F444586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 441 | 310 | 408 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100012154|Ga0070683_1000121547 |
| Length | 225 |
| Sequence | VQDAVFKKTKLCVNLSLSEIIMASVPKVLVLYYSAYGHIETMAYAEADGARAAGAHVDIKRVPELVPEDVARNAHFKLDQAAPIARIDDLADYDAVIVGAGTRFGRLPSQLASFLDQAGGLWQRGAMHGKVGGAFSCSATQHGGQETTLFSIITNLLHFGMVIVGMDYGHAGQMTLAEITGGSPYGATTIAGSDGSRKPTENELQGARYQGRKIAETAKRLVQGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 4 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 5 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 6 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 7 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 8 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 9 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 10 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 11 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 12 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 13 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 14 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 15 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 16 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 17 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 18 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 19 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 20 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 21 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 22 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 23 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 24 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 25 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 26 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 27 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 28 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 29 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 30 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 232 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 233 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 270 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 288 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 293 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 298 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 299 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 300 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 302 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 306 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 310 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.52 |
| Metatranscriptomes | 0 |
| Isolates | 7.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.45 |
| Bulb | 0 |
| Endosphere | 13.38 |
| Nodule | 0.68 |
| Rhizoplane | 4.54 |
| Rhizosphere | 72.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000187 | 3300001989 | Bacteria | 20509 |
| 2 | JGI24739J22299_10004073 | 3300001989 | Bacteria | 5588 |
| 3 | JGI24738J21930_10013414 | 3300002075 | Bacteria | 1773 |
| 4 | JGI25150J39212_1000398 | 3300002774 | Bacteria | 20361 |
| 5 | JGI25151J46595_10050349 | 3300003187 | Bacteria | 1420 |
| 6 | JGI25153J46596_10000091 | 3300003215 | Bacteria | 105614 |
| 7 | JGI25153J46596_10015585 | 3300003215 | Bacteria | 3087 |
| 8 | rootL2_10181224 | 3300003322 | Bacteria | 3591 |
| 9 | Ga0055526_1011643 | 3300003771 | Bacteria | 3937 |
| 10 | Ga0055537_1001470 | 3300003773 | Bacteria | 9160 |
| 11 | Ga0055537_1001547 | 3300003773 | Bacteria | 8796 |
| 12 | Ga0055524_1001171 | 3300003775 | Bacteria | 15663 |
| 13 | Ga0055536_1022900 | 3300003781 | Bacteria | 1849 |
| 14 | Ga0055530_10038540 | 3300003791 | Bacteria | 1187 |
| 15 | Ga0055540_1003107 | 3300003792 | Bacteria | 8242 |
| 16 | Ga0055531_10000116 | 3300003794 | Bacteria | 88368 |
| 17 | Ga0055531_10016434 | 3300003794 | Bacteria | 3191 |
| 18 | Ga0070676_10114046 | 3300005328 | Bacteria | 1687 |
| 19 | Ga0070683_100012154 | 3300005329 | Bacteria | 7472 |
| 20 | Ga0070683_100645829 | 3300005329 | Bacteria | 1013 |
| 21 | Ga0070690_100011616 | 3300005330 | Bacteria | 5155 |
| 22 | Ga0070690_100068072 | 3300005330 | Bacteria | 2309 |
| 23 | Ga0070670_100015212 | 3300005331 | Bacteria | 6604 |
| 24 | Ga0070670_100367459 | 3300005331 | Bacteria | 1266 |
| 25 | Ga0070666_10032078 | 3300005335 | Bacteria | 3469 |
| 26 | Ga0070680_100295190 | 3300005336 | Bacteria | 1374 |
| 27 | Ga0070689_100005535 | 3300005340 | Bacteria | 8640 |
| 28 | Ga0070687_100322212 | 3300005343 | Bacteria | 988 |
| 29 | Ga0070669_100000048 | 3300005353 | Bacteria | 118472 |
| 30 | Ga0070669_100078138 | 3300005353 | Bacteria | 2459 |
| 31 | Ga0070669_100199859 | 3300005353 | Bacteria | 1572 |
| 32 | Ga0070671_100434795 | 3300005355 | Bacteria | 1125 |
| 33 | Ga0070674_100074560 | 3300005356 | Bacteria | 2408 |
| 34 | Ga0070688_100156024 | 3300005365 | Bacteria | 1564 |
| 35 | Ga0070667_100013798 | 3300005367 | Bacteria | 6678 |
| 36 | Ga0070667_100196335 | 3300005367 | Bacteria | 1789 |
| 37 | Ga0070667_100410982 | 3300005367 | Bacteria | 1233 |
| 38 | Ga0070667_101008622 | 3300005367 | Bacteria | 777 |
| 39 | Ga0070703_10147694 | 3300005406 | Bacteria | 880 |
| 40 | Ga0070709_10167097 | 3300005434 | Bacteria | 1534 |
| 41 | Ga0070709_10723891 | 3300005434 | Bacteria | 776 |
| 42 | Ga0070714_100465814 | 3300005435 | Bacteria | 1202 |
| 43 | Ga0070713_100218775 | 3300005436 | Bacteria | 1727 |
| 44 | Ga0070713_100261759 | 3300005436 | Bacteria | 1581 |
| 45 | Ga0070713_100292313 | 3300005436 | Bacteria | 1498 |
| 46 | Ga0070701_10019277 | 3300005438 | Bacteria | 3220 |
| 47 | Ga0070711_100488195 | 3300005439 | Bacteria | 1014 |
| 48 | Ga0070700_100082962 | 3300005441 | Bacteria | 2074 |
| 49 | Ga0070700_100105616 | 3300005441 | Bacteria | 1863 |
| 50 | Ga0070663_100181016 | 3300005455 | Bacteria | 1635 |
| 51 | Ga0070678_100103936 | 3300005456 | Bacteria | 2208 |
| 52 | Ga0070662_100111467 | 3300005457 | Bacteria | 2085 |
| 53 | Ga0070662_100628624 | 3300005457 | Bacteria | 905 |
| 54 | Ga0070681_10061334 | 3300005458 | Bacteria | 3735 |
| 55 | Ga0068867_100210568 | 3300005459 | Bacteria | 1561 |
| 56 | Ga0070698_100244150 | 3300005471 | Bacteria | 1729 |
| 57 | Ga0070684_100038055 | 3300005535 | Bacteria | 4130 |
| 58 | Ga0068853_100003308 | 3300005539 | Bacteria | 12328 |
| 59 | Ga0070672_100013803 | 3300005543 | Bacteria | 5713 |
| 60 | Ga0070672_100018096 | 3300005543 | Bacteria | 5086 |
| 61 | Ga0070686_100011665 | 3300005544 | Bacteria | 4992 |
| 62 | Ga0070695_100025959 | 3300005545 | Bacteria | 3622 |
| 63 | Ga0070693_100350753 | 3300005547 | Bacteria | 1010 |
| 64 | Ga0070665_100001518 | 3300005548 | Bacteria | 26902 |
| 65 | Ga0070665_100033290 | 3300005548 | Bacteria | 5187 |
| 66 | Ga0070665_100442050 | 3300005548 | Bacteria | 1310 |
| 67 | Ga0068855_100829450 | 3300005563 | Bacteria | 981 |
| 68 | Ga0068857_100015451 | 3300005577 | Bacteria | 6668 |
| 69 | Ga0068857_100100477 | 3300005577 | Bacteria | 2595 |
| 70 | Ga0068857_100476835 | 3300005577 | Bacteria | 1169 |
| 71 | Ga0068854_100103914 | 3300005578 | Bacteria | 2133 |
| 72 | Ga0068854_100114747 | 3300005578 | Bacteria | 2037 |
| 73 | Ga0068856_100166150 | 3300005614 | Bacteria | 2218 |
| 74 | Ga0070702_100023095 | 3300005615 | Bacteria | 3300 |
| 75 | Ga0070702_100319660 | 3300005615 | Bacteria | 1081 |
| 76 | Ga0068852_100040621 | 3300005616 | Bacteria | 3926 |
| 77 | Ga0068852_100161441 | 3300005616 | Bacteria | 2093 |
| 78 | Ga0068852_100616019 | 3300005616 | Bacteria | 1091 |
| 79 | Ga0068859_100080765 | 3300005617 | Bacteria | 3293 |
| 80 | Ga0068859_100080948 | 3300005617 | Bacteria | 3289 |
| 81 | Ga0068864_100030628 | 3300005618 | Bacteria | 4561 |
| 82 | Ga0068864_100176295 | 3300005618 | Bacteria | 1952 |
| 83 | Ga0068861_100013245 | 3300005719 | Bacteria | 5769 |
| 84 | Ga0068861_100023529 | 3300005719 | Bacteria | 4444 |
| 85 | Ga0068870_10263909 | 3300005840 | Bacteria | 1073 |
| 86 | Ga0068863_100009439 | 3300005841 | Bacteria | 9522 |
| 87 | Ga0068858_100042308 | 3300005842 | Bacteria | 4224 |
| 88 | Ga0068858_100514419 | 3300005842 | Bacteria | 1157 |
| 89 | Ga0068860_100003140 | 3300005843 | Bacteria | 17062 |
| 90 | Ga0068862_100000128 | 3300005844 | Bacteria | 88625 |
| 91 | Ga0068862_100018129 | 3300005844 | Bacteria | 5862 |
| 92 | Ga0081540_1079531 | 3300005983 | Bacteria | 1482 |
| 93 | Ga0081540_1110481 | 3300005983 | Bacteria | 1163 |
| 94 | Ga0070715_10006908 | 3300006163 | Bacteria | 3882 |
| 95 | Ga0070716_100093407 | 3300006173 | Bacteria | 1826 |
| 96 | Ga0070716_100478570 | 3300006173 | Bacteria | 914 |
| 97 | Ga0070712_100301214 | 3300006175 | Bacteria | 1298 |
| 98 | Ga0070712_100434911 | 3300006175 | Bacteria | 1090 |
| 99 | Ga0070712_100499769 | 3300006175 | Bacteria | 1019 |
| 100 | Ga0070712_100504633 | 3300006175 | Bacteria | 1014 |
| 101 | Ga0070712_100539682 | 3300006175 | Bacteria | 982 |
| 102 | Ga0075367_10140624 | 3300006178 | Bacteria | 1495 |
| 103 | Ga0097621_100005591 | 3300006237 | Bacteria | 8862 |
| 104 | Ga0097621_100035992 | 3300006237 | Bacteria | 3957 |
| 105 | Ga0097621_100164191 | 3300006237 | Bacteria | 1911 |
| 106 | Ga0068871_100009486 | 3300006358 | Bacteria | 7056 |
| 107 | Ga0075428_100192132 | 3300006844 | Bacteria | 2208 |
| 108 | Ga0075431_100033581 | 3300006847 | Bacteria | 5287 |
| 109 | Ga0075434_100616883 | 3300006871 | Bacteria | 1104 |
| 110 | Ga0075429_100033627 | 3300006880 | Bacteria | 4455 |
| 111 | Ga0068865_100556386 | 3300006881 | Bacteria | 964 |
| 112 | Ga0097620_100080771 | 3300006931 | Bacteria | 3293 |
| 113 | Ga0097620_100080948 | 3300006931 | Bacteria | 3289 |
| 114 | Ga0079104_1025245 | 3300006946 | Bacteria | 1554 |
| 115 | Ga0099795_10135000 | 3300007788 | Bacteria | 999 |
| 116 | Ga0099795_10144347 | 3300007788 | Bacteria | 970 |
| 117 | Ga0105240_10271431 | 3300009093 | Bacteria | 1952 |
| 118 | Ga0105240_10424330 | 3300009093 | Bacteria | 1493 |
| 119 | Ga0105240_10823402 | 3300009093 | Bacteria | 1004 |
| 120 | Ga0111539_10004917 | 3300009094 | Bacteria | 17386 |
| 121 | Ga0105245_10059426 | 3300009098 | Bacteria | 3443 |
| 122 | Ga0105247_10301597 | 3300009101 | Bacteria | 1112 |
| 123 | Ga0105241_10040059 | 3300009174 | Bacteria | 3536 |
| 124 | Ga0105248_10006025 | 3300009177 | Bacteria | 13310 |
| 125 | Ga0105237_10055213 | 3300009545 | Bacteria | 3979 |
| 126 | Ga0105237_10356146 | 3300009545 | Bacteria | 1468 |
| 127 | Ga0105238_10003746 | 3300009551 | Bacteria | 15114 |
| 128 | Ga0105238_10415273 | 3300009551 | Bacteria | 1340 |
| 129 | Ga0105249_10017944 | 3300009553 | Bacteria | 6288 |
| 130 | Ga0099796_10018016 | 3300010159 | Bacteria | 2113 |
| 131 | Ga0105239_10210111 | 3300010375 | Bacteria | 2181 |
| 132 | Ga0105239_10479976 | 3300010375 | Bacteria | 1412 |
| 133 | Ga0157369_10000203 | 3300013105 | Bacteria | 82075 |
| 134 | Ga0157369_10047048 | 3300013105 | Bacteria | 4686 |
| 135 | Ga0157374_10014743 | 3300013296 | Bacteria | 6845 |
| 136 | Ga0163162_11091412 | 3300013306 | Bacteria | 904 |
| 137 | Ga0157372_11089811 | 3300013307 | Bacteria | 924 |
| 138 | Ga0157375_10008148 | 3300013308 | Bacteria | 9168 |
| 139 | Ga0157375_10058145 | 3300013308 | Bacteria | 3825 |
| 140 | Ga0163163_10010812 | 3300014325 | Bacteria | 8239 |
| 141 | Ga0157380_10001615 | 3300014326 | Bacteria | 14859 |
| 142 | Ga0157380_10001902 | 3300014326 | Bacteria | 13842 |
| 143 | Ga0157380_10019159 | 3300014326 | Bacteria | 5097 |
| 144 | Ga0157379_10040277 | 3300014968 | Bacteria | 4169 |
| 145 | Ga0157379_10493701 | 3300014968 | Bacteria | 1134 |
| 146 | Ga0157376_10012042 | 3300014969 | Bacteria | 6402 |
| 147 | Ga0157376_10438534 | 3300014969 | Bacteria | 1271 |
| 148 | Ga0157376_10514801 | 3300014969 | Bacteria | 1178 |
| 149 | Ga0183363_1006 | 3300015690 | Bacteria | 400466 |
| 150 | Ga0213872_10200437 | 3300021361 | Bacteria | 856 |
| 151 | Ga0207425_1000049 | 3300025245 | Bacteria | 180735 |
| 152 | Ga0209129_1001668 | 3300025258 | Bacteria | 12020 |
| 153 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 154 | Ga0209565_1000170 | 3300025263 | Bacteria | 84580 |
| 155 | Ga0209673_1007604 | 3300025273 | Bacteria | 4953 |
| 156 | Ga0209673_1011741 | 3300025273 | Bacteria | 3587 |
| 157 | Ga0209673_1026853 | 3300025273 | Bacteria | 1883 |
| 158 | Ga0209675_1004240 | 3300025291 | Bacteria | 6463 |
| 159 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 160 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 161 | Ga0209564_1000335 | 3300025295 | Bacteria | 91079 |
| 162 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 163 | Ga0209758_1011544 | 3300025297 | Bacteria | 5098 |
| 164 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 165 | Ga0209050_1000196 | 3300025298 | Bacteria | 135678 |
| 166 | Ga0209050_1006899 | 3300025298 | Bacteria | 6573 |
| 167 | Ga0209050_1009345 | 3300025298 | Bacteria | 5034 |
| 168 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 169 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 170 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 171 | Ga0209257_1000228 | 3300025304 | Bacteria | 133390 |
| 172 | Ga0209257_1003180 | 3300025304 | Bacteria | 14609 |
| 173 | Ga0209257_1003572 | 3300025304 | Bacteria | 13185 |
| 174 | Ga0209257_1003678 | 3300025304 | Bacteria | 12808 |
| 175 | Ga0209257_1017255 | 3300025304 | Bacteria | 2857 |
| 176 | Ga0207697_10000121 | 3300025315 | Bacteria | 37017 |
| 177 | Ga0207682_10040628 | 3300025893 | Bacteria | 1896 |
| 178 | Ga0207688_10265855 | 3300025901 | Bacteria | 1042 |
| 179 | Ga0207647_10158858 | 3300025904 | Bacteria | 1319 |
| 180 | Ga0207685_10046675 | 3300025905 | Bacteria | 1650 |
| 181 | Ga0207645_10138227 | 3300025907 | Bacteria | 1587 |
| 182 | Ga0207654_10421846 | 3300025911 | Bacteria | 931 |
| 183 | Ga0207695_10143982 | 3300025913 | Bacteria | 2329 |
| 184 | Ga0207671_10012108 | 3300025914 | Bacteria | 6965 |
| 185 | Ga0207671_10417264 | 3300025914 | Bacteria | 1068 |
| 186 | Ga0207693_10049743 | 3300025915 | Bacteria | 3292 |
| 187 | Ga0207693_10140223 | 3300025915 | Bacteria | 1901 |
| 188 | Ga0207662_10163293 | 3300025918 | Bacteria | 1424 |
| 189 | Ga0207681_10000050 | 3300025923 | Bacteria | 118481 |
| 190 | Ga0207681_10157855 | 3300025923 | Bacteria | 1706 |
| 191 | Ga0207681_10163083 | 3300025923 | Bacteria | 1682 |
| 192 | Ga0207694_10000156 | 3300025924 | Bacteria | 70186 |
| 193 | Ga0207694_10143037 | 3300025924 | Bacteria | 1924 |
| 194 | Ga0207650_10025436 | 3300025925 | Bacteria | 4216 |
| 195 | Ga0207659_10687758 | 3300025926 | Bacteria | 875 |
| 196 | Ga0207700_10064965 | 3300025928 | Bacteria | 2782 |
| 197 | Ga0207706_10673618 | 3300025933 | Bacteria | 885 |
| 198 | Ga0207686_10399439 | 3300025934 | Bacteria | 1047 |
| 199 | Ga0207670_10039997 | 3300025936 | Bacteria | 3075 |
| 200 | Ga0207669_10230327 | 3300025937 | Bacteria | 1366 |
| 201 | Ga0207704_10289622 | 3300025938 | Bacteria | 1249 |
| 202 | Ga0207704_10539106 | 3300025938 | Bacteria | 946 |
| 203 | Ga0207665_10037340 | 3300025939 | Bacteria | 3233 |
| 204 | Ga0207691_10011743 | 3300025940 | Bacteria | 8411 |
| 205 | Ga0207691_10870986 | 3300025940 | Bacteria | 755 |
| 206 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 207 | Ga0207689_10159272 | 3300025942 | Bacteria | 1860 |
| 208 | Ga0207679_10077157 | 3300025945 | Bacteria | 2534 |
| 209 | Ga0207679_10238576 | 3300025945 | Bacteria | 1539 |
| 210 | Ga0207679_10855550 | 3300025945 | Bacteria | 831 |
| 211 | Ga0207667_10000068 | 3300025949 | Bacteria | 180716 |
| 212 | Ga0207667_10858155 | 3300025949 | Bacteria | 902 |
| 213 | Ga0207712_10009031 | 3300025961 | Bacteria | 6306 |
| 214 | Ga0207668_10455061 | 3300025972 | Bacteria | 1093 |
| 215 | Ga0207640_10033155 | 3300025981 | Bacteria | 3211 |
| 216 | Ga0207640_10045007 | 3300025981 | Bacteria | 2832 |
| 217 | Ga0207658_10015230 | 3300025986 | Bacteria | 5275 |
| 218 | Ga0207658_10274338 | 3300025986 | Bacteria | 1443 |
| 219 | Ga0207658_10345265 | 3300025986 | Bacteria | 1295 |
| 220 | Ga0207703_10025739 | 3300026035 | Bacteria | 4629 |
| 221 | Ga0207703_10552901 | 3300026035 | Bacteria | 1085 |
| 222 | Ga0207639_10013049 | 3300026041 | Bacteria | 5801 |
| 223 | Ga0207639_10038916 | 3300026041 | Bacteria | 3540 |
| 224 | Ga0207678_10245170 | 3300026067 | Bacteria | 1534 |
| 225 | Ga0207708_10046743 | 3300026075 | Bacteria | 3296 |
| 226 | Ga0207708_10049054 | 3300026075 | Bacteria | 3214 |
| 227 | Ga0207702_10261774 | 3300026078 | Bacteria | 1629 |
| 228 | Ga0207641_10842462 | 3300026088 | Bacteria | 909 |
| 229 | Ga0207648_10234868 | 3300026089 | Bacteria | 1631 |
| 230 | Ga0207676_10119246 | 3300026095 | Bacteria | 2222 |
| 231 | Ga0207676_10246969 | 3300026095 | Bacteria | 1604 |
| 232 | Ga0207674_10018140 | 3300026116 | Bacteria | 7657 |
| 233 | Ga0207674_10203543 | 3300026116 | Bacteria | 1929 |
| 234 | Ga0207674_10629631 | 3300026116 | Bacteria | 1036 |
| 235 | Ga0207675_100019225 | 3300026118 | Bacteria | 6374 |
| 236 | Ga0207675_100026894 | 3300026118 | Bacteria | 5355 |
| 237 | Ga0207675_100084745 | 3300026118 | Bacteria | 2974 |
| 238 | Ga0207675_100178561 | 3300026118 | Bacteria | 2032 |
| 239 | Ga0207683_10104012 | 3300026121 | Bacteria | 2537 |
| 240 | Ga0207698_10073640 | 3300026142 | Bacteria | 2721 |
| 241 | Ga0207698_10720180 | 3300026142 | Bacteria | 994 |
| 242 | Ga0209588_1119422 | 3300027671 | Bacteria | 844 |
| 243 | Ga0265356_1001571 | 3300028017 | Bacteria | 3325 |
| 244 | Ga0268266_10001573 | 3300028379 | Bacteria | 26671 |
| 245 | Ga0268266_10087063 | 3300028379 | Bacteria | 2732 |
| 246 | Ga0268265_10000102 | 3300028380 | Bacteria | 106737 |
| 247 | Ga0268264_10025820 | 3300028381 | Bacteria | 4797 |
| 248 | Ga0265334_10014803 | 3300028573 | Bacteria | 3247 |
| 249 | Ga0265318_10000078 | 3300028577 | Bacteria | 90755 |
| 250 | Ga0265318_10004942 | 3300028577 | Bacteria | 6360 |
| 251 | Ga0307517_10176347 | 3300028786 | Bacteria | 1391 |
| 252 | Ga0265338_10000043 | 3300028800 | Bacteria | 226293 |
| 253 | Ga0265330_10016096 | 3300031235 | Bacteria | 3454 |
| 254 | Ga0265332_10012204 | 3300031238 | Bacteria | 3812 |
| 255 | Ga0265325_10000002 | 3300031241 | Bacteria | 396758 |
| 256 | Ga0265340_10039226 | 3300031247 | Bacteria | 2338 |
| 257 | Ga0265339_10000216 | 3300031249 | Bacteria | 47017 |
| 258 | Ga0265331_10011034 | 3300031250 | Bacteria | 4958 |
| 259 | Ga0265327_10003282 | 3300031251 | Bacteria | 15669 |
| 260 | Ga0307513_10173344 | 3300031456 | Bacteria | 2031 |
| 261 | Ga0307513_10599181 | 3300031456 | Bacteria | 811 |
| 262 | Ga0307408_100052870 | 3300031548 | Bacteria | 2932 |
| 263 | Ga0307408_100060793 | 3300031548 | Bacteria | 2755 |
| 264 | Ga0307408_100143556 | 3300031548 | Bacteria | 1876 |
| 265 | Ga0265313_10001374 | 3300031595 | Bacteria | 22847 |
| 266 | Ga0307508_10117653 | 3300031616 | Bacteria | 2259 |
| 267 | Ga0265314_10021331 | 3300031711 | Bacteria | 4983 |
| 268 | Ga0265314_10344900 | 3300031711 | Bacteria | 821 |
| 269 | Ga0265342_10048271 | 3300031712 | Bacteria | 2553 |
| 270 | Ga0265342_10086061 | 3300031712 | Bacteria | 1808 |
| 271 | Ga0307516_10032551 | 3300031730 | Bacteria | 5250 |
| 272 | Ga0307405_10076332 | 3300031731 | Bacteria | 2173 |
| 273 | Ga0307413_10007820 | 3300031824 | Bacteria | 4998 |
| 274 | Ga0307406_10009523 | 3300031901 | Bacteria | 5453 |
| 275 | Ga0307406_10028440 | 3300031901 | Bacteria | 3377 |
| 276 | Ga0307406_10605444 | 3300031901 | Bacteria | 904 |
| 277 | Ga0307407_10007455 | 3300031903 | Bacteria | 4957 |
| 278 | Ga0307407_10099316 | 3300031903 | Bacteria | 1803 |
| 279 | Ga0307412_10082796 | 3300031911 | Bacteria | 2222 |
| 280 | Ga0307412_10129044 | 3300031911 | Bacteria | 1833 |
| 281 | Ga0307409_100039036 | 3300031995 | Bacteria | 3519 |
| 282 | Ga0307409_100118023 | 3300031995 | Bacteria | 2240 |
| 283 | Ga0307409_100330613 | 3300031995 | Bacteria | 1430 |
| 284 | Ga0307416_100019723 | 3300032002 | Bacteria | 4789 |
| 285 | Ga0307414_10930625 | 3300032004 | Bacteria | 798 |
| 286 | Ga0307411_10048029 | 3300032005 | Bacteria | 2763 |
| 287 | Ga0307415_100439979 | 3300032126 | Bacteria | 1124 |
| 288 | Ga0373954_0344424 | 3300035118 | Bacteria | 736 |
| 289 | Ga0373955_0339355 | 3300035172 | Bacteria | 909 |
| 290 | Ga0373927_0035173 | 3300035695 | Bacteria | 3258 |
| 291 | Ga0373947_0326313 | 3300035725 | Bacteria | 1027 |
| 292 | Ga0373925_0251703 | 3300037068 | Bacteria | 1417 |
| 293 | Ga0395905_0026307 | 3300037471 | Bacteria | 5487 |
| 294 | Ga0395905_0867592 | 3300037471 | Bacteria | 806 |
| 295 | Ga0436364_0887588 | 3300037853 | Bacteria | 796 |
| 296 | Ga0395901_0220414 | 3300038443 | Bacteria | 1983 |
| 297 | Ga0436360_0889201 | 3300039438 | Bacteria | 999 |
| 298 | Ga0436361_0656345 | 3300039447 | Bacteria | 1224 |
| 299 | Ga0436363_1040323 | 3300039450 | Bacteria | 956 |
| 300 | Ga0439436_0055204 | 3300041404 | Bacteria | 1116 |
| 301 | Ga0439439_0000197 | 3300041406 | Bacteria | 9225 |
| 302 | Ga0439461_0014747 | 3300041410 | Bacteria | 1490 |
| 303 | Ga0439465_0006757 | 3300041413 | Bacteria | 3643 |
| 304 | Ga0451791_0180526 | 3300041451 | Bacteria | 679 |
| 305 | Ga0451849_1579085 | 3300041505 | Bacteria | 1389 |
| 306 | Ga0439431_0085488 | 3300041997 | Bacteria | 854 |
| 307 | Ga0439432_043912 | 3300042006 | Bacteria | 1409 |
| 308 | Ga0450888_040420 | 3300042126 | Bacteria | 647 |
| 309 | Ga0439458_0097291 | 3300042157 | Bacteria | 762 |
| 310 | Ga0451577_0888450 | 3300042876 | Bacteria | 803 |
| 311 | Ga0495590_0295845 | 3300046457 | Bacteria | 608 |
| 312 | Ga0495638_0001099 | 3300046460 | Bacteria | 26383 |
| 313 | Ga0495638_0076725 | 3300046460 | Bacteria | 2036 |
| 314 | Ga0495606_0279658 | 3300046507 | Bacteria | 913 |
| 315 | Ga0495608_0393956 | 3300046511 | Bacteria | 848 |
| 316 | Ga0495616_0000360 | 3300046513 | Bacteria | 35740 |
| 317 | Ga0495628_0372853 | 3300046516 | Bacteria | 1046 |
| 318 | Ga0495628_0384822 | 3300046516 | Bacteria | 1027 |
| 319 | Ga0495668_0078747 | 3300046616 | Bacteria | 1809 |
| 320 | Ga0495625_0000054 | 3300046660 | Bacteria | 187599 |
| 321 | Ga0495625_0120696 | 3300046660 | Bacteria | 1784 |
| 322 | Ga0495661_0033296 | 3300046665 | Bacteria | 3252 |
| 323 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 324 | Ga0495670_0401545 | 3300046691 | Bacteria | 740 |
| 325 | Ga0495671_0083767 | 3300046692 | Bacteria | 1563 |
| 326 | Ga0495660_0372904 | 3300046810 | Bacteria | 630 |
| 327 | Ga0495674_0146134 | 3300047319 | Bacteria | 1985 |
| 328 | Ga0495674_0603112 | 3300047319 | Bacteria | 870 |
| 329 | Ga0495673_0000600 | 3300047469 | Bacteria | 35843 |
| 330 | Ga0495681_0025398 | 3300047470 | Bacteria | 3100 |
| 331 | Ga0495686_0137553 | 3300047472 | Bacteria | 1444 |
| 332 | Ga0496101_0833909 | 3300048904 | Bacteria | 727 |
| 333 | Ga0496102_0492594 | 3300048905 | Bacteria | 1147 |
| 334 | Ga0496102_0646273 | 3300048905 | Bacteria | 981 |
| 335 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 336 | Ga0496104_0008260 | 3300048907 | Bacteria | 9243 |
| 337 | Ga0496104_0024084 | 3300048907 | Bacteria | 5602 |
| 338 | Ga0496104_0097029 | 3300048907 | Bacteria | 2821 |
| 339 | Ga0496104_0419721 | 3300048907 | Bacteria | 1250 |
| 340 | Ga0496105_0002020 | 3300048908 | Bacteria | 14656 |
| 341 | Ga0496105_0033403 | 3300048908 | Bacteria | 4225 |
| 342 | Ga0496108_0003757 | 3300048911 | Bacteria | 12168 |
| 343 | Ga0496109_0001984 | 3300048912 | Bacteria | 16959 |
| 344 | Ga0496109_0293576 | 3300048912 | Bacteria | 1533 |
| 345 | Ga0496110_0097886 | 3300048913 | Bacteria | 2628 |
| 346 | Ga0496111_0379381 | 3300048914 | Bacteria | 1045 |
| 347 | Ga0496114_0087188 | 3300048917 | Bacteria | 2646 |
| 348 | Ga0496114_0459556 | 3300048917 | Bacteria | 1127 |
| 349 | Ga0496115_0001359 | 3300048918 | Bacteria | 17461 |
| 350 | Ga0496116_0002416 | 3300048919 | Bacteria | 19675 |
| 351 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 352 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 353 | Ga0496118_0330231 | 3300048921 | Bacteria | 823 |
| 354 | Ga0496119_0009737 | 3300048922 | Bacteria | 8182 |
| 355 | Ga0496120_0074129 | 3300048923 | Bacteria | 1860 |
| 356 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 357 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 358 | Ga0496124_0000129 | 3300048927 | Bacteria | 156648 |
| 359 | Ga0496124_0018814 | 3300048927 | Bacteria | 6452 |
| 360 | Ga0496124_0040847 | 3300048927 | Bacteria | 4008 |
| 361 | Ga0496124_0356267 | 3300048927 | Bacteria | 1033 |
| 362 | Ga0496125_0124827 | 3300048928 | Bacteria | 1827 |
| 363 | Ga0496125_0146798 | 3300048928 | Bacteria | 1628 |
| 364 | Ga0496126_0001609 | 3300048929 | Bacteria | 34276 |
| 365 | Ga0496126_0004119 | 3300048929 | Bacteria | 17590 |
| 366 | Ga0496126_0005832 | 3300048929 | Bacteria | 13922 |
| 367 | Ga0496126_0402304 | 3300048929 | Bacteria | 1110 |
| 368 | Ga0495682_0002446 | 3300049460 | Bacteria | 8778 |
| 369 | Ga0501036_1311913 | 3300049572 | Bacteria | 588 |
| 370 | Ga0501042_0159021 | 3300049578 | Bacteria | 1630 |
| 371 | Ga0501047_0065937 | 3300049581 | Bacteria | 3490 |
| 372 | Ga0501068_0000771 | 3300049584 | Bacteria | 16509 |
| 373 | Ga0501069_0095231 | 3300049585 | Bacteria | 1686 |
| 374 | Ga0501070_0064531 | 3300049586 | Bacteria | 3032 |
| 375 | Ga0501071_0011277 | 3300049587 | Bacteria | 6014 |
| 376 | Ga0501073_0002694 | 3300049589 | Bacteria | 13298 |
| 377 | Ga0501076_0016598 | 3300049592 | Bacteria | 5583 |
| 378 | Ga0501077_0012798 | 3300049593 | Bacteria | 5257 |
| 379 | Ga0501225_0002106 | 3300049705 | Bacteria | 6185 |
| 380 | Ga0501079_0000016 | 3300049741 | Bacteria | 65975 |
| 381 | Ga0501080_0000319 | 3300049742 | Bacteria | 36724 |
| 382 | Ga0501083_0015178 | 3300049744 | Bacteria | 5393 |
| 383 | Ga0501241_022387 | 3300049758 | Bacteria | 1167 |
| 384 | nmdc:mga06z11_62275_c1 | 3300050494 | Bacteria | 1948 |
| 385 | nmdc:mga06r32_26358_c1 | 3300050510 | Bacteria | 5418 |
| 386 | nmdc:mga0rr50_1260189_c1 | 3300050513 | Bacteria | 627 |
| 387 | nmdc:mga0rr50_1368332_c1 | 3300050513 | Bacteria | 599 |
| 388 | nmdc:mga0sz30_13312_c1 | 3300050516 | Bacteria | 3219 |
| 389 | Ga0500643_056086 | 3300053087 | Bacteria | 1115 |
| 390 | Ga0500644_0000228 | 3300053088 | Bacteria | 32096 |
| 391 | Ga0500566_0089168 | 3300053094 | Bacteria | 1706 |
| 392 | Ga0500556_0006177 | 3300053104 | Bacteria | 3397 |
| 393 | Ga0500562_028128 | 3300053108 | Bacteria | 1477 |
| 394 | Ga0500607_000052 | 3300053121 | Bacteria | 80355 |
| 395 | Ga0500614_177200 | 3300053123 | Bacteria | 651 |
| 396 | Ga0500655_002963 | 3300053133 | Bacteria | 3080 |
| 397 | Ga0500658_0009388 | 3300053134 | Bacteria | 3608 |
| 398 | Ga0500658_0161825 | 3300053134 | Bacteria | 1013 |
| 399 | Ga0500559_0003408 | 3300053136 | Bacteria | 7828 |
| 400 | Ga0500564_000157 | 3300053138 | Bacteria | 17802 |
| 401 | Ga0500564_021329 | 3300053138 | Bacteria | 2967 |
| 402 | Ga0500604_0019199 | 3300053151 | Bacteria | 1912 |
| 403 | Ga0500619_010208 | 3300053154 | Bacteria | 2365 |
| 404 | Ga0500622_0008175 | 3300053156 | Bacteria | 5876 |
| 405 | Ga0500622_0015639 | 3300053156 | Bacteria | 4062 |
| 406 | Ga0500637_0178320 | 3300053178 | Bacteria | 1219 |
| 407 | Ga0501084_0003301 | 3300054114 | Bacteria | 13049 |
| 408 | Ga0501082_0110085 | 3300060353 | Bacteria | 2384 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0330231 | Ga0496118_0330231_237_800 | 178 |
| 2 | 3300007788 | Ga0099795_10135000 | Ga0099795_101350002 | 180 |
| 3 | 3300006175 | Ga0070712_100504633 | Ga0070712_1005046332 | 181 |
| 4 | 3300035172 | Ga0373955_0339355 | Ga0373955_0339355_341_889 | 182 |
| 5 | 3300035725 | Ga0373947_0326313 | Ga0373947_0326313_433_981 | 182 |
| 6 | 3300037068 | Ga0373925_0251703 | Ga0373925_0251703_853_1401 | 182 |
| 7 | 3300041451 | Ga0451791_0180526 | Ga0451791_0180526_119_667 | 182 |
| 8 | 3300041997 | Ga0439431_0085488 | Ga0439431_0085488_14_589 | 182 |
| 9 | 3300042157 | Ga0439458_0097291 | Ga0439458_0097291_187_735 | 182 |
| 10 | 3300046457 | Ga0495590_0295845 | Ga0495590_0295845_26_574 | 182 |
| 11 | 3300046616 | Ga0495668_0078747 | Ga0495668_0078747_14_562 | 182 |
| 12 | 3300046665 | Ga0495661_0033296 | Ga0495661_0033296_10_558 | 182 |
| 13 | 3300046692 | Ga0495671_0083767 | Ga0495671_0083767_572_1120 | 182 |
| 14 | 3300046810 | Ga0495660_0372904 | Ga0495660_0372904_21_569 | 182 |
| 15 | 3300047319 | Ga0495674_0603112 | Ga0495674_0603112_289_837 | 182 |
| 16 | 3300048907 | Ga0496104_0419721 | Ga0496104_0419721_684_1232 | 182 |
| 17 | 3300048908 | Ga0496105_0033403 | Ga0496105_0033403_1954_2502 | 182 |
| 18 | 3300048923 | Ga0496120_0074129 | Ga0496120_0074129_13_564 | 182 |
| 19 | 3300049572 | Ga0501036_1311913 | Ga0501036_1311913_24_572 | 182 |
| 20 | 3300050513 | nmdc:mga0rr50_1260189_c1 | nmdc:mga0rr50_1260189_c1_23_571 | 182 |
| 21 | 3300050513 | nmdc:mga0rr50_1368332_c1 | nmdc:mga0rr50_1368332_c1_36_584 | 182 |
| 22 | 3300050516 | nmdc:mga0sz30_13312_c1 | nmdc:mga0sz30_13312_c1_44_592 | 182 |
| 23 | 3300006173 | Ga0070716_100478570 | Ga0070716_1004785702 | 184 |
| 24 | 3300006175 | Ga0070712_100301214 | Ga0070712_1003012142 | 188 |
| 25 | 3300025915 | Ga0207693_10049743 | Ga0207693_100497432 | 188 |
| 26 | 3300028577 | Ga0265318_10000078 | Ga0265318_1000007821 | 189 |
| 27 | 3300001989 | JGI24739J22299_10004073 | JGI24739J22299_100040734 | 194 |
| 28 | 3300005577 | Ga0068857_100015451 | Ga0068857_1000154514 | 194 |
| 29 | 3300026116 | Ga0207674_10018140 | Ga0207674_100181406 | 194 |
| 30 | 3300005367 | Ga0070667_101008622 | Ga0070667_1010086221 | 195 |
| 31 | iso_pu_bacteria | 2512564014 | 2512644680 | 195 |
| 32 | iso_pu_bacteria | 2513237137 | 2513859768 | 195 |
| 33 | iso_pu_bacteria | 2517572143 | 2517890012 | 195 |
| 34 | iso_pu_bacteria | 2582581279 | 2585146330 | 195 |
| 35 | iso_pu_bacteria | 2582581279 | 2585148451 | 195 |
| 36 | iso_pu_bacteria | 2582581315 | 2585324499 | 195 |
| 37 | iso_pu_bacteria | 2585428106 | 2587916390 | 195 |
| 38 | iso_pu_bacteria | 2585428106 | 2587917622 | 195 |
| 39 | iso_pu_bacteria | 2593339238 | 2595447820 | 195 |
| 40 | iso_pu_bacteria | 2599185359 | 2600228612 | 195 |
| 41 | iso_pu_bacteria | 2643221622 | 2644125901 | 195 |
| 42 | iso_pu_bacteria | 2643221640 | 2644226853 | 195 |
| 43 | iso_pu_bacteria | 2643221642 | 2644233678 | 195 |
| 44 | iso_pu_bacteria | 2808606401 | 2809062223 | 195 |
| 45 | iso_pu_bacteria | 2808606404 | 2809078437 | 195 |
| 46 | iso_pu_bacteria | 2808606405 | 2809082612 | 195 |
| 47 | iso_pu_bacteria | 2818991466 | 2819714577 | 195 |
| 48 | iso_pu_bacteria | 2857504554 | 2857507122 | 195 |
| 49 | iso_pu_bacteria | 2879163058 | 2879165611 | 195 |
| 50 | iso_pu_bacteria | 2880518877 | 2880518970 | 195 |
| 51 | iso_pu_bacteria | 2884411467 | 2884413130 | 195 |
| 52 | iso_pu_bacteria | 2884960567 | 2884961834 | 195 |
| 53 | iso_pu_bacteria | 2884960567 | 2884964914 | 195 |
| 54 | iso_pu_bacteria | 2886627955 | 2886633999 | 195 |
| 55 | iso_pu_bacteria | 2899259804 | 2899262798 | 195 |
| 56 | iso_pu_bacteria | 2919709256 | 2919710511 | 195 |
| 57 | iso_pu_bacteria | 2928526807 | 2928529080 | 195 |
| 58 | iso_pu_bacteria | 2928531327 | 2928536060 | 195 |
| 59 | iso_pu_bacteria | 2928968154 | 2928968597 | 195 |
| 60 | iso_pu_bacteria | 2990265787 | 2990266069 | 195 |
| 61 | iso_pu_bacteria | 2993693658 | 2993696138 | 195 |
| 62 | iso_pu_bacteria | 8054302542 | 8054304142 | 195 |
| 63 | iso_pu_bacteria | 8054563764 | 8054565013 | 195 |
| 64 | 3300013308 | Ga0157375_10058145 | Ga0157375_100581455 | 196 |
| 65 | 3300041505 | Ga0451849_1579085 | Ga0451849_1579085_394_1005 | 196 |
| 66 | 3300048917 | Ga0496114_0087188 | Ga0496114_0087188_1035_1646 | 196 |
| 67 | 3300002075 | JGI24738J21930_10013414 | JGI24738J21930_100134142 | 198 |
| 68 | 3300005457 | Ga0070662_100111467 | Ga0070662_1001114673 | 198 |
| 69 | 3300005539 | Ga0068853_100003308 | Ga0068853_1000033087 | 198 |
| 70 | 3300005563 | Ga0068855_100829450 | Ga0068855_1008294502 | 198 |
| 71 | 3300005578 | Ga0068854_100103914 | Ga0068854_1001039141 | 198 |
| 72 | 3300009551 | Ga0105238_10415273 | Ga0105238_104152732 | 198 |
| 73 | 3300014326 | Ga0157380_10001902 | Ga0157380_100019026 | 198 |
| 74 | 3300021361 | Ga0213872_10200437 | Ga0213872_102004371 | 198 |
| 75 | 3300025904 | Ga0207647_10158858 | Ga0207647_101588582 | 198 |
| 76 | 3300025924 | Ga0207694_10143037 | Ga0207694_101430372 | 198 |
| 77 | 3300025981 | Ga0207640_10033155 | Ga0207640_100331553 | 198 |
| 78 | 3300026041 | Ga0207639_10013049 | Ga0207639_100130492 | 198 |
| 79 | 3300026116 | Ga0207674_10629631 | Ga0207674_106296312 | 198 |
| 80 | 3300031548 | Ga0307408_100060793 | Ga0307408_1000607933 | 198 |
| 81 | 3300031731 | Ga0307405_10076332 | Ga0307405_100763323 | 198 |
| 82 | 3300031901 | Ga0307406_10605444 | Ga0307406_106054442 | 198 |
| 83 | 3300031911 | Ga0307412_10082796 | Ga0307412_100827963 | 198 |
| 84 | 3300031995 | Ga0307409_100330613 | Ga0307409_1003306131 | 198 |
| 85 | 3300039447 | Ga0436361_0656345 | Ga0436361_0656345_586_1185 | 198 |
| 86 | 3300001989 | JGI24739J22299_10000187 | JGI24739J22299_100001871 | 199 |
| 87 | 3300002774 | JGI25150J39212_1000398 | JGI25150J39212_100039814 | 199 |
| 88 | 3300003187 | JGI25151J46595_10050349 | JGI25151J46595_100503491 | 199 |
| 89 | 3300003215 | JGI25153J46596_10000091 | JGI25153J46596_1000009171 | 199 |
| 90 | 3300003215 | JGI25153J46596_10015585 | JGI25153J46596_100155853 | 199 |
| 91 | 3300003322 | rootL2_10181224 | rootL2_101812242 | 199 |
| 92 | 3300003771 | Ga0055526_1011643 | Ga0055526_10116434 | 199 |
| 93 | 3300003773 | Ga0055537_1001470 | Ga0055537_10014708 | 199 |
| 94 | 3300003773 | Ga0055537_1001547 | Ga0055537_10015477 | 199 |
| 95 | 3300003775 | Ga0055524_1001171 | Ga0055524_100117111 | 199 |
| 96 | 3300003781 | Ga0055536_1022900 | Ga0055536_10229002 | 199 |
| 97 | 3300003791 | Ga0055530_10038540 | Ga0055530_100385402 | 199 |
| 98 | 3300003792 | Ga0055540_1003107 | Ga0055540_10031072 | 199 |
| 99 | 3300003794 | Ga0055531_10000116 | Ga0055531_1000011655 | 199 |
| 100 | 3300003794 | Ga0055531_10016434 | Ga0055531_100164343 | 199 |
| 101 | 3300005328 | Ga0070676_10114046 | Ga0070676_101140462 | 199 |
| 102 | 3300005329 | Ga0070683_100012154 | Ga0070683_1000121547 | 199 |
| 103 | 3300005329 | Ga0070683_100645829 | Ga0070683_1006458293 | 199 |
| 104 | 3300005330 | Ga0070690_100011616 | Ga0070690_1000116162 | 199 |
| 105 | 3300005330 | Ga0070690_100068072 | Ga0070690_1000680722 | 199 |
| 106 | 3300005331 | Ga0070670_100015212 | Ga0070670_1000152123 | 199 |
| 107 | 3300005331 | Ga0070670_100367459 | Ga0070670_1003674592 | 199 |
| 108 | 3300005335 | Ga0070666_10032078 | Ga0070666_100320782 | 199 |
| 109 | 3300005336 | Ga0070680_100295190 | Ga0070680_1002951902 | 199 |
| 110 | 3300005340 | Ga0070689_100005535 | Ga0070689_1000055352 | 199 |
| 111 | 3300005343 | Ga0070687_100322212 | Ga0070687_1003222121 | 199 |
| 112 | 3300005353 | Ga0070669_100000048 | Ga0070669_10000004862 | 199 |
| 113 | 3300005353 | Ga0070669_100078138 | Ga0070669_1000781383 | 199 |
| 114 | 3300005353 | Ga0070669_100199859 | Ga0070669_1001998591 | 199 |
| 115 | 3300005355 | Ga0070671_100434795 | Ga0070671_1004347951 | 199 |
| 116 | 3300005356 | Ga0070674_100074560 | Ga0070674_1000745602 | 199 |
| 117 | 3300005365 | Ga0070688_100156024 | Ga0070688_1001560242 | 199 |
| 118 | 3300005367 | Ga0070667_100013798 | Ga0070667_1000137982 | 199 |
| 119 | 3300005367 | Ga0070667_100196335 | Ga0070667_1001963351 | 199 |
| 120 | 3300005367 | Ga0070667_100410982 | Ga0070667_1004109822 | 199 |
| 121 | 3300005406 | Ga0070703_10147694 | Ga0070703_101476941 | 199 |
| 122 | 3300005434 | Ga0070709_10167097 | Ga0070709_101670972 | 199 |
| 123 | 3300005434 | Ga0070709_10723891 | Ga0070709_107238911 | 199 |
| 124 | 3300005435 | Ga0070714_100465814 | Ga0070714_1004658141 | 199 |
| 125 | 3300005436 | Ga0070713_100218775 | Ga0070713_1002187751 | 199 |
| 126 | 3300005436 | Ga0070713_100261759 | Ga0070713_1002617593 | 199 |
| 127 | 3300005436 | Ga0070713_100292313 | Ga0070713_1002923132 | 199 |
| 128 | 3300005438 | Ga0070701_10019277 | Ga0070701_100192772 | 199 |
| 129 | 3300005439 | Ga0070711_100488195 | Ga0070711_1004881952 | 199 |
| 130 | 3300005441 | Ga0070700_100082962 | Ga0070700_1000829623 | 199 |
| 131 | 3300005441 | Ga0070700_100105616 | Ga0070700_1001056162 | 199 |
| 132 | 3300005455 | Ga0070663_100181016 | Ga0070663_1001810161 | 199 |
| 133 | 3300005456 | Ga0070678_100103936 | Ga0070678_1001039362 | 199 |
| 134 | 3300005457 | Ga0070662_100628624 | Ga0070662_1006286241 | 199 |
| 135 | 3300005458 | Ga0070681_10061334 | Ga0070681_100613343 | 199 |
| 136 | 3300005459 | Ga0068867_100210568 | Ga0068867_1002105681 | 199 |
| 137 | 3300005471 | Ga0070698_100244150 | Ga0070698_1002441502 | 199 |
| 138 | 3300005535 | Ga0070684_100038055 | Ga0070684_1000380553 | 199 |
| 139 | 3300005543 | Ga0070672_100013803 | Ga0070672_1000138033 | 199 |
| 140 | 3300005543 | Ga0070672_100018096 | Ga0070672_1000180964 | 199 |
| 141 | 3300005544 | Ga0070686_100011665 | Ga0070686_1000116653 | 199 |
| 142 | 3300005545 | Ga0070695_100025959 | Ga0070695_1000259591 | 199 |
| 143 | 3300005547 | Ga0070693_100350753 | Ga0070693_1003507531 | 199 |
| 144 | 3300005548 | Ga0070665_100001518 | Ga0070665_1000015188 | 199 |
| 145 | 3300005548 | Ga0070665_100033290 | Ga0070665_1000332902 | 199 |
| 146 | 3300005548 | Ga0070665_100442050 | Ga0070665_1004420501 | 199 |
| 147 | 3300005577 | Ga0068857_100100477 | Ga0068857_1001004772 | 199 |
| 148 | 3300005577 | Ga0068857_100476835 | Ga0068857_1004768352 | 199 |
| 149 | 3300005578 | Ga0068854_100114747 | Ga0068854_1001147472 | 199 |
| 150 | 3300005614 | Ga0068856_100166150 | Ga0068856_1001661503 | 199 |
| 151 | 3300005615 | Ga0070702_100023095 | Ga0070702_1000230954 | 199 |
| 152 | 3300005615 | Ga0070702_100319660 | Ga0070702_1003196601 | 199 |
| 153 | 3300005616 | Ga0068852_100040621 | Ga0068852_1000406211 | 199 |
| 154 | 3300005616 | Ga0068852_100161441 | Ga0068852_1001614412 | 199 |
| 155 | 3300005616 | Ga0068852_100616019 | Ga0068852_1006160192 | 199 |
| 156 | 3300005617 | Ga0068859_100080765 | Ga0068859_1000807652 | 199 |
| 157 | 3300005617 | Ga0068859_100080948 | Ga0068859_1000809482 | 199 |
| 158 | 3300005618 | Ga0068864_100030628 | Ga0068864_1000306284 | 199 |
| 159 | 3300005618 | Ga0068864_100176295 | Ga0068864_1001762952 | 199 |
| 160 | 3300005719 | Ga0068861_100013245 | Ga0068861_1000132456 | 199 |
| 161 | 3300005719 | Ga0068861_100023529 | Ga0068861_1000235293 | 199 |
| 162 | 3300005840 | Ga0068870_10263909 | Ga0068870_102639092 | 199 |
| 163 | 3300005841 | Ga0068863_100009439 | Ga0068863_1000094394 | 199 |
| 164 | 3300005842 | Ga0068858_100042308 | Ga0068858_1000423084 | 199 |
| 165 | 3300005842 | Ga0068858_100514419 | Ga0068858_1005144192 | 199 |
| 166 | 3300005843 | Ga0068860_100003140 | Ga0068860_1000031402 | 199 |
| 167 | 3300005844 | Ga0068862_100000128 | Ga0068862_10000012863 | 199 |
| 168 | 3300005844 | Ga0068862_100018129 | Ga0068862_1000181295 | 199 |
| 169 | 3300005983 | Ga0081540_1079531 | Ga0081540_10795313 | 199 |
| 170 | 3300005983 | Ga0081540_1110481 | Ga0081540_11104811 | 199 |
| 171 | 3300006163 | Ga0070715_10006908 | Ga0070715_100069083 | 199 |
| 172 | 3300006173 | Ga0070716_100093407 | Ga0070716_1000934073 | 199 |
| 173 | 3300006175 | Ga0070712_100434911 | Ga0070712_1004349112 | 199 |
| 174 | 3300006175 | Ga0070712_100499769 | Ga0070712_1004997692 | 199 |
| 175 | 3300006175 | Ga0070712_100539682 | Ga0070712_1005396821 | 199 |
| 176 | 3300006178 | Ga0075367_10140624 | Ga0075367_101406242 | 199 |
| 177 | 3300006237 | Ga0097621_100005591 | Ga0097621_1000055916 | 199 |
| 178 | 3300006237 | Ga0097621_100035992 | Ga0097621_1000359922 | 199 |
| 179 | 3300006237 | Ga0097621_100164191 | Ga0097621_1001641911 | 199 |
| 180 | 3300006358 | Ga0068871_100009486 | Ga0068871_1000094863 | 199 |
| 181 | 3300006844 | Ga0075428_100192132 | Ga0075428_1001921322 | 199 |
| 182 | 3300006847 | Ga0075431_100033581 | Ga0075431_1000335813 | 199 |
| 183 | 3300006871 | Ga0075434_100616883 | Ga0075434_1006168832 | 199 |
| 184 | 3300006880 | Ga0075429_100033627 | Ga0075429_1000336273 | 199 |
| 185 | 3300006881 | Ga0068865_100556386 | Ga0068865_1005563862 | 199 |
| 186 | 3300006931 | Ga0097620_100080771 | Ga0097620_1000807713 | 199 |
| 187 | 3300006931 | Ga0097620_100080948 | Ga0097620_1000809483 | 199 |
| 188 | 3300006946 | Ga0079104_1025245 | Ga0079104_10252451 | 199 |
| 189 | 3300007788 | Ga0099795_10144347 | Ga0099795_101443471 | 199 |
| 190 | 3300009093 | Ga0105240_10271431 | Ga0105240_102714311 | 199 |
| 191 | 3300009093 | Ga0105240_10424330 | Ga0105240_104243301 | 199 |
| 192 | 3300009093 | Ga0105240_10823402 | Ga0105240_108234022 | 199 |
| 193 | 3300009094 | Ga0111539_10004917 | Ga0111539_1000491710 | 199 |
| 194 | 3300009098 | Ga0105245_10059426 | Ga0105245_100594263 | 199 |
| 195 | 3300009101 | Ga0105247_10301597 | Ga0105247_103015972 | 199 |
| 196 | 3300009174 | Ga0105241_10040059 | Ga0105241_100400595 | 199 |
| 197 | 3300009177 | Ga0105248_10006025 | Ga0105248_100060257 | 199 |
| 198 | 3300009545 | Ga0105237_10055213 | Ga0105237_100552134 | 199 |
| 199 | 3300009545 | Ga0105237_10356146 | Ga0105237_103561462 | 199 |
| 200 | 3300009551 | Ga0105238_10003746 | Ga0105238_100037464 | 199 |
| 201 | 3300009553 | Ga0105249_10017944 | Ga0105249_100179444 | 199 |
| 202 | 3300010159 | Ga0099796_10018016 | Ga0099796_100180163 | 199 |
| 203 | 3300010375 | Ga0105239_10210111 | Ga0105239_102101112 | 199 |
| 204 | 3300010375 | Ga0105239_10479976 | Ga0105239_104799762 | 199 |
| 205 | 3300013105 | Ga0157369_10000203 | Ga0157369_1000020349 | 199 |
| 206 | 3300013105 | Ga0157369_10047048 | Ga0157369_100470483 | 199 |
| 207 | 3300013296 | Ga0157374_10014743 | Ga0157374_100147437 | 199 |
| 208 | 3300013306 | Ga0163162_11091412 | Ga0163162_110914122 | 199 |
| 209 | 3300013307 | Ga0157372_11089811 | Ga0157372_110898112 | 199 |
| 210 | 3300013308 | Ga0157375_10008148 | Ga0157375_100081483 | 199 |
| 211 | 3300014325 | Ga0163163_10010812 | Ga0163163_100108122 | 199 |
| 212 | 3300014326 | Ga0157380_10001615 | Ga0157380_100016157 | 199 |
| 213 | 3300014326 | Ga0157380_10019159 | Ga0157380_100191593 | 199 |
| 214 | 3300014968 | Ga0157379_10040277 | Ga0157379_100402772 | 199 |
| 215 | 3300014968 | Ga0157379_10493701 | Ga0157379_104937011 | 199 |
| 216 | 3300014969 | Ga0157376_10012042 | Ga0157376_100120422 | 199 |
| 217 | 3300014969 | Ga0157376_10438534 | Ga0157376_104385342 | 199 |
| 218 | 3300014969 | Ga0157376_10514801 | Ga0157376_105148011 | 199 |
| 219 | 3300015690 | Ga0183363_1006 | Ga0183363_1006216 | 199 |
| 220 | 3300025245 | Ga0207425_1000049 | Ga0207425_1000049142 | 199 |
| 221 | 3300025258 | Ga0209129_1001668 | Ga0209129_10016687 | 199 |
| 222 | 3300025263 | Ga0209565_1000007 | Ga0209565_100000741 | 199 |
| 223 | 3300025263 | Ga0209565_1000170 | Ga0209565_10001709 | 199 |
| 224 | 3300025273 | Ga0209673_1007604 | Ga0209673_10076047 | 199 |
| 225 | 3300025273 | Ga0209673_1011741 | Ga0209673_10117413 | 199 |
| 226 | 3300025273 | Ga0209673_1026853 | Ga0209673_10268533 | 199 |
| 227 | 3300025291 | Ga0209675_1004240 | Ga0209675_10042404 | 199 |
| 228 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068114 | 199 |
| 229 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003697 | 199 |
| 230 | 3300025295 | Ga0209564_1000335 | Ga0209564_100033553 | 199 |
| 231 | 3300025297 | Ga0209758_1000004 | Ga0209758_100000413 | 199 |
| 232 | 3300025297 | Ga0209758_1011544 | Ga0209758_10115443 | 199 |
| 233 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011942 | 199 |
| 234 | 3300025298 | Ga0209050_1000196 | Ga0209050_1000196103 | 199 |
| 235 | 3300025298 | Ga0209050_1006899 | Ga0209050_10068994 | 199 |
| 236 | 3300025298 | Ga0209050_1009345 | Ga0209050_10093452 | 199 |
| 237 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009117 | 199 |
| 238 | 3300025299 | Ga0209256_1000010 | Ga0209256_100001041 | 199 |
| 239 | 3300025303 | Ga0209051_1000191 | Ga0209051_1000191127 | 199 |
| 240 | 3300025304 | Ga0209257_1000228 | Ga0209257_1000228103 | 199 |
| 241 | 3300025304 | Ga0209257_1003180 | Ga0209257_100318010 | 199 |
| 242 | 3300025304 | Ga0209257_1003572 | Ga0209257_100357214 | 199 |
| 243 | 3300025304 | Ga0209257_1003678 | Ga0209257_10036788 | 199 |
| 244 | 3300025304 | Ga0209257_1017255 | Ga0209257_10172554 | 199 |
| 245 | 3300025315 | Ga0207697_10000121 | Ga0207697_100001216 | 199 |
| 246 | 3300025893 | Ga0207682_10040628 | Ga0207682_100406282 | 199 |
| 247 | 3300025901 | Ga0207688_10265855 | Ga0207688_102658552 | 199 |
| 248 | 3300025905 | Ga0207685_10046675 | Ga0207685_100466752 | 199 |
| 249 | 3300025907 | Ga0207645_10138227 | Ga0207645_101382272 | 199 |
| 250 | 3300025911 | Ga0207654_10421846 | Ga0207654_104218462 | 199 |
| 251 | 3300025913 | Ga0207695_10143982 | Ga0207695_101439821 | 199 |
| 252 | 3300025914 | Ga0207671_10012108 | Ga0207671_100121087 | 199 |
| 253 | 3300025914 | Ga0207671_10417264 | Ga0207671_104172641 | 199 |
| 254 | 3300025915 | Ga0207693_10140223 | Ga0207693_101402233 | 199 |
| 255 | 3300025918 | Ga0207662_10163293 | Ga0207662_101632932 | 199 |
| 256 | 3300025923 | Ga0207681_10000050 | Ga0207681_1000005062 | 199 |
| 257 | 3300025923 | Ga0207681_10157855 | Ga0207681_101578552 | 199 |
| 258 | 3300025923 | Ga0207681_10163083 | Ga0207681_101630832 | 199 |
| 259 | 3300025924 | Ga0207694_10000156 | Ga0207694_1000015632 | 199 |
| 260 | 3300025925 | Ga0207650_10025436 | Ga0207650_100254364 | 199 |
| 261 | 3300025926 | Ga0207659_10687758 | Ga0207659_106877581 | 199 |
| 262 | 3300025928 | Ga0207700_10064965 | Ga0207700_100649652 | 199 |
| 263 | 3300025933 | Ga0207706_10673618 | Ga0207706_106736182 | 199 |
| 264 | 3300025934 | Ga0207686_10399439 | Ga0207686_103994392 | 199 |
| 265 | 3300025936 | Ga0207670_10039997 | Ga0207670_100399973 | 199 |
| 266 | 3300025937 | Ga0207669_10230327 | Ga0207669_102303272 | 199 |
| 267 | 3300025938 | Ga0207704_10289622 | Ga0207704_102896222 | 199 |
| 268 | 3300025938 | Ga0207704_10539106 | Ga0207704_105391061 | 199 |
| 269 | 3300025939 | Ga0207665_10037340 | Ga0207665_100373401 | 199 |
| 270 | 3300025940 | Ga0207691_10011743 | Ga0207691_100117437 | 199 |
| 271 | 3300025940 | Ga0207691_10870986 | Ga0207691_108709861 | 199 |
| 272 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001703 | 199 |
| 273 | 3300025942 | Ga0207689_10159272 | Ga0207689_101592722 | 199 |
| 274 | 3300025945 | Ga0207679_10077157 | Ga0207679_100771573 | 199 |
| 275 | 3300025945 | Ga0207679_10238576 | Ga0207679_102385762 | 199 |
| 276 | 3300025945 | Ga0207679_10855550 | Ga0207679_108555501 | 199 |
| 277 | 3300025949 | Ga0207667_10000068 | Ga0207667_1000006838 | 199 |
| 278 | 3300025949 | Ga0207667_10858155 | Ga0207667_108581552 | 199 |
| 279 | 3300025961 | Ga0207712_10009031 | Ga0207712_100090314 | 199 |
| 280 | 3300025972 | Ga0207668_10455061 | Ga0207668_104550612 | 199 |
| 281 | 3300025981 | Ga0207640_10045007 | Ga0207640_100450072 | 199 |
| 282 | 3300025986 | Ga0207658_10015230 | Ga0207658_100152304 | 199 |
| 283 | 3300025986 | Ga0207658_10274338 | Ga0207658_102743382 | 199 |
| 284 | 3300025986 | Ga0207658_10345265 | Ga0207658_103452651 | 199 |
| 285 | 3300026035 | Ga0207703_10025739 | Ga0207703_100257393 | 199 |
| 286 | 3300026035 | Ga0207703_10552901 | Ga0207703_105529012 | 199 |
| 287 | 3300026041 | Ga0207639_10038916 | Ga0207639_100389161 | 199 |
| 288 | 3300026067 | Ga0207678_10245170 | Ga0207678_102451702 | 199 |
| 289 | 3300026075 | Ga0207708_10046743 | Ga0207708_100467433 | 199 |
| 290 | 3300026075 | Ga0207708_10049054 | Ga0207708_100490543 | 199 |
| 291 | 3300026078 | Ga0207702_10261774 | Ga0207702_102617743 | 199 |
| 292 | 3300026088 | Ga0207641_10842462 | Ga0207641_108424621 | 199 |
| 293 | 3300026089 | Ga0207648_10234868 | Ga0207648_102348682 | 199 |
| 294 | 3300026095 | Ga0207676_10119246 | Ga0207676_101192462 | 199 |
| 295 | 3300026095 | Ga0207676_10246969 | Ga0207676_102469692 | 199 |
| 296 | 3300026116 | Ga0207674_10203543 | Ga0207674_102035433 | 199 |
| 297 | 3300026118 | Ga0207675_100019225 | Ga0207675_1000192256 | 199 |
| 298 | 3300026118 | Ga0207675_100026894 | Ga0207675_1000268942 | 199 |
| 299 | 3300026118 | Ga0207675_100084745 | Ga0207675_1000847452 | 199 |
| 300 | 3300026118 | Ga0207675_100178561 | Ga0207675_1001785613 | 199 |
| 301 | 3300026121 | Ga0207683_10104012 | Ga0207683_101040122 | 199 |
| 302 | 3300026142 | Ga0207698_10073640 | Ga0207698_100736404 | 199 |
| 303 | 3300026142 | Ga0207698_10720180 | Ga0207698_107201802 | 199 |
| 304 | 3300027671 | Ga0209588_1119422 | Ga0209588_11194221 | 199 |
| 305 | 3300028017 | Ga0265356_1001571 | Ga0265356_10015713 | 199 |
| 306 | 3300028379 | Ga0268266_10001573 | Ga0268266_100015736 | 199 |
| 307 | 3300028379 | Ga0268266_10087063 | Ga0268266_100870632 | 199 |
| 308 | 3300028380 | Ga0268265_10000102 | Ga0268265_1000010251 | 199 |
| 309 | 3300028381 | Ga0268264_10025820 | Ga0268264_100258204 | 199 |
| 310 | 3300028573 | Ga0265334_10014803 | Ga0265334_100148033 | 199 |
| 311 | 3300028577 | Ga0265318_10004942 | Ga0265318_100049423 | 199 |
| 312 | 3300028786 | Ga0307517_10176347 | Ga0307517_101763472 | 199 |
| 313 | 3300028800 | Ga0265338_10000043 | Ga0265338_1000004348 | 199 |
| 314 | 3300031235 | Ga0265330_10016096 | Ga0265330_100160962 | 199 |
| 315 | 3300031238 | Ga0265332_10012204 | Ga0265332_100122045 | 199 |
| 316 | 3300031241 | Ga0265325_10000002 | Ga0265325_10000002339 | 199 |
| 317 | 3300031247 | Ga0265340_10039226 | Ga0265340_100392265 | 199 |
| 318 | 3300031249 | Ga0265339_10000216 | Ga0265339_1000021637 | 199 |
| 319 | 3300031250 | Ga0265331_10011034 | Ga0265331_100110346 | 199 |
| 320 | 3300031251 | Ga0265327_10003282 | Ga0265327_100032826 | 199 |
| 321 | 3300031456 | Ga0307513_10173344 | Ga0307513_101733442 | 199 |
| 322 | 3300031456 | Ga0307513_10599181 | Ga0307513_105991811 | 199 |
| 323 | 3300031548 | Ga0307408_100052870 | Ga0307408_1000528702 | 199 |
| 324 | 3300031548 | Ga0307408_100143556 | Ga0307408_1001435563 | 199 |
| 325 | 3300031595 | Ga0265313_10001374 | Ga0265313_1000137417 | 199 |
| 326 | 3300031616 | Ga0307508_10117653 | Ga0307508_101176532 | 199 |
| 327 | 3300031711 | Ga0265314_10021331 | Ga0265314_100213314 | 199 |
| 328 | 3300031711 | Ga0265314_10344900 | Ga0265314_103449001 | 199 |
| 329 | 3300031712 | Ga0265342_10048271 | Ga0265342_100482714 | 199 |
| 330 | 3300031712 | Ga0265342_10086061 | Ga0265342_100860613 | 199 |
| 331 | 3300031730 | Ga0307516_10032551 | Ga0307516_100325512 | 199 |
| 332 | 3300031824 | Ga0307413_10007820 | Ga0307413_100078202 | 199 |
| 333 | 3300031901 | Ga0307406_10009523 | Ga0307406_100095233 | 199 |
| 334 | 3300031901 | Ga0307406_10028440 | Ga0307406_100284403 | 199 |
| 335 | 3300031903 | Ga0307407_10007455 | Ga0307407_100074556 | 199 |
| 336 | 3300031903 | Ga0307407_10099316 | Ga0307407_100993163 | 199 |
| 337 | 3300031911 | Ga0307412_10129044 | Ga0307412_101290442 | 199 |
| 338 | 3300031995 | Ga0307409_100039036 | Ga0307409_1000390364 | 199 |
| 339 | 3300031995 | Ga0307409_100118023 | Ga0307409_1001180232 | 199 |
| 340 | 3300032002 | Ga0307416_100019723 | Ga0307416_1000197235 | 199 |
| 341 | 3300032004 | Ga0307414_10930625 | Ga0307414_109306252 | 199 |
| 342 | 3300032005 | Ga0307411_10048029 | Ga0307411_100480292 | 199 |
| 343 | 3300032126 | Ga0307415_100439979 | Ga0307415_1004399792 | 199 |
| 344 | 3300035118 | Ga0373954_0344424 | Ga0373954_0344424_35_652 | 199 |
| 345 | 3300035695 | Ga0373927_0035173 | Ga0373927_0035173_302_901 | 199 |
| 346 | 3300037471 | Ga0395905_0026307 | Ga0395905_0026307_4819_5418 | 199 |
| 347 | 3300037471 | Ga0395905_0867592 | Ga0395905_0867592_95_697 | 199 |
| 348 | 3300037853 | Ga0436364_0887588 | Ga0436364_0887588_145_753 | 199 |
| 349 | 3300038443 | Ga0395901_0220414 | Ga0395901_0220414_312_911 | 199 |
| 350 | 3300039438 | Ga0436360_0889201 | Ga0436360_0889201_248_850 | 199 |
| 351 | 3300039450 | Ga0436363_1040323 | Ga0436363_1040323_176_775 | 199 |
| 352 | 3300041404 | Ga0439436_0055204 | Ga0439436_0055204_128_754 | 199 |
| 353 | 3300041406 | Ga0439439_0000197 | Ga0439439_0000197_7045_7671 | 199 |
| 354 | 3300041410 | Ga0439461_0014747 | Ga0439461_0014747_19_645 | 199 |
| 355 | 3300041413 | Ga0439465_0006757 | Ga0439465_0006757_2193_2819 | 199 |
| 356 | 3300042006 | Ga0439432_043912 | Ga0439432_043912_694_1320 | 199 |
| 357 | 3300042126 | Ga0450888_040420 | Ga0450888_040420_14_634 | 199 |
| 358 | 3300042876 | Ga0451577_0888450 | Ga0451577_0888450_26_625 | 199 |
| 359 | 3300046460 | Ga0495638_0001099 | Ga0495638_0001099_14573_15172 | 199 |
| 360 | 3300046460 | Ga0495638_0076725 | Ga0495638_0076725_1057_1680 | 199 |
| 361 | 3300046507 | Ga0495606_0279658 | Ga0495606_0279658_74_673 | 199 |
| 362 | 3300046511 | Ga0495608_0393956 | Ga0495608_0393956_206_805 | 199 |
| 363 | 3300046513 | Ga0495616_0000360 | Ga0495616_0000360_22549_23172 | 199 |
| 364 | 3300046516 | Ga0495628_0372853 | Ga0495628_0372853_48_647 | 199 |
| 365 | 3300046516 | Ga0495628_0384822 | Ga0495628_0384822_324_923 | 199 |
| 366 | 3300046660 | Ga0495625_0000054 | Ga0495625_0000054_64236_64838 | 199 |
| 367 | 3300046660 | Ga0495625_0120696 | Ga0495625_0120696_74_676 | 199 |
| 368 | 3300046691 | Ga0495670_0000015 | Ga0495670_0000015_64125_64727 | 199 |
| 369 | 3300046691 | Ga0495670_0401545 | Ga0495670_0401545_88_702 | 199 |
| 370 | 3300047319 | Ga0495674_0146134 | Ga0495674_0146134_1222_1821 | 199 |
| 371 | 3300047469 | Ga0495673_0000600 | Ga0495673_0000600_22054_22653 | 199 |
| 372 | 3300047470 | Ga0495681_0025398 | Ga0495681_0025398_783_1409 | 199 |
| 373 | 3300047472 | Ga0495686_0137553 | Ga0495686_0137553_638_1237 | 199 |
| 374 | 3300048904 | Ga0496101_0833909 | Ga0496101_0833909_79_699 | 199 |
| 375 | 3300048905 | Ga0496102_0492594 | Ga0496102_0492594_78_677 | 199 |
| 376 | 3300048905 | Ga0496102_0646273 | Ga0496102_0646273_259_885 | 199 |
| 377 | 3300048906 | Ga0496103_0000037 | Ga0496103_0000037_121014_121616 | 199 |
| 378 | 3300048907 | Ga0496104_0008260 | Ga0496104_0008260_1990_2610 | 199 |
| 379 | 3300048907 | Ga0496104_0024084 | Ga0496104_0024084_4624_5223 | 199 |
| 380 | 3300048907 | Ga0496104_0097029 | Ga0496104_0097029_1285_1908 | 199 |
| 381 | 3300048908 | Ga0496105_0002020 | Ga0496105_0002020_12573_13193 | 199 |
| 382 | 3300048911 | Ga0496108_0003757 | Ga0496108_0003757_4687_5307 | 199 |
| 383 | 3300048912 | Ga0496109_0001984 | Ga0496109_0001984_7009_7629 | 199 |
| 384 | 3300048912 | Ga0496109_0293576 | Ga0496109_0293576_288_887 | 199 |
| 385 | 3300048913 | Ga0496110_0097886 | Ga0496110_0097886_476_1096 | 199 |
| 386 | 3300048914 | Ga0496111_0379381 | Ga0496111_0379381_178_798 | 199 |
| 387 | 3300048917 | Ga0496114_0459556 | Ga0496114_0459556_40_651 | 199 |
| 388 | 3300048918 | Ga0496115_0001359 | Ga0496115_0001359_11069_11710 | 199 |
| 389 | 3300048919 | Ga0496116_0002416 | Ga0496116_0002416_13274_13876 | 199 |
| 390 | 3300048920 | Ga0496117_0000115 | Ga0496117_0000115_57859_58461 | 199 |
| 391 | 3300048921 | Ga0496118_0000086 | Ga0496118_0000086_121028_121630 | 199 |
| 392 | 3300048922 | Ga0496119_0009737 | Ga0496119_0009737_7537_8139 | 199 |
| 393 | 3300048924 | Ga0496121_0000105 | Ga0496121_0000105_81428_82030 | 199 |
| 394 | 3300048927 | Ga0496124_0000102 | Ga0496124_0000102_121028_121630 | 199 |
| 395 | 3300048927 | Ga0496124_0000129 | Ga0496124_0000129_145939_146541 | 199 |
| 396 | 3300048927 | Ga0496124_0018814 | Ga0496124_0018814_5687_6289 | 199 |
| 397 | 3300048927 | Ga0496124_0040847 | Ga0496124_0040847_940_1539 | 199 |
| 398 | 3300048927 | Ga0496124_0356267 | Ga0496124_0356267_103_702 | 199 |
| 399 | 3300048928 | Ga0496125_0124827 | Ga0496125_0124827_69_671 | 199 |
| 400 | 3300048928 | Ga0496125_0146798 | Ga0496125_0146798_961_1560 | 199 |
| 401 | 3300048929 | Ga0496126_0001609 | Ga0496126_0001609_28943_29542 | 199 |
| 402 | 3300048929 | Ga0496126_0004119 | Ga0496126_0004119_10334_10933 | 199 |
| 403 | 3300048929 | Ga0496126_0005832 | Ga0496126_0005832_12175_12786 | 199 |
| 404 | 3300048929 | Ga0496126_0402304 | Ga0496126_0402304_159_758 | 199 |
| 405 | 3300049460 | Ga0495682_0002446 | Ga0495682_0002446_6262_6861 | 199 |
| 406 | 3300049578 | Ga0501042_0159021 | Ga0501042_0159021_987_1607 | 199 |
| 407 | 3300049581 | Ga0501047_0065937 | Ga0501047_0065937_2407_3006 | 199 |
| 408 | 3300049584 | Ga0501068_0000771 | Ga0501068_0000771_7082_7702 | 199 |
| 409 | 3300049585 | Ga0501069_0095231 | Ga0501069_0095231_676_1275 | 199 |
| 410 | 3300049586 | Ga0501070_0064531 | Ga0501070_0064531_1852_2472 | 199 |
| 411 | 3300049587 | Ga0501071_0011277 | Ga0501071_0011277_4048_4668 | 199 |
| 412 | 3300049589 | Ga0501073_0002694 | Ga0501073_0002694_4606_5226 | 199 |
| 413 | 3300049592 | Ga0501076_0016598 | Ga0501076_0016598_3418_4038 | 199 |
| 414 | 3300049593 | Ga0501077_0012798 | Ga0501077_0012798_3266_3886 | 199 |
| 415 | 3300049705 | Ga0501225_0002106 | Ga0501225_0002106_2566_3165 | 199 |
| 416 | 3300049741 | Ga0501079_0000016 | Ga0501079_0000016_53157_53777 | 199 |
| 417 | 3300049742 | Ga0501080_0000319 | Ga0501080_0000319_3992_4612 | 199 |
| 418 | 3300049744 | Ga0501083_0015178 | Ga0501083_0015178_318_938 | 199 |
| 419 | 3300049758 | Ga0501241_022387 | Ga0501241_022387_508_1110 | 199 |
| 420 | 3300050494 | nmdc:mga06z11_62275_c1 | nmdc:mga06z11_62275_c1_242_841 | 199 |
| 421 | 3300050510 | nmdc:mga06r32_26358_c1 | nmdc:mga06r32_26358_c1_2842_3516 | 199 |
| 422 | 3300053087 | Ga0500643_056086 | Ga0500643_056086_277_876 | 199 |
| 423 | 3300053088 | Ga0500644_0000228 | Ga0500644_0000228_16318_16917 | 199 |
| 424 | 3300053094 | Ga0500566_0089168 | Ga0500566_0089168_219_851 | 199 |
| 425 | 3300053104 | Ga0500556_0006177 | Ga0500556_0006177_2370_2969 | 199 |
| 426 | 3300053108 | Ga0500562_028128 | Ga0500562_028128_840_1442 | 199 |
| 427 | 3300053121 | Ga0500607_000052 | Ga0500607_000052_15049_15699 | 199 |
| 428 | 3300053123 | Ga0500614_177200 | Ga0500614_177200_31_633 | 199 |
| 429 | 3300053133 | Ga0500655_002963 | Ga0500655_002963_1846_2445 | 199 |
| 430 | 3300053134 | Ga0500658_0009388 | Ga0500658_0009388_379_1005 | 199 |
| 431 | 3300053134 | Ga0500658_0161825 | Ga0500658_0161825_341_967 | 199 |
| 432 | 3300053136 | Ga0500559_0003408 | Ga0500559_0003408_819_1418 | 199 |
| 433 | 3300053138 | Ga0500564_000157 | Ga0500564_000157_15389_15988 | 199 |
| 434 | 3300053138 | Ga0500564_021329 | Ga0500564_021329_1294_1953 | 199 |
| 435 | 3300053151 | Ga0500604_0019199 | Ga0500604_0019199_1221_1847 | 199 |
| 436 | 3300053154 | Ga0500619_010208 | Ga0500619_010208_426_1025 | 199 |
| 437 | 3300053156 | Ga0500622_0008175 | Ga0500622_0008175_278_877 | 199 |
| 438 | 3300053156 | Ga0500622_0015639 | Ga0500622_0015639_1980_2579 | 199 |
| 439 | 3300053178 | Ga0500637_0178320 | Ga0500637_0178320_380_991 | 199 |
| 440 | 3300054114 | Ga0501084_0003301 | Ga0501084_0003301_1291_1911 | 199 |
| 441 | 3300060353 | Ga0501082_0110085 | Ga0501082_0110085_1702_2322 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7q6n-assembly1.cif.gz_A | structure of wrba from salmonella typhimurium bound to me0052 | 0.9758 | 1 | 197 |
| 3b6i-assembly1.cif.gz_A | wrba from escherichia coli, native structure | 0.9731 | 2 | 199 |
| 4la4-assembly1.cif.gz_B-2 | crystal structure of native pnpb | 0.9726 | 1 | 198 |
| 5f51-assembly1.cif.gz_A | structure of b. abortus wrba-related protein a (apo) | 0.9708 | 1 | 197 |
| 7q6m-assembly1.cif.gz_D | structure of wrba from yersinia pseudotuberculosis in p1 | 0.9702 | 1 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0H261_1_202_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9654 | 1 | 199 | 3.40.50.360 |
| 3zhoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9635 | 2 | 199 | 3.40.50.360 |
| af_A0A0R0H261_1_202_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9607 | 1 | 199 | 3.40.50.360 |
| 3zhoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9582 | 2 | 199 | 3.40.50.360 |
| 5mp4F00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9563 | 3 | 196 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1CAN3-F1-model_v4 | TrpR binding protein WrbA | 0.9905 | 1 | 111 |
GO:0003955
GO:0010181 GO:0016020 |
| AF-A0A162AC88-F1-model_v4 | Flavodoxin-like domain-containing protein | 0.9904 | 1 | 114 |
GO:0003955
GO:0010181 GO:0016020 |
| AF-A0A059WTJ3-F1-model_v4 | Putative ACR, COG1399 | 0.9899 | 1 | 132 |
GO:0003955
GO:0010181 GO:0016020 |
| AF-A0A370NSV5-F1-model_v4 | NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) | 0.9876 | 2 | 198 |
GO:0008753
GO:0009055 GO:0010181 GO:0016020 GO:0050136 GO:0050660 GO:0050661 GO:0051287 |
| AF-H5Y7Q2-F1-model_v4 | NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) | 0.9875 | 1 | 197 |
GO:0008753
GO:0010181 GO:0016020 GO:0050136 GO:0050660 GO:0050661 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar