 | iso_pu_bacteria | 2919462493 | 2919466772 | 113 |
| 108 | 3300005290 | Ga0065712_10076109 | Ga0065712_100761095 | 115 |
| 109 | 3300005331 | Ga0070670_101486591 | Ga0070670_1014865911 | 115 |
| 110 | 3300005334 | Ga0068869_100000824 | Ga0068869_1000008243 | 115 |
| 111 | 3300005353 | Ga0070669_101788444 | Ga0070669_1017884441 | 115 |
| 112 | 3300005354 | Ga0070675_100054564 | Ga0070675_1000545642 | 115 |
| 113 | 3300005364 | Ga0070673_100632266 | Ga0070673_1006322662 | 115 |
| 114 | 3300005543 | Ga0070672_100558009 | Ga0070672_1005580093 | 115 |
| 115 | 3300005563 | Ga0068855_100536309 | Ga0068855_1005363091 | 115 |
| 116 | 3300014326 | Ga0157380_10161953 | Ga0157380_101619532 | 115 |
| 117 | 3300025923 | Ga0207681_11074225 | Ga0207681_110742251 | 115 |
| 118 | 3300025925 | Ga0207650_10814087 | Ga0207650_108140872 | 115 |
| 119 | 3300025926 | Ga0207659_10084624 | Ga0207659_100846242 | 115 |
| 120 | 3300025942 | Ga0207689_10007844 | Ga0207689_100078442 | 115 |
| 121 | 3300025945 | Ga0207679_10374348 | Ga0207679_103743482 | 115 |
| 122 | 3300025949 | Ga0207667_10765610 | Ga0207667_107656102 | 115 |
| 123 | 3300041452 | Ga0451793_1606476 | Ga0451793_1606476_475_822 | 115 |
| 124 | 3300049570 | Ga0501033_0050754 | Ga0501033_0050754_2207_2554 | 115 |
| 125 | 3300049671 | Ga0501238_000454 | Ga0501238_000454_3084_3431 | 115 |
| 126 | 3300053139 | Ga0500568_0030729 | Ga0500568_0030729_524_904 | 115 |
| 127 | 3300003320 | rootH2_10011515 | rootH2_100115159 | 116 |
| 128 | 3300003320 | rootH2_10063812 | rootH2_100638124 | 116 |
| 129 | 3300003323 | rootH1_10001123 | rootH1_100011235 | 116 |
| 130 | 3300003323 | rootH1_10013541 | rootH1_1001354114 | 116 |
| 131 | 3300005288 | Ga0065714_10002194 | Ga0065714_1000219411 | 116 |
| 132 | 3300005327 | Ga0070658_11008621 | Ga0070658_110086212 | 116 |
| 133 | 3300005327 | Ga0070658_11710277 | Ga0070658_117102771 | 116 |
| 134 | 3300005328 | Ga0070676_10015570 | Ga0070676_100155704 | 116 |
| 135 | 3300005329 | Ga0070683_100147357 | Ga0070683_1001473573 | 116 |
| 136 | 3300005329 | Ga0070683_100160243 | Ga0070683_1001602432 | 116 |
| 137 | 3300005329 | Ga0070683_100407974 | Ga0070683_1004079742 | 116 |
| 138 | 3300005331 | Ga0070670_100214041 | Ga0070670_1002140412 | 116 |
| 139 | 3300005331 | Ga0070670_100862606 | Ga0070670_1008626062 | 116 |
| 140 | 3300005334 | Ga0068869_100117825 | Ga0068869_1001178252 | 116 |
| 141 | 3300005334 | Ga0068869_100219986 | Ga0068869_1002199863 | 116 |
| 142 | 3300005334 | Ga0068869_100673088 | Ga0068869_1006730882 | 116 |
| 143 | 3300005334 | Ga0068869_100909971 | Ga0068869_1009099712 | 116 |
| 144 | 3300005335 | Ga0070666_10012781 | Ga0070666_100127814 | 116 |
| 145 | 3300005335 | Ga0070666_10078447 | Ga0070666_100784474 | 116 |
| 146 | 3300005336 | Ga0070680_100091839 | Ga0070680_1000918392 | 116 |
| 147 | 3300005336 | Ga0070680_100261036 | Ga0070680_1002610361 | 116 |
| 148 | 3300005339 | Ga0070660_100270886 | Ga0070660_1002708862 | 116 |
| 149 | 3300005339 | Ga0070660_100471046 | Ga0070660_1004710462 | 116 |
| 150 | 3300005341 | Ga0070691_11007904 | Ga0070691_110079041 | 116 |
| 151 | 3300005343 | Ga0070687_100286701 | Ga0070687_1002867012 | 116 |
| 152 | 3300005347 | Ga0070668_100086398 | Ga0070668_1000863984 | 116 |
| 153 | 3300005353 | Ga0070669_100053889 | Ga0070669_1000538893 | 116 |
| 154 | 3300005353 | Ga0070669_101338167 | Ga0070669_1013381671 | 116 |
| 155 | 3300005354 | Ga0070675_100000132 | Ga0070675_10000013233 | 116 |
| 156 | 3300005354 | Ga0070675_100998843 | Ga0070675_1009988431 | 116 |
| 157 | 3300005355 | Ga0070671_100111911 | Ga0070671_1001119113 | 116 |
| 158 | 3300005355 | Ga0070671_100704122 | Ga0070671_1007041221 | 116 |
| 159 | 3300005356 | Ga0070674_100138042 | Ga0070674_1001380422 | 116 |
| 160 | 3300005364 | Ga0070673_100012041 | Ga0070673_1000120414 | 116 |
| 161 | 3300005364 | Ga0070673_100316294 | Ga0070673_1003162942 | 116 |
| 162 | 3300005365 | Ga0070688_100735675 | Ga0070688_1007356751 | 116 |
| 163 | 3300005366 | Ga0070659_100541122 | Ga0070659_1005411222 | 116 |
| 164 | 3300005367 | Ga0070667_100010737 | Ga0070667_1000107372 | 116 |
| 165 | 3300005367 | Ga0070667_100424371 | Ga0070667_1004243712 | 116 |
| 166 | 3300005367 | Ga0070667_101167491 | Ga0070667_1011674911 | 116 |
| 167 | 3300005436 | Ga0070713_100299041 | Ga0070713_1002990412 | 116 |
| 168 | 3300005436 | Ga0070713_100329699 | Ga0070713_1003296991 | 116 |
| 169 | 3300005438 | Ga0070701_10903567 | Ga0070701_109035671 | 116 |
| 170 | 3300005441 | Ga0070700_101768796 | Ga0070700_1017687961 | 116 |
| 171 | 3300005445 | Ga0070708_101301136 | Ga0070708_1013011362 | 116 |
| 172 | 3300005456 | Ga0070678_100071188 | Ga0070678_1000711884 | 116 |
| 173 | 3300005456 | Ga0070678_100347707 | Ga0070678_1003477071 | 116 |
| 174 | 3300005458 | Ga0070681_10147045 | Ga0070681_101470453 | 116 |
| 175 | 3300005466 | Ga0070685_10060162 | Ga0070685_100601622 | 116 |
| 176 | 3300005466 | Ga0070685_10121234 | Ga0070685_101212342 | 116 |
| 177 | 3300005467 | Ga0070706_100528396 | Ga0070706_1005283962 | 116 |
| 178 | 3300005530 | Ga0070679_100179567 | Ga0070679_1001795673 | 116 |
| 179 | 3300005530 | Ga0070679_100179736 | Ga0070679_1001797362 | 116 |
| 180 | 3300005535 | Ga0070684_100141367 | Ga0070684_1001413673 | 116 |
| 181 | 3300005535 | Ga0070684_101498158 | Ga0070684_1014981581 | 116 |
| 182 | 3300005543 | Ga0070672_100010123 | Ga0070672_1000101232 | 116 |
| 183 | 3300005543 | Ga0070672_100091930 | Ga0070672_1000919302 | 116 |
| 184 | 3300005543 | Ga0070672_100455235 | Ga0070672_1004552353 | 116 |
| 185 | 3300005543 | Ga0070672_100474672 | Ga0070672_1004746722 | 116 |
| 186 | 3300005544 | Ga0070686_100269992 | Ga0070686_1002699922 | 116 |
| 187 | 3300005548 | Ga0070665_100000442 | Ga0070665_10000044220 | 116 |
| 188 | 3300005548 | Ga0070665_100173433 | Ga0070665_1001734333 | 116 |
| 189 | 3300005548 | Ga0070665_100277243 | Ga0070665_1002772433 | 116 |
| 190 | 3300005549 | Ga0070704_100635048 | Ga0070704_1006350481 | 116 |
| 191 | 3300005549 | Ga0070704_100936074 | Ga0070704_1009360742 | 116 |
| 192 | 3300005563 | Ga0068855_100113043 | Ga0068855_1001130434 | 116 |
| 193 | 3300005563 | Ga0068855_100697031 | Ga0068855_1006970312 | 116 |
| 194 | 3300005564 | Ga0070664_100019667 | Ga0070664_1000196676 | 116 |
| 195 | 3300005577 | Ga0068857_100390915 | Ga0068857_1003909151 | 116 |
| 196 | 3300005577 | Ga0068857_101623057 | Ga0068857_1016230572 | 116 |
| 197 | 3300005577 | Ga0068857_102292657 | Ga0068857_1022926571 | 116 |
| 198 | 3300005578 | Ga0068854_100151671 | Ga0068854_1001516713 | 116 |
| 199 | 3300005614 | Ga0068856_100003990 | Ga0068856_1000039904 | 116 |
| 200 | 3300005614 | Ga0068856_100642478 | Ga0068856_1006424781 | 116 |
| 201 | 3300005615 | Ga0070702_100997944 | Ga0070702_1009979442 | 116 |
| 202 | 3300005616 | Ga0068852_101473255 | Ga0068852_1014732551 | 116 |
| 203 | 3300005617 | Ga0068859_100008549 | Ga0068859_1000085495 | 116 |
| 204 | 3300005617 | Ga0068859_100029283 | Ga0068859_1000292832 | 116 |
| 205 | 3300005617 | Ga0068859_100058913 | Ga0068859_1000589134 | 116 |
| 206 | 3300005617 | Ga0068859_102365791 | Ga0068859_1023657912 | 116 |
| 207 | 3300005618 | Ga0068864_100204361 | Ga0068864_1002043613 | 116 |
| 208 | 3300005618 | Ga0068864_100523989 | Ga0068864_1005239892 | 116 |
| 209 | 3300005718 | Ga0068866_10116656 | Ga0068866_101166563 | 116 |
| 210 | 3300005840 | Ga0068870_10223347 | Ga0068870_102233472 | 116 |
| 211 | 3300005841 | Ga0068863_100199136 | Ga0068863_1001991363 | 116 |
| 212 | 3300005841 | Ga0068863_100869250 | Ga0068863_1008692501 | 116 |
| 213 | 3300005842 | Ga0068858_100101040 | Ga0068858_1001010402 | 116 |
| 214 | 3300005842 | Ga0068858_101353256 | Ga0068858_1013532562 | 116 |
| 215 | 3300005843 | Ga0068860_100025373 | Ga0068860_1000253735 | 116 |
| 216 | 3300005843 | Ga0068860_100161201 | Ga0068860_1001612012 | 116 |
| 217 | 3300006042 | Ga0075368_10470770 | Ga0075368_104707702 | 116 |
| 218 | 3300006051 | Ga0075364_10067455 | Ga0075364_100674552 | 116 |
| 219 | 3300006058 | Ga0075432_10365355 | Ga0075432_103653551 | 116 |
| 220 | 3300006177 | Ga0075362_10135882 | Ga0075362_101358823 | 116 |
| 221 | 3300006237 | Ga0097621_100021727 | Ga0097621_1000217272 | 116 |
| 222 | 3300006237 | Ga0097621_100069948 | Ga0097621_1000699482 | 116 |
| 223 | 3300006237 | Ga0097621_100194731 | Ga0097621_1001947314 | 116 |
| 224 | 3300006237 | Ga0097621_100560655 | Ga0097621_1005606551 | 116 |
| 225 | 3300006237 | Ga0097621_100664845 | Ga0097621_1006648451 | 116 |
| 226 | 3300006358 | Ga0068871_100001750 | Ga0068871_10000175017 | 116 |
| 227 | 3300006358 | Ga0068871_100064806 | Ga0068871_1000648064 | 116 |
| 228 | 3300006358 | Ga0068871_100103942 | Ga0068871_1001039422 | 116 |
| 229 | 3300006358 | Ga0068871_100209430 | Ga0068871_1002094304 | 116 |
| 230 | 3300006844 | Ga0075428_100068233 | Ga0075428_1000682333 | 116 |
| 231 | 3300006844 | Ga0075428_100350047 | Ga0075428_1003500473 | 116 |
| 232 | 3300006846 | Ga0075430_100006345 | Ga0075430_10000634512 | 116 |
| 233 | 3300006847 | Ga0075431_100035304 | Ga0075431_1000353045 | 116 |
| 234 | 3300006852 | Ga0075433_10793634 | Ga0075433_107936342 | 116 |
| 235 | 3300006871 | Ga0075434_100149350 | Ga0075434_1001493502 | 116 |
| 236 | 3300006880 | Ga0075429_100147349 | Ga0075429_1001473491 | 116 |
| 237 | 3300006880 | Ga0075429_100455107 | Ga0075429_1004551072 | 116 |
| 238 | 3300006881 | Ga0068865_100256562 | Ga0068865_1002565621 | 116 |
| 239 | 3300006914 | Ga0075436_100463698 | Ga0075436_1004636981 | 116 |
| 240 | 3300006931 | Ga0097620_100008549 | Ga0097620_1000085498 | 116 |
| 241 | 3300006931 | Ga0097620_100029283 | Ga0097620_1000292832 | 116 |
| 242 | 3300006931 | Ga0097620_100058913 | Ga0097620_1000589134 | 116 |
| 243 | 3300006931 | Ga0097620_102365544 | Ga0097620_1023655441 | 116 |
| 244 | 3300009093 | Ga0105240_10234083 | Ga0105240_102340832 | 116 |
| 245 | 3300009093 | Ga0105240_10356823 | Ga0105240_103568232 | 116 |
| 246 | 3300009093 | Ga0105240_12281855 | Ga0105240_122818551 | 116 |
| 247 | 3300009094 | Ga0111539_10420346 | Ga0111539_104203462 | 116 |
| 248 | 3300009094 | Ga0111539_11599377 | Ga0111539_115993771 | 116 |
| 249 | 3300009098 | Ga0105245_10371948 | Ga0105245_103719483 | 116 |
| 250 | 3300009147 | Ga0114129_11523455 | Ga0114129_115234551 | 116 |
| 251 | 3300009148 | Ga0105243_11298410 | Ga0105243_112984102 | 116 |
| 252 | 3300009174 | Ga0105241_10719624 | Ga0105241_107196241 | 116 |
| 253 | 3300009176 | Ga0105242_10071789 | Ga0105242_100717892 | 116 |
| 254 | 3300009177 | Ga0105248_10042830 | Ga0105248_100428302 | 116 |
| 255 | 3300009553 | Ga0105249_10049822 | Ga0105249_100498227 | 116 |
| 256 | 3300009553 | Ga0105249_10234172 | Ga0105249_102341723 | 116 |
| 257 | 3300009553 | Ga0105249_10535907 | Ga0105249_105359072 | 116 |
| 258 | 3300010375 | Ga0105239_11771551 | Ga0105239_117715512 | 116 |
| 259 | 3300011119 | Ga0105246_10774384 | Ga0105246_107743842 | 116 |
| 260 | 3300013100 | Ga0157373_10205524 | Ga0157373_102055241 | 116 |
| 261 | 3300013102 | Ga0157371_10178916 | Ga0157371_101789163 | 116 |
| 262 | 3300013104 | Ga0157370_10015874 | Ga0157370_100158742 | 116 |
| 263 | 3300013104 | Ga0157370_10174927 | Ga0157370_101749272 | 116 |
| 264 | 3300013105 | Ga0157369_10770043 | Ga0157369_107700432 | 116 |
| 265 | 3300013105 | Ga0157369_10882656 | Ga0157369_108826562 | 116 |
| 266 | 3300013297 | Ga0157378_10288020 | Ga0157378_102880203 | 116 |
| 267 | 3300013306 | Ga0163162_10030639 | Ga0163162_100306397 | 116 |
| 268 | 3300013307 | Ga0157372_10284611 | Ga0157372_102846113 | 116 |
| 269 | 3300013307 | Ga0157372_10301862 | Ga0157372_103018623 | 116 |
| 270 | 3300013307 | Ga0157372_10410949 | Ga0157372_104109492 | 116 |
| 271 | 3300013308 | Ga0157375_10696872 | Ga0157375_106968721 | 116 |
| 272 | 3300014325 | Ga0163163_10019486 | Ga0163163_100194862 | 116 |
| 273 | 3300014326 | Ga0157380_10122869 | Ga0157380_101228691 | 116 |
| 274 | 3300014326 | Ga0157380_10417518 | Ga0157380_104175181 | 116 |
| 275 | 3300014745 | Ga0157377_10043132 | Ga0157377_100431322 | 116 |
| 276 | 3300014968 | Ga0157379_10022917 | Ga0157379_100229174 | 116 |
| 277 | 3300014969 | Ga0157376_10007990 | Ga0157376_100079906 | 116 |
| 278 | 3300014969 | Ga0157376_10160754 | Ga0157376_101607542 | 116 |
| 279 | 3300014969 | Ga0157376_12873484 | Ga0157376_128734841 | 116 |
| 280 | 3300017792 | Ga0163161_11066603 | Ga0163161_110666032 | 116 |
| 281 | 3300025250 | Ga0209026_1000844 | Ga0209026_100084413 | 116 |
| 282 | 3300025315 | Ga0207697_10068244 | Ga0207697_100682441 | 116 |
| 283 | 3300025901 | Ga0207688_10581396 | Ga0207688_105813962 | 116 |
| 284 | 3300025903 | Ga0207680_10156424 | Ga0207680_101564242 | 116 |
| 285 | 3300025903 | Ga0207680_10708643 | Ga0207680_107086431 | 116 |
| 286 | 3300025904 | Ga0207647_10013145 | Ga0207647_100131451 | 116 |
| 287 | 3300025904 | Ga0207647_10208701 | Ga0207647_102087012 | 116 |
| 288 | 3300025907 | Ga0207645_10018735 | Ga0207645_100187354 | 116 |
| 289 | 3300025908 | Ga0207643_10089829 | Ga0207643_100898292 | 116 |
| 290 | 3300025908 | Ga0207643_10440260 | Ga0207643_104402601 | 116 |
| 291 | 3300025911 | Ga0207654_10378183 | Ga0207654_103781832 | 116 |
| 292 | 3300025911 | Ga0207654_10930184 | Ga0207654_109301841 | 116 |
| 293 | 3300025912 | Ga0207707_10302961 | Ga0207707_103029611 | 116 |
| 294 | 3300025913 | Ga0207695_10005702 | Ga0207695_100057024 | 116 |
| 295 | 3300025913 | Ga0207695_10452288 | Ga0207695_104522882 | 116 |
| 296 | 3300025913 | Ga0207695_10761023 | Ga0207695_107610232 | 116 |
| 297 | 3300025917 | Ga0207660_10032554 | Ga0207660_100325544 | 116 |
| 298 | 3300025918 | Ga0207662_10104850 | Ga0207662_101048502 | 116 |
| 299 | 3300025919 | Ga0207657_10082599 | Ga0207657_100825992 | 116 |
| 300 | 3300025919 | Ga0207657_10666564 | Ga0207657_106665641 | 116 |
| 301 | 3300025921 | Ga0207652_10001149 | Ga0207652_100011498 | 116 |
| 302 | 3300025921 | Ga0207652_10194317 | Ga0207652_101943173 | 116 |
| 303 | 3300025921 | Ga0207652_11395279 | Ga0207652_113952792 | 116 |
| 304 | 3300025923 | Ga0207681_10407946 | Ga0207681_104079462 | 116 |
| 305 | 3300025923 | Ga0207681_10524906 | Ga0207681_105249062 | 116 |
| 306 | 3300025925 | Ga0207650_10026536 | Ga0207650_100265362 | 116 |
| 307 | 3300025925 | Ga0207650_10110949 | Ga0207650_101109492 | 116 |
| 308 | 3300025925 | Ga0207650_10314681 | Ga0207650_103146812 | 116 |
| 309 | 3300025926 | Ga0207659_10000063 | Ga0207659_1000006326 | 116 |
| 310 | 3300025926 | Ga0207659_10703367 | Ga0207659_107033671 | 116 |
| 311 | 3300025926 | Ga0207659_10854862 | Ga0207659_108548621 | 116 |
| 312 | 3300025926 | Ga0207659_10970915 | Ga0207659_109709151 | 116 |
| 313 | 3300025926 | Ga0207659_11844057 | Ga0207659_118440571 | 116 |
| 314 | 3300025931 | Ga0207644_10129606 | Ga0207644_101296062 | 116 |
| 315 | 3300025933 | Ga0207706_10224631 | Ga0207706_102246312 | 116 |
| 316 | 3300025934 | Ga0207686_10083911 | Ga0207686_100839113 | 116 |
| 317 | 3300025935 | Ga0207709_10727319 | Ga0207709_107273192 | 116 |
| 318 | 3300025936 | Ga0207670_10233657 | Ga0207670_102336573 | 116 |
| 319 | 3300025937 | Ga0207669_10326463 | Ga0207669_103264632 | 116 |
| 320 | 3300025937 | Ga0207669_10488609 | Ga0207669_104886091 | 116 |
| 321 | 3300025937 | Ga0207669_10662113 | Ga0207669_106621132 | 116 |
| 322 | 3300025938 | Ga0207704_10180202 | Ga0207704_101802023 | 116 |
| 323 | 3300025940 | Ga0207691_10021716 | Ga0207691_100217162 | 116 |
| 324 | 3300025940 | Ga0207691_10197266 | Ga0207691_101972661 | 116 |
| 325 | 3300025941 | Ga0207711_10001259 | Ga0207711_1000125913 | 116 |
| 326 | 3300025942 | Ga0207689_10002805 | Ga0207689_100028052 | 116 |
| 327 | 3300025942 | Ga0207689_10145969 | Ga0207689_101459692 | 116 |
| 328 | 3300025942 | Ga0207689_10577328 | Ga0207689_105773282 | 116 |
| 329 | 3300025942 | Ga0207689_11639733 | Ga0207689_116397331 | 116 |
| 330 | 3300025944 | Ga0207661_10254858 | Ga0207661_102548581 | 116 |
| 331 | 3300025944 | Ga0207661_10302569 | Ga0207661_103025691 | 116 |
| 332 | 3300025944 | Ga0207661_10831199 | Ga0207661_108311992 | 116 |
| 333 | 3300025949 | Ga0207667_10001143 | Ga0207667_1000114318 | 116 |
| 334 | 3300025949 | Ga0207667_10173377 | Ga0207667_101733772 | 116 |
| 335 | 3300025960 | Ga0207651_10032769 | Ga0207651_100327692 | 116 |
| 336 | 3300025960 | Ga0207651_11614893 | Ga0207651_116148931 | 116 |
| 337 | 3300025961 | Ga0207712_10313326 | Ga0207712_103133262 | 116 |
| 338 | 3300025961 | Ga0207712_10469136 | Ga0207712_104691362 | 116 |
| 339 | 3300025972 | Ga0207668_11695097 | Ga0207668_116950971 | 116 |
| 340 | 3300025981 | Ga0207640_10249148 | Ga0207640_102491482 | 116 |
| 341 | 3300025986 | Ga0207658_10023121 | Ga0207658_100231214 | 116 |
| 342 | 3300025986 | Ga0207658_10817970 | Ga0207658_108179701 | 116 |
| 343 | 3300026023 | Ga0207677_10208040 | Ga0207677_102080402 | 116 |
| 344 | 3300026035 | Ga0207703_10017470 | Ga0207703_100174704 | 116 |
| 345 | 3300026035 | Ga0207703_12341906 | Ga0207703_123419061 | 116 |
| 346 | 3300026041 | Ga0207639_11926498 | Ga0207639_119264981 | 116 |
| 347 | 3300026078 | Ga0207702_10000196 | Ga0207702_1000019626 | 116 |
| 348 | 3300026078 | Ga0207702_10677096 | Ga0207702_106770961 | 116 |
| 349 | 3300026088 | Ga0207641_10028597 | Ga0207641_100285974 | 116 |
| 350 | 3300026088 | Ga0207641_10227736 | Ga0207641_102277364 | 116 |
| 351 | 3300026089 | Ga0207648_10002623 | Ga0207648_1000262310 | 116 |
| 352 | 3300026089 | Ga0207648_11576673 | Ga0207648_115766731 | 116 |
| 353 | 3300026095 | Ga0207676_10096862 | Ga0207676_100968624 | 116 |
| 354 | 3300026095 | Ga0207676_10390189 | Ga0207676_103901892 | 116 |
| 355 | 3300026116 | Ga0207674_12135809 | Ga0207674_121358092 | 116 |
| 356 | 3300026118 | Ga0207675_102584564 | Ga0207675_1025845641 | 116 |
| 357 | 3300026121 | Ga0207683_10020712 | Ga0207683_100207124 | 116 |
| 358 | 3300026121 | Ga0207683_10202757 | Ga0207683_102027573 | 116 |
| 359 | 3300026142 | Ga0207698_10277406 | Ga0207698_102774063 | 116 |
| 360 | 3300026142 | Ga0207698_10359904 | Ga0207698_103599041 | 116 |
| 361 | 3300027360 | Ga0209969_1031567 | Ga0209969_10315672 | 116 |
| 362 | 3300027378 | Ga0209981_1028707 | Ga0209981_10287071 | 116 |
| 363 | 3300027471 | Ga0209995_1019364 | Ga0209995_10193642 | 116 |
| 364 | 3300027526 | Ga0209968_1075956 | Ga0209968_10759561 | 116 |
| 365 | 3300027543 | Ga0209999_1029269 | Ga0209999_10292692 | 116 |
| 366 | 3300027876 | Ga0209974_10239380 | Ga0209974_102393801 | 116 |
| 367 | 3300027907 | Ga0207428_10042352 | Ga0207428_100423524 | 116 |
| 368 | 3300028379 | Ga0268266_10278418 | Ga0268266_102784182 | 116 |
| 369 | 3300028379 | Ga0268266_10411802 | Ga0268266_104118021 | 116 |
| 370 | 3300028379 | Ga0268266_10765760 | Ga0268266_107657602 | 116 |
| 371 | 3300028379 | Ga0268266_11045934 | Ga0268266_110459341 | 116 |
| 372 | 3300028381 | Ga0268264_10018690 | Ga0268264_100186904 | 116 |
| 373 | 3300028786 | Ga0307517_10410946 | Ga0307517_104109462 | 116 |
| 374 | 3300028794 | Ga0307515_10431508 | Ga0307515_104315081 | 116 |
| 375 | 3300031251 | Ga0265327_10082917 | Ga0265327_100829172 | 116 |
| 376 | 3300031456 | Ga0307513_10255684 | Ga0307513_102556842 | 116 |
| 377 | 3300031507 | Ga0307509_10828490 | Ga0307509_108284901 | 116 |
| 378 | 3300031548 | Ga0307408_100005435 | Ga0307408_1000054355 | 116 |
| 379 | 3300031727 | Ga0316576_10549858 | Ga0316576_105498582 | 116 |
| 380 | 3300031731 | Ga0307405_10087254 | Ga0307405_100872543 | 116 |
| 381 | 3300031901 | Ga0307406_10000094 | Ga0307406_1000009448 | 116 |
| 382 | 3300031903 | Ga0307407_10014946 | Ga0307407_100149466 | 116 |
| 383 | 3300031911 | Ga0307412_10410982 | Ga0307412_104109822 | 116 |
| 384 | 3300032004 | Ga0307414_10000011 | Ga0307414_10000011130 | 116 |
| 385 | 3300035084 | Ga0373928_0164818 | Ga0373928_0164818_245_595 | 116 |
| 386 | 3300035171 | Ga0373946_0305313 | Ga0373946_0305313_154_504 | 116 |
| 387 | 3300036712 | Ga0316584_0094994 | Ga0316584_0094994_415_765 | 116 |
| 388 | 3300036712 | Ga0316584_0794115 | Ga0316584_0794115_126_476 | 116 |
| 389 | 3300037312 | Ga0395899_0076014 | Ga0395899_0076014_508_858 | 116 |
| 390 | 3300037312 | Ga0395899_0914801 | Ga0395899_0914801_31_381 | 116 |
| 391 | 3300037466 | Ga0395898_0345340 | Ga0395898_0345340_738_1088 | 116 |
| 392 | 3300038443 | Ga0395901_0738715 | Ga0395901_0738715_533_883 | 116 |
| 393 | 3300041458 | Ga0451798_0224035 | Ga0451798_0224035_583_933 | 116 |
| 394 | 3300041511 | Ga0451855_0007143 | Ga0451855_0007143_96_446 | 116 |
| 395 | 3300042876 | Ga0451577_0140797 | Ga0451577_0140797_143_493 | 116 |
| 396 | 3300042876 | Ga0451577_1122534 | Ga0451577_1122534_178_528 | 116 |
| 397 | 3300044712 | Ga0453684_0000462 | Ga0453684_0000462_61136_61489 | 116 |
| 398 | 3300044712 | Ga0453684_0022557 | Ga0453684_0022557_7718_8092 | 116 |
| 399 | 3300044712 | Ga0453684_0219449 | Ga0453684_0219449_870_1220 | 116 |
| 400 | 3300044712 | Ga0453684_0430392 | Ga0453684_0430392_878_1228 | 116 |
| 401 | 3300045051 | Ga0451576_0634985 | Ga0451576_0634985_336_686 | 116 |
| 402 | 3300046459 | Ga0495629_0113581 | Ga0495629_0113581_218_568 | 116 |
| 403 | 3300046477 | Ga0495664_0591444 | Ga0495664_0591444_212_562 | 116 |
| 404 | 3300046492 | Ga0495585_0612162 | Ga0495585_0612162_118_468 | 116 |
| 405 | 3300046511 | Ga0495608_0734660 | Ga0495608_0734660_224_574 | 116 |
| 406 | 3300046529 | Ga0495652_0877708 | Ga0495652_0877708_165_515 | 116 |
| 407 | 3300046559 | Ga0495667_0053641 | Ga0495667_0053641_1791_2141 | 116 |
| 408 | 3300046642 | Ga0495634_0809044 | Ga0495634_0809044_40_390 | 116 |
| 409 | 3300046664 | Ga0495659_0082961 | Ga0495659_0082961_222_572 | 116 |
| 410 | 3300046675 | Ga0495657_0143447 | Ga0495657_0143447_530_880 | 116 |
| 411 | 3300046683 | Ga0495658_0375827 | Ga0495658_0375827_256_606 | 116 |
| 412 | 3300046689 | Ga0495613_0131313 | Ga0495613_0131313_431_781 | 116 |
| 413 | 3300046809 | Ga0495600_0176547 | Ga0495600_0176547_533_883 | 116 |
| 414 | 3300047315 | Ga0495581_0039403 | Ga0495581_0039403_2316_2666 | 116 |
| 415 | 3300047317 | Ga0495604_0035817 | Ga0495604_0035817_1925_2275 | 116 |
| 416 | 3300047319 | Ga0495674_1256494 | Ga0495674_1256494_146_496 | 116 |
| 417 | 3300047320 | Ga0495672_0016866 | Ga0495672_0016866_4212_4562 | 116 |
| 418 | 3300047444 | Ga0495675_0044611 | Ga0495675_0044611_67_417 | 116 |
| 419 | 3300047471 | Ga0495684_0020719 | Ga0495684_0020719_909_1259 | 116 |
| 420 | 3300049522 | Ga0501299_174589 | Ga0501299_174589_91_441 | 116 |
| 421 | 3300049569 | Ga0501032_0490829 | Ga0501032_0490829_353_703 | 116 |
| 422 | 3300049571 | Ga0501034_0037401 | Ga0501034_0037401_3641_3991 | 116 |
| 423 | 3300049571 | Ga0501034_0108785 | Ga0501034_0108785_1220_1570 | 116 |
| 424 | 3300049574 | Ga0501038_0632702 | Ga0501038_0632702_287_637 | 116 |
| 425 | 3300049586 | Ga0501070_0093179 | Ga0501070_0093179_35_385 | 116 |
| 426 | 3300049592 | Ga0501076_1622425 | Ga0501076_1622425_112_462 | 116 |
| 427 | 3300049668 | Ga0501233_130830 | Ga0501233_130830_36_386 | 116 |
| 428 | 3300049671 | Ga0501238_000110 | Ga0501238_000110_10537_10887 | 116 |
| 429 | 3300049679 | Ga0501249_000012 | Ga0501249_000012_60212_60562 | 116 |
| 430 | 3300049679 | Ga0501249_075702 | Ga0501249_075702_342_692 | 116 |
| 431 | 3300049758 | Ga0501241_011103 | Ga0501241_011103_1142_1492 | 116 |
| 432 | 3300049763 | Ga0501266_006202 | Ga0501266_006202_686_1036 | 116 |
| 433 | 3300049776 | Ga0501280_005919 | Ga0501280_005919_151_501 | 116 |
| 434 | 3300049822 | Ga0501035_0004612 | Ga0501035_0004612_9227_9577 | 116 |
| 435 | 3300049823 | Ga0501044_0127304 | Ga0501044_0127304_2115_2465 | 116 |
| 436 | 3300050491 | nmdc:mga00v17_102209_c1 | nmdc:mga00v17_102209_c1_140_496 | 116 |
| 437 | 3300050508 | nmdc:mga09592_1484704_c1 | nmdc:mga09592_1484704_c1_147_497 | 116 |
| 438 | 3300050511 | nmdc:mga08y16_37064_c1 | nmdc:mga08y16_37064_c1_1199_1549 | 116 |
| 439 | 3300050511 | nmdc:mga08y16_78724_c1 | nmdc:mga08y16_78724_c1_2311_2661 | 116 |
| 440 | 3300050515 | nmdc:mga0a205_262389_c1 | nmdc:mga0a205_262389_c1_1059_1409 | 116 |
| 441 | 3300053121 | Ga0500607_000146 | Ga0500607_000146_20961_21317 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c9p-assembly1.cif.gz_A | crystal structure of uncharacterized protein sp1917 | 0.9363 | 1 | 115 |
| 3c9p-assembly1.cif.gz_A | crystal structure of uncharacterized protein sp1917 | 0.9134 | 1 | 115 |
| 6p0d-assembly1.cif.gz_A | human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick | 0.3412 | 30 | 115 |
| 7rcx-assembly1.cif.gz_A | crystal structure of c. difficile penicillin-binding protein 2 in apo form | 0.3318 | 15 | 115 |
| 7rcx-assembly1.cif.gz_A | crystal structure of c. difficile penicillin-binding protein 2 in apo form | 0.2904 | 15 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c9pA00 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain | 0.9399 | 4 | 115 | 1.10.8.290 |
| 3c9pA00 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain | 0.8862 | 4 | 115 | 1.10.8.290 |
| af_P9WHV3_1_82_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.8009 | 9 | 115 | 1.10.8.10 |
| af_Q2FWE1_2_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7909 | 9 | 115 | 1.10.8.10 |
| af_P0ACC1_1_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7626 | 9 | 115 | 1.10.8.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I7ZNW3-F1-model_v4 | deleted | 1.002 | 4 | 116 |
|
| AF-A0A1A3MNP2-F1-model_v4 | deleted | 1.002 | 5 | 115 |
|
| AF-A0A560WHY9-F1-model_v4 | DUF2200 family protein | 1.002 | 5 | 116 |
|
| AF-A0A200HG91-F1-model_v4 | DUF2200 domain-containing protein | 1.002 | 9 | 116 |
|
| AF-A0A1H4HYB9-F1-model_v4 | deleted | 1.001 | 4 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar