F444586

General Info

Members Datasets Scaffolds Average Seq Length
441 310 408 202

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100012154|Ga0070683_1000121547
Length 225
Sequence VQDAVFKKTKLCVNLSLSEIIMASVPKVLVLYYSAYGHIETMAYAEADGARAAGAHVDIKRVPELVPEDVARNAHFKLDQAAPIARIDDLADYDAVIVGAGTRFGRLPSQLASFLDQAGGLWQRGAMHGKVGGAFSCSATQHGGQETTLFSIITNLLHFGMVIVGMDYGHAGQMTLAEITGGSPYGATTIAGSDGSRKPTENELQGARYQGRKIAETAKRLVQGQ

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
8 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
9 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
13 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
14 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
15 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
16 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
17 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
18 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
19 2884411467 Dyella sp. AD56 Isolate Rhizosphere
20 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
21 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
22 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
23 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
24 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
25 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
26 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
27 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
28 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
233 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
298 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
310 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.52
Metatranscriptomes 0
Isolates 7.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 13.38
Nodule 0.68
Rhizoplane 4.54
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000187 3300001989 Bacteria 20509
2 JGI24739J22299_10004073 3300001989 Bacteria 5588
3 JGI24738J21930_10013414 3300002075 Bacteria 1773
4 JGI25150J39212_1000398 3300002774 Bacteria 20361
5 JGI25151J46595_10050349 3300003187 Bacteria 1420
6 JGI25153J46596_10000091 3300003215 Bacteria 105614
7 JGI25153J46596_10015585 3300003215 Bacteria 3087
8 rootL2_10181224 3300003322 Bacteria 3591
9 Ga0055526_1011643 3300003771 Bacteria 3937
10 Ga0055537_1001470 3300003773 Bacteria 9160
11 Ga0055537_1001547 3300003773 Bacteria 8796
12 Ga0055524_1001171 3300003775 Bacteria 15663
13 Ga0055536_1022900 3300003781 Bacteria 1849
14 Ga0055530_10038540 3300003791 Bacteria 1187
15 Ga0055540_1003107 3300003792 Bacteria 8242
16 Ga0055531_10000116 3300003794 Bacteria 88368
17 Ga0055531_10016434 3300003794 Bacteria 3191
18 Ga0070676_10114046 3300005328 Bacteria 1687
19 Ga0070683_100012154 3300005329 Bacteria 7472
20 Ga0070683_100645829 3300005329 Bacteria 1013
21 Ga0070690_100011616 3300005330 Bacteria 5155
22 Ga0070690_100068072 3300005330 Bacteria 2309
23 Ga0070670_100015212 3300005331 Bacteria 6604
24 Ga0070670_100367459 3300005331 Bacteria 1266
25 Ga0070666_10032078 3300005335 Bacteria 3469
26 Ga0070680_100295190 3300005336 Bacteria 1374
27 Ga0070689_100005535 3300005340 Bacteria 8640
28 Ga0070687_100322212 3300005343 Bacteria 988
29 Ga0070669_100000048 3300005353 Bacteria 118472
30 Ga0070669_100078138 3300005353 Bacteria 2459
31 Ga0070669_100199859 3300005353 Bacteria 1572
32 Ga0070671_100434795 3300005355 Bacteria 1125
33 Ga0070674_100074560 3300005356 Bacteria 2408
34 Ga0070688_100156024 3300005365 Bacteria 1564
35 Ga0070667_100013798 3300005367 Bacteria 6678
36 Ga0070667_100196335 3300005367 Bacteria 1789
37 Ga0070667_100410982 3300005367 Bacteria 1233
38 Ga0070667_101008622 3300005367 Bacteria 777
39 Ga0070703_10147694 3300005406 Bacteria 880
40 Ga0070709_10167097 3300005434 Bacteria 1534
41 Ga0070709_10723891 3300005434 Bacteria 776
42 Ga0070714_100465814 3300005435 Bacteria 1202
43 Ga0070713_100218775 3300005436 Bacteria 1727
44 Ga0070713_100261759 3300005436 Bacteria 1581
45 Ga0070713_100292313 3300005436 Bacteria 1498
46 Ga0070701_10019277 3300005438 Bacteria 3220
47 Ga0070711_100488195 3300005439 Bacteria 1014
48 Ga0070700_100082962 3300005441 Bacteria 2074
49 Ga0070700_100105616 3300005441 Bacteria 1863
50 Ga0070663_100181016 3300005455 Bacteria 1635
51 Ga0070678_100103936 3300005456 Bacteria 2208
52 Ga0070662_100111467 3300005457 Bacteria 2085
53 Ga0070662_100628624 3300005457 Bacteria 905
54 Ga0070681_10061334 3300005458 Bacteria 3735
55 Ga0068867_100210568 3300005459 Bacteria 1561
56 Ga0070698_100244150 3300005471 Bacteria 1729
57 Ga0070684_100038055 3300005535 Bacteria 4130
58 Ga0068853_100003308 3300005539 Bacteria 12328
59 Ga0070672_100013803 3300005543 Bacteria 5713
60 Ga0070672_100018096 3300005543 Bacteria 5086
61 Ga0070686_100011665 3300005544 Bacteria 4992
62 Ga0070695_100025959 3300005545 Bacteria 3622
63 Ga0070693_100350753 3300005547 Bacteria 1010
64 Ga0070665_100001518 3300005548 Bacteria 26902
65 Ga0070665_100033290 3300005548 Bacteria 5187
66 Ga0070665_100442050 3300005548 Bacteria 1310
67 Ga0068855_100829450 3300005563 Bacteria 981
68 Ga0068857_100015451 3300005577 Bacteria 6668
69 Ga0068857_100100477 3300005577 Bacteria 2595
70 Ga0068857_100476835 3300005577 Bacteria 1169
71 Ga0068854_100103914 3300005578 Bacteria 2133
72 Ga0068854_100114747 3300005578 Bacteria 2037
73 Ga0068856_100166150 3300005614 Bacteria 2218
74 Ga0070702_100023095 3300005615 Bacteria 3300
75 Ga0070702_100319660 3300005615 Bacteria 1081
76 Ga0068852_100040621 3300005616 Bacteria 3926
77 Ga0068852_100161441 3300005616 Bacteria 2093
78 Ga0068852_100616019 3300005616 Bacteria 1091
79 Ga0068859_100080765 3300005617 Bacteria 3293
80 Ga0068859_100080948 3300005617 Bacteria 3289
81 Ga0068864_100030628 3300005618 Bacteria 4561
82 Ga0068864_100176295 3300005618 Bacteria 1952
83 Ga0068861_100013245 3300005719 Bacteria 5769
84 Ga0068861_100023529 3300005719 Bacteria 4444
85 Ga0068870_10263909 3300005840 Bacteria 1073
86 Ga0068863_100009439 3300005841 Bacteria 9522
87 Ga0068858_100042308 3300005842 Bacteria 4224
88 Ga0068858_100514419 3300005842 Bacteria 1157
89 Ga0068860_100003140 3300005843 Bacteria 17062
90 Ga0068862_100000128 3300005844 Bacteria 88625
91 Ga0068862_100018129 3300005844 Bacteria 5862
92 Ga0081540_1079531 3300005983 Bacteria 1482
93 Ga0081540_1110481 3300005983 Bacteria 1163
94 Ga0070715_10006908 3300006163 Bacteria 3882
95 Ga0070716_100093407 3300006173 Bacteria 1826
96 Ga0070716_100478570 3300006173 Bacteria 914
97 Ga0070712_100301214 3300006175 Bacteria 1298
98 Ga0070712_100434911 3300006175 Bacteria 1090
99 Ga0070712_100499769 3300006175 Bacteria 1019
100 Ga0070712_100504633 3300006175 Bacteria 1014
101 Ga0070712_100539682 3300006175 Bacteria 982
102 Ga0075367_10140624 3300006178 Bacteria 1495
103 Ga0097621_100005591 3300006237 Bacteria 8862
104 Ga0097621_100035992 3300006237 Bacteria 3957
105 Ga0097621_100164191 3300006237 Bacteria 1911
106 Ga0068871_100009486 3300006358 Bacteria 7056
107 Ga0075428_100192132 3300006844 Bacteria 2208
108 Ga0075431_100033581 3300006847 Bacteria 5287
109 Ga0075434_100616883 3300006871 Bacteria 1104
110 Ga0075429_100033627 3300006880 Bacteria 4455
111 Ga0068865_100556386 3300006881 Bacteria 964
112 Ga0097620_100080771 3300006931 Bacteria 3293
113 Ga0097620_100080948 3300006931 Bacteria 3289
114 Ga0079104_1025245 3300006946 Bacteria 1554
115 Ga0099795_10135000 3300007788 Bacteria 999
116 Ga0099795_10144347 3300007788 Bacteria 970
117 Ga0105240_10271431 3300009093 Bacteria 1952
118 Ga0105240_10424330 3300009093 Bacteria 1493
119 Ga0105240_10823402 3300009093 Bacteria 1004
120 Ga0111539_10004917 3300009094 Bacteria 17386
121 Ga0105245_10059426 3300009098 Bacteria 3443
122 Ga0105247_10301597 3300009101 Bacteria 1112
123 Ga0105241_10040059 3300009174 Bacteria 3536
124 Ga0105248_10006025 3300009177 Bacteria 13310
125 Ga0105237_10055213 3300009545 Bacteria 3979
126 Ga0105237_10356146 3300009545 Bacteria 1468
127 Ga0105238_10003746 3300009551 Bacteria 15114
128 Ga0105238_10415273 3300009551 Bacteria 1340
129 Ga0105249_10017944 3300009553 Bacteria 6288
130 Ga0099796_10018016 3300010159 Bacteria 2113
131 Ga0105239_10210111 3300010375 Bacteria 2181
132 Ga0105239_10479976 3300010375 Bacteria 1412
133 Ga0157369_10000203 3300013105 Bacteria 82075
134 Ga0157369_10047048 3300013105 Bacteria 4686
135 Ga0157374_10014743 3300013296 Bacteria 6845
136 Ga0163162_11091412 3300013306 Bacteria 904
137 Ga0157372_11089811 3300013307 Bacteria 924
138 Ga0157375_10008148 3300013308 Bacteria 9168
139 Ga0157375_10058145 3300013308 Bacteria 3825
140 Ga0163163_10010812 3300014325 Bacteria 8239
141 Ga0157380_10001615 3300014326 Bacteria 14859
142 Ga0157380_10001902 3300014326 Bacteria 13842
143 Ga0157380_10019159 3300014326 Bacteria 5097
144 Ga0157379_10040277 3300014968 Bacteria 4169
145 Ga0157379_10493701 3300014968 Bacteria 1134
146 Ga0157376_10012042 3300014969 Bacteria 6402
147 Ga0157376_10438534 3300014969 Bacteria 1271
148 Ga0157376_10514801 3300014969 Bacteria 1178
149 Ga0183363_1006 3300015690 Bacteria 400466
150 Ga0213872_10200437 3300021361 Bacteria 856
151 Ga0207425_1000049 3300025245 Bacteria 180735
152 Ga0209129_1001668 3300025258 Bacteria 12020
153 Ga0209565_1000007 3300025263 Bacteria 784361
154 Ga0209565_1000170 3300025263 Bacteria 84580
155 Ga0209673_1007604 3300025273 Bacteria 4953
156 Ga0209673_1011741 3300025273 Bacteria 3587
157 Ga0209673_1026853 3300025273 Bacteria 1883
158 Ga0209675_1004240 3300025291 Bacteria 6463
159 Ga0209025_1000068 3300025294 Bacteria 294129
160 Ga0209564_1000003 3300025295 Bacteria 1585848
161 Ga0209564_1000335 3300025295 Bacteria 91079
162 Ga0209758_1000004 3300025297 Bacteria 1375322
163 Ga0209758_1011544 3300025297 Bacteria 5098
164 Ga0209050_1000001 3300025298 Bacteria 3563507
165 Ga0209050_1000196 3300025298 Bacteria 135678
166 Ga0209050_1006899 3300025298 Bacteria 6573
167 Ga0209050_1009345 3300025298 Bacteria 5034
168 Ga0209256_1000009 3300025299 Bacteria 922071
169 Ga0209256_1000010 3300025299 Bacteria 912110
170 Ga0209051_1000191 3300025303 Bacteria 108763
171 Ga0209257_1000228 3300025304 Bacteria 133390
172 Ga0209257_1003180 3300025304 Bacteria 14609
173 Ga0209257_1003572 3300025304 Bacteria 13185
174 Ga0209257_1003678 3300025304 Bacteria 12808
175 Ga0209257_1017255 3300025304 Bacteria 2857
176 Ga0207697_10000121 3300025315 Bacteria 37017
177 Ga0207682_10040628 3300025893 Bacteria 1896
178 Ga0207688_10265855 3300025901 Bacteria 1042
179 Ga0207647_10158858 3300025904 Bacteria 1319
180 Ga0207685_10046675 3300025905 Bacteria 1650
181 Ga0207645_10138227 3300025907 Bacteria 1587
182 Ga0207654_10421846 3300025911 Bacteria 931
183 Ga0207695_10143982 3300025913 Bacteria 2329
184 Ga0207671_10012108 3300025914 Bacteria 6965
185 Ga0207671_10417264 3300025914 Bacteria 1068
186 Ga0207693_10049743 3300025915 Bacteria 3292
187 Ga0207693_10140223 3300025915 Bacteria 1901
188 Ga0207662_10163293 3300025918 Bacteria 1424
189 Ga0207681_10000050 3300025923 Bacteria 118481
190 Ga0207681_10157855 3300025923 Bacteria 1706
191 Ga0207681_10163083 3300025923 Bacteria 1682
192 Ga0207694_10000156 3300025924 Bacteria 70186
193 Ga0207694_10143037 3300025924 Bacteria 1924
194 Ga0207650_10025436 3300025925 Bacteria 4216
195 Ga0207659_10687758 3300025926 Bacteria 875
196 Ga0207700_10064965 3300025928 Bacteria 2782
197 Ga0207706_10673618 3300025933 Bacteria 885
198 Ga0207686_10399439 3300025934 Bacteria 1047
199 Ga0207670_10039997 3300025936 Bacteria 3075
200 Ga0207669_10230327 3300025937 Bacteria 1366
201 Ga0207704_10289622 3300025938 Bacteria 1249
202 Ga0207704_10539106 3300025938 Bacteria 946
203 Ga0207665_10037340 3300025939 Bacteria 3233
204 Ga0207691_10011743 3300025940 Bacteria 8411
205 Ga0207691_10870986 3300025940 Bacteria 755
206 Ga0207711_10000001 3300025941 Bacteria 1325674
207 Ga0207689_10159272 3300025942 Bacteria 1860
208 Ga0207679_10077157 3300025945 Bacteria 2534
209 Ga0207679_10238576 3300025945 Bacteria 1539
210 Ga0207679_10855550 3300025945 Bacteria 831
211 Ga0207667_10000068 3300025949 Bacteria 180716
212 Ga0207667_10858155 3300025949 Bacteria 902
213 Ga0207712_10009031 3300025961 Bacteria 6306
214 Ga0207668_10455061 3300025972 Bacteria 1093
215 Ga0207640_10033155 3300025981 Bacteria 3211
216 Ga0207640_10045007 3300025981 Bacteria 2832
217 Ga0207658_10015230 3300025986 Bacteria 5275
218 Ga0207658_10274338 3300025986 Bacteria 1443
219 Ga0207658_10345265 3300025986 Bacteria 1295
220 Ga0207703_10025739 3300026035 Bacteria 4629
221 Ga0207703_10552901 3300026035 Bacteria 1085
222 Ga0207639_10013049 3300026041 Bacteria 5801
223 Ga0207639_10038916 3300026041 Bacteria 3540
224 Ga0207678_10245170 3300026067 Bacteria 1534
225 Ga0207708_10046743 3300026075 Bacteria 3296
226 Ga0207708_10049054 3300026075 Bacteria 3214
227 Ga0207702_10261774 3300026078 Bacteria 1629
228 Ga0207641_10842462 3300026088 Bacteria 909
229 Ga0207648_10234868 3300026089 Bacteria 1631
230 Ga0207676_10119246 3300026095 Bacteria 2222
231 Ga0207676_10246969 3300026095 Bacteria 1604
232 Ga0207674_10018140 3300026116 Bacteria 7657
233 Ga0207674_10203543 3300026116 Bacteria 1929
234 Ga0207674_10629631 3300026116 Bacteria 1036
235 Ga0207675_100019225 3300026118 Bacteria 6374
236 Ga0207675_100026894 3300026118 Bacteria 5355
237 Ga0207675_100084745 3300026118 Bacteria 2974
238 Ga0207675_100178561 3300026118 Bacteria 2032
239 Ga0207683_10104012 3300026121 Bacteria 2537
240 Ga0207698_10073640 3300026142 Bacteria 2721
241 Ga0207698_10720180 3300026142 Bacteria 994
242 Ga0209588_1119422 3300027671 Bacteria 844
243 Ga0265356_1001571 3300028017 Bacteria 3325
244 Ga0268266_10001573 3300028379 Bacteria 26671
245 Ga0268266_10087063 3300028379 Bacteria 2732
246 Ga0268265_10000102 3300028380 Bacteria 106737
247 Ga0268264_10025820 3300028381 Bacteria 4797
248 Ga0265334_10014803 3300028573 Bacteria 3247
249 Ga0265318_10000078 3300028577 Bacteria 90755
250 Ga0265318_10004942 3300028577 Bacteria 6360
251 Ga0307517_10176347 3300028786 Bacteria 1391
252 Ga0265338_10000043 3300028800 Bacteria 226293
253 Ga0265330_10016096 3300031235 Bacteria 3454
254 Ga0265332_10012204 3300031238 Bacteria 3812
255 Ga0265325_10000002 3300031241 Bacteria 396758
256 Ga0265340_10039226 3300031247 Bacteria 2338
257 Ga0265339_10000216 3300031249 Bacteria 47017
258 Ga0265331_10011034 3300031250 Bacteria 4958
259 Ga0265327_10003282 3300031251 Bacteria 15669
260 Ga0307513_10173344 3300031456 Bacteria 2031
261 Ga0307513_10599181 3300031456 Bacteria 811
262 Ga0307408_100052870 3300031548 Bacteria 2932
263 Ga0307408_100060793 3300031548 Bacteria 2755
264 Ga0307408_100143556 3300031548 Bacteria 1876
265 Ga0265313_10001374 3300031595 Bacteria 22847
266 Ga0307508_10117653 3300031616 Bacteria 2259
267 Ga0265314_10021331 3300031711 Bacteria 4983
268 Ga0265314_10344900 3300031711 Bacteria 821
269 Ga0265342_10048271 3300031712 Bacteria 2553
270 Ga0265342_10086061 3300031712 Bacteria 1808
271 Ga0307516_10032551 3300031730 Bacteria 5250
272 Ga0307405_10076332 3300031731 Bacteria 2173
273 Ga0307413_10007820 3300031824 Bacteria 4998
274 Ga0307406_10009523 3300031901 Bacteria 5453
275 Ga0307406_10028440 3300031901 Bacteria 3377
276 Ga0307406_10605444 3300031901 Bacteria 904
277 Ga0307407_10007455 3300031903 Bacteria 4957
278 Ga0307407_10099316 3300031903 Bacteria 1803
279 Ga0307412_10082796 3300031911 Bacteria 2222
280 Ga0307412_10129044 3300031911 Bacteria 1833
281 Ga0307409_100039036 3300031995 Bacteria 3519
282 Ga0307409_100118023 3300031995 Bacteria 2240
283 Ga0307409_100330613 3300031995 Bacteria 1430
284 Ga0307416_100019723 3300032002 Bacteria 4789
285 Ga0307414_10930625 3300032004 Bacteria 798
286 Ga0307411_10048029 3300032005 Bacteria 2763
287 Ga0307415_100439979 3300032126 Bacteria 1124
288 Ga0373954_0344424 3300035118 Bacteria 736
289 Ga0373955_0339355 3300035172 Bacteria 909
290 Ga0373927_0035173 3300035695 Bacteria 3258
291 Ga0373947_0326313 3300035725 Bacteria 1027
292 Ga0373925_0251703 3300037068 Bacteria 1417
293 Ga0395905_0026307 3300037471 Bacteria 5487
294 Ga0395905_0867592 3300037471 Bacteria 806
295 Ga0436364_0887588 3300037853 Bacteria 796
296 Ga0395901_0220414 3300038443 Bacteria 1983
297 Ga0436360_0889201 3300039438 Bacteria 999
298 Ga0436361_0656345 3300039447 Bacteria 1224
299 Ga0436363_1040323 3300039450 Bacteria 956
300 Ga0439436_0055204 3300041404 Bacteria 1116
301 Ga0439439_0000197 3300041406 Bacteria 9225
302 Ga0439461_0014747 3300041410 Bacteria 1490
303 Ga0439465_0006757 3300041413 Bacteria 3643
304 Ga0451791_0180526 3300041451 Bacteria 679
305 Ga0451849_1579085 3300041505 Bacteria 1389
306 Ga0439431_0085488 3300041997 Bacteria 854
307 Ga0439432_043912 3300042006 Bacteria 1409
308 Ga0450888_040420 3300042126 Bacteria 647
309 Ga0439458_0097291 3300042157 Bacteria 762
310 Ga0451577_0888450 3300042876 Bacteria 803
311 Ga0495590_0295845 3300046457 Bacteria 608
312 Ga0495638_0001099 3300046460 Bacteria 26383
313 Ga0495638_0076725 3300046460 Bacteria 2036
314 Ga0495606_0279658 3300046507 Bacteria 913
315 Ga0495608_0393956 3300046511 Bacteria 848
316 Ga0495616_0000360 3300046513 Bacteria 35740
317 Ga0495628_0372853 3300046516 Bacteria 1046
318 Ga0495628_0384822 3300046516 Bacteria 1027
319 Ga0495668_0078747 3300046616 Bacteria 1809
320 Ga0495625_0000054 3300046660 Bacteria 187599
321 Ga0495625_0120696 3300046660 Bacteria 1784
322 Ga0495661_0033296 3300046665 Bacteria 3252
323 Ga0495670_0000015 3300046691 Bacteria 131137
324 Ga0495670_0401545 3300046691 Bacteria 740
325 Ga0495671_0083767 3300046692 Bacteria 1563
326 Ga0495660_0372904 3300046810 Bacteria 630
327 Ga0495674_0146134 3300047319 Bacteria 1985
328 Ga0495674_0603112 3300047319 Bacteria 870
329 Ga0495673_0000600 3300047469 Bacteria 35843
330 Ga0495681_0025398 3300047470 Bacteria 3100
331 Ga0495686_0137553 3300047472 Bacteria 1444
332 Ga0496101_0833909 3300048904 Bacteria 727
333 Ga0496102_0492594 3300048905 Bacteria 1147
334 Ga0496102_0646273 3300048905 Bacteria 981
335 Ga0496103_0000037 3300048906 Bacteria 179474
336 Ga0496104_0008260 3300048907 Bacteria 9243
337 Ga0496104_0024084 3300048907 Bacteria 5602
338 Ga0496104_0097029 3300048907 Bacteria 2821
339 Ga0496104_0419721 3300048907 Bacteria 1250
340 Ga0496105_0002020 3300048908 Bacteria 14656
341 Ga0496105_0033403 3300048908 Bacteria 4225
342 Ga0496108_0003757 3300048911 Bacteria 12168
343 Ga0496109_0001984 3300048912 Bacteria 16959
344 Ga0496109_0293576 3300048912 Bacteria 1533
345 Ga0496110_0097886 3300048913 Bacteria 2628
346 Ga0496111_0379381 3300048914 Bacteria 1045
347 Ga0496114_0087188 3300048917 Bacteria 2646
348 Ga0496114_0459556 3300048917 Bacteria 1127
349 Ga0496115_0001359 3300048918 Bacteria 17461
350 Ga0496116_0002416 3300048919 Bacteria 19675
351 Ga0496117_0000115 3300048920 Bacteria 179488
352 Ga0496118_0000086 3300048921 Bacteria 179488
353 Ga0496118_0330231 3300048921 Bacteria 823
354 Ga0496119_0009737 3300048922 Bacteria 8182
355 Ga0496120_0074129 3300048923 Bacteria 1860
356 Ga0496121_0000105 3300048924 Bacteria 191437
357 Ga0496124_0000102 3300048927 Bacteria 179488
358 Ga0496124_0000129 3300048927 Bacteria 156648
359 Ga0496124_0018814 3300048927 Bacteria 6452
360 Ga0496124_0040847 3300048927 Bacteria 4008
361 Ga0496124_0356267 3300048927 Bacteria 1033
362 Ga0496125_0124827 3300048928 Bacteria 1827
363 Ga0496125_0146798 3300048928 Bacteria 1628
364 Ga0496126_0001609 3300048929 Bacteria 34276
365 Ga0496126_0004119 3300048929 Bacteria 17590
366 Ga0496126_0005832 3300048929 Bacteria 13922
367 Ga0496126_0402304 3300048929 Bacteria 1110
368 Ga0495682_0002446 3300049460 Bacteria 8778
369 Ga0501036_1311913 3300049572 Bacteria 588
370 Ga0501042_0159021 3300049578 Bacteria 1630
371 Ga0501047_0065937 3300049581 Bacteria 3490
372 Ga0501068_0000771 3300049584 Bacteria 16509
373 Ga0501069_0095231 3300049585 Bacteria 1686
374 Ga0501070_0064531 3300049586 Bacteria 3032
375 Ga0501071_0011277 3300049587 Bacteria 6014
376 Ga0501073_0002694 3300049589 Bacteria 13298
377 Ga0501076_0016598 3300049592 Bacteria 5583
378 Ga0501077_0012798 3300049593 Bacteria 5257
379 Ga0501225_0002106 3300049705 Bacteria 6185
380 Ga0501079_0000016 3300049741 Bacteria 65975
381 Ga0501080_0000319 3300049742 Bacteria 36724
382 Ga0501083_0015178 3300049744 Bacteria 5393
383 Ga0501241_022387 3300049758 Bacteria 1167
384 nmdc:mga06z11_62275_c1 3300050494 Bacteria 1948
385 nmdc:mga06r32_26358_c1 3300050510 Bacteria 5418
386 nmdc:mga0rr50_1260189_c1 3300050513 Bacteria 627
387 nmdc:mga0rr50_1368332_c1 3300050513 Bacteria 599
388 nmdc:mga0sz30_13312_c1 3300050516 Bacteria 3219
389 Ga0500643_056086 3300053087 Bacteria 1115
390 Ga0500644_0000228 3300053088 Bacteria 32096
391 Ga0500566_0089168 3300053094 Bacteria 1706
392 Ga0500556_0006177 3300053104 Bacteria 3397
393 Ga0500562_028128 3300053108 Bacteria 1477
394 Ga0500607_000052 3300053121 Bacteria 80355
395 Ga0500614_177200 3300053123 Bacteria 651
396 Ga0500655_002963 3300053133 Bacteria 3080
397 Ga0500658_0009388 3300053134 Bacteria 3608
398 Ga0500658_0161825 3300053134 Bacteria 1013
399 Ga0500559_0003408 3300053136 Bacteria 7828
400 Ga0500564_000157 3300053138 Bacteria 17802
401 Ga0500564_021329 3300053138 Bacteria 2967
402 Ga0500604_0019199 3300053151 Bacteria 1912
403 Ga0500619_010208 3300053154 Bacteria 2365
404 Ga0500622_0008175 3300053156 Bacteria 5876
405 Ga0500622_0015639 3300053156 Bacteria 4062
406 Ga0500637_0178320 3300053178 Bacteria 1219
407 Ga0501084_0003301 3300054114 Bacteria 13049
408 Ga0501082_0110085 3300060353 Bacteria 2384

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0330231 Ga0496118_0330231_237_800 178
2 3300007788 Ga0099795_10135000 Ga0099795_101350002 180
3 3300006175 Ga0070712_100504633 Ga0070712_1005046332 181
4 3300035172 Ga0373955_0339355 Ga0373955_0339355_341_889 182
5 3300035725 Ga0373947_0326313 Ga0373947_0326313_433_981 182
6 3300037068 Ga0373925_0251703 Ga0373925_0251703_853_1401 182
7 3300041451 Ga0451791_0180526 Ga0451791_0180526_119_667 182
8 3300041997 Ga0439431_0085488 Ga0439431_0085488_14_589 182
9 3300042157 Ga0439458_0097291 Ga0439458_0097291_187_735 182
10 3300046457 Ga0495590_0295845 Ga0495590_0295845_26_574 182
11 3300046616 Ga0495668_0078747 Ga0495668_0078747_14_562 182
12 3300046665 Ga0495661_0033296 Ga0495661_0033296_10_558 182
13 3300046692 Ga0495671_0083767 Ga0495671_0083767_572_1120 182
14 3300046810 Ga0495660_0372904 Ga0495660_0372904_21_569 182
15 3300047319 Ga0495674_0603112 Ga0495674_0603112_289_837 182
16 3300048907 Ga0496104_0419721 Ga0496104_0419721_684_1232 182
17 3300048908 Ga0496105_0033403 Ga0496105_0033403_1954_2502 182
18 3300048923 Ga0496120_0074129 Ga0496120_0074129_13_564 182
19 3300049572 Ga0501036_1311913 Ga0501036_1311913_24_572 182
20 3300050513 nmdc:mga0rr50_1260189_c1 nmdc:mga0rr50_1260189_c1_23_571 182
21 3300050513 nmdc:mga0rr50_1368332_c1 nmdc:mga0rr50_1368332_c1_36_584 182
22 3300050516 nmdc:mga0sz30_13312_c1 nmdc:mga0sz30_13312_c1_44_592 182
23 3300006173 Ga0070716_100478570 Ga0070716_1004785702 184
24 3300006175 Ga0070712_100301214 Ga0070712_1003012142 188
25 3300025915 Ga0207693_10049743 Ga0207693_100497432 188
26 3300028577 Ga0265318_10000078 Ga0265318_1000007821 189
27 3300001989 JGI24739J22299_10004073 JGI24739J22299_100040734 194
28 3300005577 Ga0068857_100015451 Ga0068857_1000154514 194
29 3300026116 Ga0207674_10018140 Ga0207674_100181406 194
30 3300005367 Ga0070667_101008622 Ga0070667_1010086221 195
31 iso_pu_bacteria 2512564014 2512644680 195
32 iso_pu_bacteria 2513237137 2513859768 195
33 iso_pu_bacteria 2517572143 2517890012 195
34 iso_pu_bacteria 2582581279 2585146330 195
35 iso_pu_bacteria 2582581279 2585148451 195
36 iso_pu_bacteria 2582581315 2585324499 195
37 iso_pu_bacteria 2585428106 2587916390 195
38 iso_pu_bacteria 2585428106 2587917622 195
39 iso_pu_bacteria 2593339238 2595447820 195
40 iso_pu_bacteria 2599185359 2600228612 195
41 iso_pu_bacteria 2643221622 2644125901 195
42 iso_pu_bacteria 2643221640 2644226853 195
43 iso_pu_bacteria 2643221642 2644233678 195
44 iso_pu_bacteria 2808606401 2809062223 195
45 iso_pu_bacteria 2808606404 2809078437 195
46 iso_pu_bacteria 2808606405 2809082612 195
47 iso_pu_bacteria 2818991466 2819714577 195
48 iso_pu_bacteria 2857504554 2857507122 195
49 iso_pu_bacteria 2879163058 2879165611 195
50 iso_pu_bacteria 2880518877 2880518970 195
51 iso_pu_bacteria 2884411467 2884413130 195
52 iso_pu_bacteria 2884960567 2884961834 195
53 iso_pu_bacteria 2884960567 2884964914 195
54 iso_pu_bacteria 2886627955 2886633999 195
55 iso_pu_bacteria 2899259804 2899262798 195
56 iso_pu_bacteria 2919709256 2919710511 195
57 iso_pu_bacteria 2928526807 2928529080 195
58 iso_pu_bacteria 2928531327 2928536060 195
59 iso_pu_bacteria 2928968154 2928968597 195
60 iso_pu_bacteria 2990265787 2990266069 195
61 iso_pu_bacteria 2993693658 2993696138 195
62 iso_pu_bacteria 8054302542 8054304142 195
63 iso_pu_bacteria 8054563764 8054565013 195
64 3300013308 Ga0157375_10058145 Ga0157375_100581455 196
65 3300041505 Ga0451849_1579085 Ga0451849_1579085_394_1005 196
66 3300048917 Ga0496114_0087188 Ga0496114_0087188_1035_1646 196
67 3300002075 JGI24738J21930_10013414 JGI24738J21930_100134142 198
68 3300005457 Ga0070662_100111467 Ga0070662_1001114673 198
69 3300005539 Ga0068853_100003308 Ga0068853_1000033087 198
70 3300005563 Ga0068855_100829450 Ga0068855_1008294502 198
71 3300005578 Ga0068854_100103914 Ga0068854_1001039141 198
72 3300009551 Ga0105238_10415273 Ga0105238_104152732 198
73 3300014326 Ga0157380_10001902 Ga0157380_100019026 198
74 3300021361 Ga0213872_10200437 Ga0213872_102004371 198
75 3300025904 Ga0207647_10158858 Ga0207647_101588582 198
76 3300025924 Ga0207694_10143037 Ga0207694_101430372 198
77 3300025981 Ga0207640_10033155 Ga0207640_100331553 198
78 3300026041 Ga0207639_10013049 Ga0207639_100130492 198
79 3300026116 Ga0207674_10629631 Ga0207674_106296312 198
80 3300031548 Ga0307408_100060793 Ga0307408_1000607933 198
81 3300031731 Ga0307405_10076332 Ga0307405_100763323 198
82 3300031901 Ga0307406_10605444 Ga0307406_106054442 198
83 3300031911 Ga0307412_10082796 Ga0307412_100827963 198
84 3300031995 Ga0307409_100330613 Ga0307409_1003306131 198
85 3300039447 Ga0436361_0656345 Ga0436361_0656345_586_1185 198
86 3300001989 JGI24739J22299_10000187 JGI24739J22299_100001871 199
87 3300002774 JGI25150J39212_1000398 JGI25150J39212_100039814 199
88 3300003187 JGI25151J46595_10050349 JGI25151J46595_100503491 199
89 3300003215 JGI25153J46596_10000091 JGI25153J46596_1000009171 199
90 3300003215 JGI25153J46596_10015585 JGI25153J46596_100155853 199
91 3300003322 rootL2_10181224 rootL2_101812242 199
92 3300003771 Ga0055526_1011643 Ga0055526_10116434 199
93 3300003773 Ga0055537_1001470 Ga0055537_10014708 199
94 3300003773 Ga0055537_1001547 Ga0055537_10015477 199
95 3300003775 Ga0055524_1001171 Ga0055524_100117111 199
96 3300003781 Ga0055536_1022900 Ga0055536_10229002 199
97 3300003791 Ga0055530_10038540 Ga0055530_100385402 199
98 3300003792 Ga0055540_1003107 Ga0055540_10031072 199
99 3300003794 Ga0055531_10000116 Ga0055531_1000011655 199
100 3300003794 Ga0055531_10016434 Ga0055531_100164343 199
101 3300005328 Ga0070676_10114046 Ga0070676_101140462 199
102 3300005329 Ga0070683_100012154 Ga0070683_1000121547 199
103 3300005329 Ga0070683_100645829 Ga0070683_1006458293 199
104 3300005330 Ga0070690_100011616 Ga0070690_1000116162 199
105 3300005330 Ga0070690_100068072 Ga0070690_1000680722 199
106 3300005331 Ga0070670_100015212 Ga0070670_1000152123 199
107 3300005331 Ga0070670_100367459 Ga0070670_1003674592 199
108 3300005335 Ga0070666_10032078 Ga0070666_100320782 199
109 3300005336 Ga0070680_100295190 Ga0070680_1002951902 199
110 3300005340 Ga0070689_100005535 Ga0070689_1000055352 199
111 3300005343 Ga0070687_100322212 Ga0070687_1003222121 199
112 3300005353 Ga0070669_100000048 Ga0070669_10000004862 199
113 3300005353 Ga0070669_100078138 Ga0070669_1000781383 199
114 3300005353 Ga0070669_100199859 Ga0070669_1001998591 199
115 3300005355 Ga0070671_100434795 Ga0070671_1004347951 199
116 3300005356 Ga0070674_100074560 Ga0070674_1000745602 199
117 3300005365 Ga0070688_100156024 Ga0070688_1001560242 199
118 3300005367 Ga0070667_100013798 Ga0070667_1000137982 199
119 3300005367 Ga0070667_100196335 Ga0070667_1001963351 199
120 3300005367 Ga0070667_100410982 Ga0070667_1004109822 199
121 3300005406 Ga0070703_10147694 Ga0070703_101476941 199
122 3300005434 Ga0070709_10167097 Ga0070709_101670972 199
123 3300005434 Ga0070709_10723891 Ga0070709_107238911 199
124 3300005435 Ga0070714_100465814 Ga0070714_1004658141 199
125 3300005436 Ga0070713_100218775 Ga0070713_1002187751 199
126 3300005436 Ga0070713_100261759 Ga0070713_1002617593 199
127 3300005436 Ga0070713_100292313 Ga0070713_1002923132 199
128 3300005438 Ga0070701_10019277 Ga0070701_100192772 199
129 3300005439 Ga0070711_100488195 Ga0070711_1004881952 199
130 3300005441 Ga0070700_100082962 Ga0070700_1000829623 199
131 3300005441 Ga0070700_100105616 Ga0070700_1001056162 199
132 3300005455 Ga0070663_100181016 Ga0070663_1001810161 199
133 3300005456 Ga0070678_100103936 Ga0070678_1001039362 199
134 3300005457 Ga0070662_100628624 Ga0070662_1006286241 199
135 3300005458 Ga0070681_10061334 Ga0070681_100613343 199
136 3300005459 Ga0068867_100210568 Ga0068867_1002105681 199
137 3300005471 Ga0070698_100244150 Ga0070698_1002441502 199
138 3300005535 Ga0070684_100038055 Ga0070684_1000380553 199
139 3300005543 Ga0070672_100013803 Ga0070672_1000138033 199
140 3300005543 Ga0070672_100018096 Ga0070672_1000180964 199
141 3300005544 Ga0070686_100011665 Ga0070686_1000116653 199
142 3300005545 Ga0070695_100025959 Ga0070695_1000259591 199
143 3300005547 Ga0070693_100350753 Ga0070693_1003507531 199
144 3300005548 Ga0070665_100001518 Ga0070665_1000015188 199
145 3300005548 Ga0070665_100033290 Ga0070665_1000332902 199
146 3300005548 Ga0070665_100442050 Ga0070665_1004420501 199
147 3300005577 Ga0068857_100100477 Ga0068857_1001004772 199
148 3300005577 Ga0068857_100476835 Ga0068857_1004768352 199
149 3300005578 Ga0068854_100114747 Ga0068854_1001147472 199
150 3300005614 Ga0068856_100166150 Ga0068856_1001661503 199
151 3300005615 Ga0070702_100023095 Ga0070702_1000230954 199
152 3300005615 Ga0070702_100319660 Ga0070702_1003196601 199
153 3300005616 Ga0068852_100040621 Ga0068852_1000406211 199
154 3300005616 Ga0068852_100161441 Ga0068852_1001614412 199
155 3300005616 Ga0068852_100616019 Ga0068852_1006160192 199
156 3300005617 Ga0068859_100080765 Ga0068859_1000807652 199
157 3300005617 Ga0068859_100080948 Ga0068859_1000809482 199
158 3300005618 Ga0068864_100030628 Ga0068864_1000306284 199
159 3300005618 Ga0068864_100176295 Ga0068864_1001762952 199
160 3300005719 Ga0068861_100013245 Ga0068861_1000132456 199
161 3300005719 Ga0068861_100023529 Ga0068861_1000235293 199
162 3300005840 Ga0068870_10263909 Ga0068870_102639092 199
163 3300005841 Ga0068863_100009439 Ga0068863_1000094394 199
164 3300005842 Ga0068858_100042308 Ga0068858_1000423084 199
165 3300005842 Ga0068858_100514419 Ga0068858_1005144192 199
166 3300005843 Ga0068860_100003140 Ga0068860_1000031402 199
167 3300005844 Ga0068862_100000128 Ga0068862_10000012863 199
168 3300005844 Ga0068862_100018129 Ga0068862_1000181295 199
169 3300005983 Ga0081540_1079531 Ga0081540_10795313 199
170 3300005983 Ga0081540_1110481 Ga0081540_11104811 199
171 3300006163 Ga0070715_10006908 Ga0070715_100069083 199
172 3300006173 Ga0070716_100093407 Ga0070716_1000934073 199
173 3300006175 Ga0070712_100434911 Ga0070712_1004349112 199
174 3300006175 Ga0070712_100499769 Ga0070712_1004997692 199
175 3300006175 Ga0070712_100539682 Ga0070712_1005396821 199
176 3300006178 Ga0075367_10140624 Ga0075367_101406242 199
177 3300006237 Ga0097621_100005591 Ga0097621_1000055916 199
178 3300006237 Ga0097621_100035992 Ga0097621_1000359922 199
179 3300006237 Ga0097621_100164191 Ga0097621_1001641911 199
180 3300006358 Ga0068871_100009486 Ga0068871_1000094863 199
181 3300006844 Ga0075428_100192132 Ga0075428_1001921322 199
182 3300006847 Ga0075431_100033581 Ga0075431_1000335813 199
183 3300006871 Ga0075434_100616883 Ga0075434_1006168832 199
184 3300006880 Ga0075429_100033627 Ga0075429_1000336273 199
185 3300006881 Ga0068865_100556386 Ga0068865_1005563862 199
186 3300006931 Ga0097620_100080771 Ga0097620_1000807713 199
187 3300006931 Ga0097620_100080948 Ga0097620_1000809483 199
188 3300006946 Ga0079104_1025245 Ga0079104_10252451 199
189 3300007788 Ga0099795_10144347 Ga0099795_101443471 199
190 3300009093 Ga0105240_10271431 Ga0105240_102714311 199
191 3300009093 Ga0105240_10424330 Ga0105240_104243301 199
192 3300009093 Ga0105240_10823402 Ga0105240_108234022 199
193 3300009094 Ga0111539_10004917 Ga0111539_1000491710 199
194 3300009098 Ga0105245_10059426 Ga0105245_100594263 199
195 3300009101 Ga0105247_10301597 Ga0105247_103015972 199
196 3300009174 Ga0105241_10040059 Ga0105241_100400595 199
197 3300009177 Ga0105248_10006025 Ga0105248_100060257 199
198 3300009545 Ga0105237_10055213 Ga0105237_100552134 199
199 3300009545 Ga0105237_10356146 Ga0105237_103561462 199
200 3300009551 Ga0105238_10003746 Ga0105238_100037464 199
201 3300009553 Ga0105249_10017944 Ga0105249_100179444 199
202 3300010159 Ga0099796_10018016 Ga0099796_100180163 199
203 3300010375 Ga0105239_10210111 Ga0105239_102101112 199
204 3300010375 Ga0105239_10479976 Ga0105239_104799762 199
205 3300013105 Ga0157369_10000203 Ga0157369_1000020349 199
206 3300013105 Ga0157369_10047048 Ga0157369_100470483 199
207 3300013296 Ga0157374_10014743 Ga0157374_100147437 199
208 3300013306 Ga0163162_11091412 Ga0163162_110914122 199
209 3300013307 Ga0157372_11089811 Ga0157372_110898112 199
210 3300013308 Ga0157375_10008148 Ga0157375_100081483 199
211 3300014325 Ga0163163_10010812 Ga0163163_100108122 199
212 3300014326 Ga0157380_10001615 Ga0157380_100016157 199
213 3300014326 Ga0157380_10019159 Ga0157380_100191593 199
214 3300014968 Ga0157379_10040277 Ga0157379_100402772 199
215 3300014968 Ga0157379_10493701 Ga0157379_104937011 199
216 3300014969 Ga0157376_10012042 Ga0157376_100120422 199
217 3300014969 Ga0157376_10438534 Ga0157376_104385342 199
218 3300014969 Ga0157376_10514801 Ga0157376_105148011 199
219 3300015690 Ga0183363_1006 Ga0183363_1006216 199
220 3300025245 Ga0207425_1000049 Ga0207425_1000049142 199
221 3300025258 Ga0209129_1001668 Ga0209129_10016687 199
222 3300025263 Ga0209565_1000007 Ga0209565_100000741 199
223 3300025263 Ga0209565_1000170 Ga0209565_10001709 199
224 3300025273 Ga0209673_1007604 Ga0209673_10076047 199
225 3300025273 Ga0209673_1011741 Ga0209673_10117413 199
226 3300025273 Ga0209673_1026853 Ga0209673_10268533 199
227 3300025291 Ga0209675_1004240 Ga0209675_10042404 199
228 3300025294 Ga0209025_1000068 Ga0209025_1000068114 199
229 3300025295 Ga0209564_1000003 Ga0209564_1000003697 199
230 3300025295 Ga0209564_1000335 Ga0209564_100033553 199
231 3300025297 Ga0209758_1000004 Ga0209758_100000413 199
232 3300025297 Ga0209758_1011544 Ga0209758_10115443 199
233 3300025298 Ga0209050_1000001 Ga0209050_10000011942 199
234 3300025298 Ga0209050_1000196 Ga0209050_1000196103 199
235 3300025298 Ga0209050_1006899 Ga0209050_10068994 199
236 3300025298 Ga0209050_1009345 Ga0209050_10093452 199
237 3300025299 Ga0209256_1000009 Ga0209256_1000009117 199
238 3300025299 Ga0209256_1000010 Ga0209256_100001041 199
239 3300025303 Ga0209051_1000191 Ga0209051_1000191127 199
240 3300025304 Ga0209257_1000228 Ga0209257_1000228103 199
241 3300025304 Ga0209257_1003180 Ga0209257_100318010 199
242 3300025304 Ga0209257_1003572 Ga0209257_100357214 199
243 3300025304 Ga0209257_1003678 Ga0209257_10036788 199
244 3300025304 Ga0209257_1017255 Ga0209257_10172554 199
245 3300025315 Ga0207697_10000121 Ga0207697_100001216 199
246 3300025893 Ga0207682_10040628 Ga0207682_100406282 199
247 3300025901 Ga0207688_10265855 Ga0207688_102658552 199
248 3300025905 Ga0207685_10046675 Ga0207685_100466752 199
249 3300025907 Ga0207645_10138227 Ga0207645_101382272 199
250 3300025911 Ga0207654_10421846 Ga0207654_104218462 199
251 3300025913 Ga0207695_10143982 Ga0207695_101439821 199
252 3300025914 Ga0207671_10012108 Ga0207671_100121087 199
253 3300025914 Ga0207671_10417264 Ga0207671_104172641 199
254 3300025915 Ga0207693_10140223 Ga0207693_101402233 199
255 3300025918 Ga0207662_10163293 Ga0207662_101632932 199
256 3300025923 Ga0207681_10000050 Ga0207681_1000005062 199
257 3300025923 Ga0207681_10157855 Ga0207681_101578552 199
258 3300025923 Ga0207681_10163083 Ga0207681_101630832 199
259 3300025924 Ga0207694_10000156 Ga0207694_1000015632 199
260 3300025925 Ga0207650_10025436 Ga0207650_100254364 199
261 3300025926 Ga0207659_10687758 Ga0207659_106877581 199
262 3300025928 Ga0207700_10064965 Ga0207700_100649652 199
263 3300025933 Ga0207706_10673618 Ga0207706_106736182 199
264 3300025934 Ga0207686_10399439 Ga0207686_103994392 199
265 3300025936 Ga0207670_10039997 Ga0207670_100399973 199
266 3300025937 Ga0207669_10230327 Ga0207669_102303272 199
267 3300025938 Ga0207704_10289622 Ga0207704_102896222 199
268 3300025938 Ga0207704_10539106 Ga0207704_105391061 199
269 3300025939 Ga0207665_10037340 Ga0207665_100373401 199
270 3300025940 Ga0207691_10011743 Ga0207691_100117437 199
271 3300025940 Ga0207691_10870986 Ga0207691_108709861 199
272 3300025941 Ga0207711_10000001 Ga0207711_10000001703 199
273 3300025942 Ga0207689_10159272 Ga0207689_101592722 199
274 3300025945 Ga0207679_10077157 Ga0207679_100771573 199
275 3300025945 Ga0207679_10238576 Ga0207679_102385762 199
276 3300025945 Ga0207679_10855550 Ga0207679_108555501 199
277 3300025949 Ga0207667_10000068 Ga0207667_1000006838 199
278 3300025949 Ga0207667_10858155 Ga0207667_108581552 199
279 3300025961 Ga0207712_10009031 Ga0207712_100090314 199
280 3300025972 Ga0207668_10455061 Ga0207668_104550612 199
281 3300025981 Ga0207640_10045007 Ga0207640_100450072 199
282 3300025986 Ga0207658_10015230 Ga0207658_100152304 199
283 3300025986 Ga0207658_10274338 Ga0207658_102743382 199
284 3300025986 Ga0207658_10345265 Ga0207658_103452651 199
285 3300026035 Ga0207703_10025739 Ga0207703_100257393 199
286 3300026035 Ga0207703_10552901 Ga0207703_105529012 199
287 3300026041 Ga0207639_10038916 Ga0207639_100389161 199
288 3300026067 Ga0207678_10245170 Ga0207678_102451702 199
289 3300026075 Ga0207708_10046743 Ga0207708_100467433 199
290 3300026075 Ga0207708_10049054 Ga0207708_100490543 199
291 3300026078 Ga0207702_10261774 Ga0207702_102617743 199
292 3300026088 Ga0207641_10842462 Ga0207641_108424621 199
293 3300026089 Ga0207648_10234868 Ga0207648_102348682 199
294 3300026095 Ga0207676_10119246 Ga0207676_101192462 199
295 3300026095 Ga0207676_10246969 Ga0207676_102469692 199
296 3300026116 Ga0207674_10203543 Ga0207674_102035433 199
297 3300026118 Ga0207675_100019225 Ga0207675_1000192256 199
298 3300026118 Ga0207675_100026894 Ga0207675_1000268942 199
299 3300026118 Ga0207675_100084745 Ga0207675_1000847452 199
300 3300026118 Ga0207675_100178561 Ga0207675_1001785613 199
301 3300026121 Ga0207683_10104012 Ga0207683_101040122 199
302 3300026142 Ga0207698_10073640 Ga0207698_100736404 199
303 3300026142 Ga0207698_10720180 Ga0207698_107201802 199
304 3300027671 Ga0209588_1119422 Ga0209588_11194221 199
305 3300028017 Ga0265356_1001571 Ga0265356_10015713 199
306 3300028379 Ga0268266_10001573 Ga0268266_100015736 199
307 3300028379 Ga0268266_10087063 Ga0268266_100870632 199
308 3300028380 Ga0268265_10000102 Ga0268265_1000010251 199
309 3300028381 Ga0268264_10025820 Ga0268264_100258204 199
310 3300028573 Ga0265334_10014803 Ga0265334_100148033 199
311 3300028577 Ga0265318_10004942 Ga0265318_100049423 199
312 3300028786 Ga0307517_10176347 Ga0307517_101763472 199
313 3300028800 Ga0265338_10000043 Ga0265338_1000004348 199
314 3300031235 Ga0265330_10016096 Ga0265330_100160962 199
315 3300031238 Ga0265332_10012204 Ga0265332_100122045 199
316 3300031241 Ga0265325_10000002 Ga0265325_10000002339 199
317 3300031247 Ga0265340_10039226 Ga0265340_100392265 199
318 3300031249 Ga0265339_10000216 Ga0265339_1000021637 199
319 3300031250 Ga0265331_10011034 Ga0265331_100110346 199
320 3300031251 Ga0265327_10003282 Ga0265327_100032826 199
321 3300031456 Ga0307513_10173344 Ga0307513_101733442 199
322 3300031456 Ga0307513_10599181 Ga0307513_105991811 199
323 3300031548 Ga0307408_100052870 Ga0307408_1000528702 199
324 3300031548 Ga0307408_100143556 Ga0307408_1001435563 199
325 3300031595 Ga0265313_10001374 Ga0265313_1000137417 199
326 3300031616 Ga0307508_10117653 Ga0307508_101176532 199
327 3300031711 Ga0265314_10021331 Ga0265314_100213314 199
328 3300031711 Ga0265314_10344900 Ga0265314_103449001 199
329 3300031712 Ga0265342_10048271 Ga0265342_100482714 199
330 3300031712 Ga0265342_10086061 Ga0265342_100860613 199
331 3300031730 Ga0307516_10032551 Ga0307516_100325512 199
332 3300031824 Ga0307413_10007820 Ga0307413_100078202 199
333 3300031901 Ga0307406_10009523 Ga0307406_100095233 199
334 3300031901 Ga0307406_10028440 Ga0307406_100284403 199
335 3300031903 Ga0307407_10007455 Ga0307407_100074556 199
336 3300031903 Ga0307407_10099316 Ga0307407_100993163 199
337 3300031911 Ga0307412_10129044 Ga0307412_101290442 199
338 3300031995 Ga0307409_100039036 Ga0307409_1000390364 199
339 3300031995 Ga0307409_100118023 Ga0307409_1001180232 199
340 3300032002 Ga0307416_100019723 Ga0307416_1000197235 199
341 3300032004 Ga0307414_10930625 Ga0307414_109306252 199
342 3300032005 Ga0307411_10048029 Ga0307411_100480292 199
343 3300032126 Ga0307415_100439979 Ga0307415_1004399792 199
344 3300035118 Ga0373954_0344424 Ga0373954_0344424_35_652 199
345 3300035695 Ga0373927_0035173 Ga0373927_0035173_302_901 199
346 3300037471 Ga0395905_0026307 Ga0395905_0026307_4819_5418 199
347 3300037471 Ga0395905_0867592 Ga0395905_0867592_95_697 199
348 3300037853 Ga0436364_0887588 Ga0436364_0887588_145_753 199
349 3300038443 Ga0395901_0220414 Ga0395901_0220414_312_911 199
350 3300039438 Ga0436360_0889201 Ga0436360_0889201_248_850 199
351 3300039450 Ga0436363_1040323 Ga0436363_1040323_176_775 199
352 3300041404 Ga0439436_0055204 Ga0439436_0055204_128_754 199
353 3300041406 Ga0439439_0000197 Ga0439439_0000197_7045_7671 199
354 3300041410 Ga0439461_0014747 Ga0439461_0014747_19_645 199
355 3300041413 Ga0439465_0006757 Ga0439465_0006757_2193_2819 199
356 3300042006 Ga0439432_043912 Ga0439432_043912_694_1320 199
357 3300042126 Ga0450888_040420 Ga0450888_040420_14_634 199
358 3300042876 Ga0451577_0888450 Ga0451577_0888450_26_625 199
359 3300046460 Ga0495638_0001099 Ga0495638_0001099_14573_15172 199
360 3300046460 Ga0495638_0076725 Ga0495638_0076725_1057_1680 199
361 3300046507 Ga0495606_0279658 Ga0495606_0279658_74_673 199
362 3300046511 Ga0495608_0393956 Ga0495608_0393956_206_805 199
363 3300046513 Ga0495616_0000360 Ga0495616_0000360_22549_23172 199
364 3300046516 Ga0495628_0372853 Ga0495628_0372853_48_647 199
365 3300046516 Ga0495628_0384822 Ga0495628_0384822_324_923 199
366 3300046660 Ga0495625_0000054 Ga0495625_0000054_64236_64838 199
367 3300046660 Ga0495625_0120696 Ga0495625_0120696_74_676 199
368 3300046691 Ga0495670_0000015 Ga0495670_0000015_64125_64727 199
369 3300046691 Ga0495670_0401545 Ga0495670_0401545_88_702 199
370 3300047319 Ga0495674_0146134 Ga0495674_0146134_1222_1821 199
371 3300047469 Ga0495673_0000600 Ga0495673_0000600_22054_22653 199
372 3300047470 Ga0495681_0025398 Ga0495681_0025398_783_1409 199
373 3300047472 Ga0495686_0137553 Ga0495686_0137553_638_1237 199
374 3300048904 Ga0496101_0833909 Ga0496101_0833909_79_699 199
375 3300048905 Ga0496102_0492594 Ga0496102_0492594_78_677 199
376 3300048905 Ga0496102_0646273 Ga0496102_0646273_259_885 199
377 3300048906 Ga0496103_0000037 Ga0496103_0000037_121014_121616 199
378 3300048907 Ga0496104_0008260 Ga0496104_0008260_1990_2610 199
379 3300048907 Ga0496104_0024084 Ga0496104_0024084_4624_5223 199
380 3300048907 Ga0496104_0097029 Ga0496104_0097029_1285_1908 199
381 3300048908 Ga0496105_0002020 Ga0496105_0002020_12573_13193 199
382 3300048911 Ga0496108_0003757 Ga0496108_0003757_4687_5307 199
383 3300048912 Ga0496109_0001984 Ga0496109_0001984_7009_7629 199
384 3300048912 Ga0496109_0293576 Ga0496109_0293576_288_887 199
385 3300048913 Ga0496110_0097886 Ga0496110_0097886_476_1096 199
386 3300048914 Ga0496111_0379381 Ga0496111_0379381_178_798 199
387 3300048917 Ga0496114_0459556 Ga0496114_0459556_40_651 199
388 3300048918 Ga0496115_0001359 Ga0496115_0001359_11069_11710 199
389 3300048919 Ga0496116_0002416 Ga0496116_0002416_13274_13876 199
390 3300048920 Ga0496117_0000115 Ga0496117_0000115_57859_58461 199
391 3300048921 Ga0496118_0000086 Ga0496118_0000086_121028_121630 199
392 3300048922 Ga0496119_0009737 Ga0496119_0009737_7537_8139 199
393 3300048924 Ga0496121_0000105 Ga0496121_0000105_81428_82030 199
394 3300048927 Ga0496124_0000102 Ga0496124_0000102_121028_121630 199
395 3300048927 Ga0496124_0000129 Ga0496124_0000129_145939_146541 199
396 3300048927 Ga0496124_0018814 Ga0496124_0018814_5687_6289 199
397 3300048927 Ga0496124_0040847 Ga0496124_0040847_940_1539 199
398 3300048927 Ga0496124_0356267 Ga0496124_0356267_103_702 199
399 3300048928 Ga0496125_0124827 Ga0496125_0124827_69_671 199
400 3300048928 Ga0496125_0146798 Ga0496125_0146798_961_1560 199
401 3300048929 Ga0496126_0001609 Ga0496126_0001609_28943_29542 199
402 3300048929 Ga0496126_0004119 Ga0496126_0004119_10334_10933 199
403 3300048929 Ga0496126_0005832 Ga0496126_0005832_12175_12786 199
404 3300048929 Ga0496126_0402304 Ga0496126_0402304_159_758 199
405 3300049460 Ga0495682_0002446 Ga0495682_0002446_6262_6861 199
406 3300049578 Ga0501042_0159021 Ga0501042_0159021_987_1607 199
407 3300049581 Ga0501047_0065937 Ga0501047_0065937_2407_3006 199
408 3300049584 Ga0501068_0000771 Ga0501068_0000771_7082_7702 199
409 3300049585 Ga0501069_0095231 Ga0501069_0095231_676_1275 199
410 3300049586 Ga0501070_0064531 Ga0501070_0064531_1852_2472 199
411 3300049587 Ga0501071_0011277 Ga0501071_0011277_4048_4668 199
412 3300049589 Ga0501073_0002694 Ga0501073_0002694_4606_5226 199
413 3300049592 Ga0501076_0016598 Ga0501076_0016598_3418_4038 199
414 3300049593 Ga0501077_0012798 Ga0501077_0012798_3266_3886 199
415 3300049705 Ga0501225_0002106 Ga0501225_0002106_2566_3165 199
416 3300049741 Ga0501079_0000016 Ga0501079_0000016_53157_53777 199
417 3300049742 Ga0501080_0000319 Ga0501080_0000319_3992_4612 199
418 3300049744 Ga0501083_0015178 Ga0501083_0015178_318_938 199
419 3300049758 Ga0501241_022387 Ga0501241_022387_508_1110 199
420 3300050494 nmdc:mga06z11_62275_c1 nmdc:mga06z11_62275_c1_242_841 199
421 3300050510 nmdc:mga06r32_26358_c1 nmdc:mga06r32_26358_c1_2842_3516 199
422 3300053087 Ga0500643_056086 Ga0500643_056086_277_876 199
423 3300053088 Ga0500644_0000228 Ga0500644_0000228_16318_16917 199
424 3300053094 Ga0500566_0089168 Ga0500566_0089168_219_851 199
425 3300053104 Ga0500556_0006177 Ga0500556_0006177_2370_2969 199
426 3300053108 Ga0500562_028128 Ga0500562_028128_840_1442 199
427 3300053121 Ga0500607_000052 Ga0500607_000052_15049_15699 199
428 3300053123 Ga0500614_177200 Ga0500614_177200_31_633 199
429 3300053133 Ga0500655_002963 Ga0500655_002963_1846_2445 199
430 3300053134 Ga0500658_0009388 Ga0500658_0009388_379_1005 199
431 3300053134 Ga0500658_0161825 Ga0500658_0161825_341_967 199
432 3300053136 Ga0500559_0003408 Ga0500559_0003408_819_1418 199
433 3300053138 Ga0500564_000157 Ga0500564_000157_15389_15988 199
434 3300053138 Ga0500564_021329 Ga0500564_021329_1294_1953 199
435 3300053151 Ga0500604_0019199 Ga0500604_0019199_1221_1847 199
436 3300053154 Ga0500619_010208 Ga0500619_010208_426_1025 199
437 3300053156 Ga0500622_0008175 Ga0500622_0008175_278_877 199
438 3300053156 Ga0500622_0015639 Ga0500622_0015639_1980_2579 199
439 3300053178 Ga0500637_0178320 Ga0500637_0178320_380_991 199
440 3300054114 Ga0501084_0003301 Ga0501084_0003301_1291_1911 199
441 3300060353 Ga0501082_0110085 Ga0501082_0110085_1702_2322 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

26

174

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q6n-assembly1.cif.gz_A structure of wrba from salmonella typhimurium bound to me0052 0.9758 1 197
3b6i-assembly1.cif.gz_A wrba from escherichia coli, native structure 0.9731 2 199
4la4-assembly1.cif.gz_B-2 crystal structure of native pnpb 0.9726 1 198
5f51-assembly1.cif.gz_A structure of b. abortus wrba-related protein a (apo) 0.9708 1 197
7q6m-assembly1.cif.gz_D structure of wrba from yersinia pseudotuberculosis in p1 0.9702 1 197
ID Description Score Start End Superfamily
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9654 1 199 3.40.50.360
3zhoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9635 2 199 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9607 1 199 3.40.50.360
3zhoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9582 2 199 3.40.50.360
5mp4F00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9563 3 196 3.40.50.360
ID Description Score Start End GO Terms
AF-T1CAN3-F1-model_v4 TrpR binding protein WrbA 0.9905 1 111 GO:0003955
GO:0010181
GO:0016020
AF-A0A162AC88-F1-model_v4 Flavodoxin-like domain-containing protein 0.9904 1 114 GO:0003955
GO:0010181
GO:0016020
AF-A0A059WTJ3-F1-model_v4 Putative ACR, COG1399 0.9899 1 132 GO:0003955
GO:0010181
GO:0016020
AF-A0A370NSV5-F1-model_v4 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) 0.9876 2 198 GO:0008753
GO:0009055
GO:0010181
GO:0016020
GO:0050136
GO:0050660
GO:0050661
GO:0051287
AF-H5Y7Q2-F1-model_v4 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) 0.9875 1 197 GO:0008753
GO:0010181
GO:0016020
GO:0050136
GO:0050660
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
91.65 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map