F444556

General Info

Members Datasets Scaffolds Average Seq Length
440 262 880 163

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946787523|2946787945
Length 192
Sequence KASPPTTPPKVPTTPPVATPVLQKAEKAAPRKDEVTLAVVIGAHGIGGEVRLKVFADNFGSYKSFNDGALSLKSARSGNNGMIARFAEVADRNAAEAMRGTELTVPRASLPPLEDGEYYHTDVIGLDVVSTDGEAIGRVVAIDNFGAGDVIEIERLPVDGKPGKRFMVPMRVEAVPEWDAERLVVEASFAAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
227 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
228 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
240 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
244 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
245 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
246 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
247 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
248 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
249 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
250 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
251 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
252 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
253 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
254 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
255 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
256 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
257 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
258 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
259 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
260 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
261 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
262 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.91
Bulb 0
Endosphere 19.09
Nodule 0
Rhizoplane 3.41
Rhizosphere 65.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3660127 2162886007 Bacteria 11567
2 ARcpr5oldR_c006759 3300000041 Bacteria 976
3 JGI24740J21852_10036872 3300001979 Bacteria 1514
4 JGI24739J22299_10016001 3300001989 Bacteria 2720
5 JGI24739J22299_10056395 3300001989 Bacteria 1253
6 JGI24739J22299_10068911 3300001989 Bacteria 1103
7 JGI24737J22298_10011329 3300001990 Bacteria 2924
8 JGI24735J21928_10060947 3300002067 Bacteria 1084
9 JGI24751J29686_10000235 3300002459 Bacteria 22528
10 JGI25150J39212_1000046 3300002774 Bacteria 78180
11 JGI25151J46595_10036630 3300003187 Bacteria 1849
12 JGI25153J46596_10000099 3300003215 Bacteria 100036
13 JGI25153J46596_10016306 3300003215 Bacteria 2983
14 Ga0055526_1002118 3300003771 Bacteria 13630
15 Ga0055537_1014546 3300003773 Bacteria 1425
16 Ga0055537_1021421 3300003773 Bacteria 961
17 Ga0055524_1000654 3300003775 Bacteria 24493
18 Ga0055536_1006952 3300003781 Bacteria 5152
19 Ga0055530_10000359 3300003791 Bacteria 41160
20 Ga0055540_1001341 3300003792 Bacteria 14832
21 Ga0055531_10000601 3300003794 Bacteria 31249
22 Ga0055531_10007812 3300003794 Bacteria 5759
23 Ga0055543_1027817 3300004625 Bacteria 999
24 Ga0065165_1004977 3300005262 Bacteria 7794
25 Ga0065165_1005771 3300005262 Bacteria 6777
26 Ga0065165_1037471 3300005262 Bacteria 1469
27 Ga0065165_1049330 3300005262 Bacteria 1204
28 Ga0065165_1073372 3300005262 Bacteria 904
29 Ga0065704_10000222 3300005289 Bacteria 73073
30 Ga0065707_10104231 3300005295 Bacteria 2705
31 Ga0070658_10017088 3300005327 Bacteria 5806
32 Ga0070658_10024479 3300005327 Bacteria 4843
33 Ga0070658_10046779 3300005327 Bacteria 3501
34 Ga0070658_10063002 3300005327 Bacteria 3022
35 Ga0070658_10554219 3300005327 Bacteria 995
36 Ga0070658_10568692 3300005327 Bacteria 981
37 Ga0070658_11058911 3300005327 Bacteria 705
38 Ga0070683_100047251 3300005329 Bacteria 3977
39 Ga0068869_100296467 3300005334 Bacteria 1304
40 Ga0070666_10219383 3300005335 Bacteria 1341
41 Ga0070680_100532270 3300005336 Bacteria 1006
42 Ga0070682_100382760 3300005337 Bacteria 1059
43 Ga0068868_100000011 3300005338 Bacteria 117273
44 Ga0070660_100009903 3300005339 Bacteria 6722
45 Ga0070660_100028750 3300005339 Bacteria 4161
46 Ga0070660_100082118 3300005339 Bacteria 2530
47 Ga0070661_100167299 3300005344 Bacteria 1668
48 Ga0070692_10007622 3300005345 Bacteria 4778
49 Ga0070692_10028769 3300005345 Bacteria 2765
50 Ga0070692_10035267 3300005345 Bacteria 2531
51 Ga0070669_100243302 3300005353 Bacteria 1430
52 Ga0070669_100471779 3300005353 Bacteria 1037
53 Ga0070671_100519588 3300005355 Bacteria 1025
54 Ga0070671_100612495 3300005355 Bacteria 941
55 Ga0070673_100417564 3300005364 Bacteria 1202
56 Ga0070659_100079521 3300005366 Bacteria 2617
57 Ga0070667_100000261 3300005367 Bacteria 60134
58 Ga0070663_100066739 3300005455 Bacteria 2608
59 Ga0070663_100176653 3300005455 Bacteria 1654
60 Ga0070663_101640127 3300005455 Bacteria 574
61 Ga0070707_100564541 3300005468 Bacteria 1100
62 Ga0070679_100253519 3300005530 Bacteria 1715
63 Ga0070684_100038687 3300005535 Bacteria 4099
64 Ga0068853_100235781 3300005539 Bacteria 1675
65 Ga0070665_100000319 3300005548 Bacteria 74295
66 Ga0070665_100134424 3300005548 Bacteria 2475
67 Ga0070665_101113188 3300005548 Bacteria 801
68 Ga0068855_100013984 3300005563 Bacteria 9676
69 Ga0068855_100098367 3300005563 Bacteria 3371
70 Ga0068855_100636339 3300005563 Bacteria 1147
71 Ga0068855_101908529 3300005563 Bacteria 601
72 Ga0070664_101277557 3300005564 Bacteria 693
73 Ga0068854_100146658 3300005578 Bacteria 1816
74 Ga0068854_100196707 3300005578 Bacteria 1582
75 Ga0068854_100780933 3300005578 Bacteria 831
76 Ga0068854_101546263 3300005578 Bacteria 603
77 Ga0068856_100145004 3300005614 Bacteria 2382
78 Ga0068852_100000249 3300005616 Bacteria 36603
79 Ga0068852_100308428 3300005616 Bacteria 1534
80 Ga0068852_101257945 3300005616 Bacteria 761
81 Ga0068864_100001790 3300005618 Bacteria 17627
82 Ga0068861_101140397 3300005719 Bacteria 751
83 Ga0068858_100006070 3300005842 Bacteria 11782
84 Ga0068858_100066211 3300005842 Bacteria 3344
85 Ga0068860_100373339 3300005843 Bacteria 1407
86 Ga0068860_100447047 3300005843 Bacteria 1285
87 Ga0068862_100156451 3300005844 Bacteria 2032
88 Ga0070717_10673027 3300006028 Bacteria 940
89 Ga0075362_10300605 3300006177 Bacteria 796
90 Ga0075366_10008380 3300006195 Bacteria 5743
91 Ga0075370_10241514 3300006353 Bacteria 1070
92 Ga0075370_10271964 3300006353 Bacteria 1006
93 Ga0075370_10377609 3300006353 Bacteria 849
94 Ga0068871_100938055 3300006358 Bacteria 804
95 Ga0068865_100612680 3300006881 Bacteria 921
96 Ga0105240_10012397 3300009093 Bacteria 11769
97 Ga0105240_10023568 3300009093 Bacteria 8134
98 Ga0105248_10014412 3300009177 Bacteria 8701
99 Ga0105237_10043395 3300009545 Bacteria 4529
100 Ga0105238_10423973 3300009551 Bacteria 1325
101 Ga0157373_10064725 3300013100 Bacteria 2588
102 Ga0157371_10026445 3300013102 Bacteria 4218
103 Ga0157371_10100411 3300013102 Bacteria 2052
104 Ga0157371_10490837 3300013102 Bacteria 906
105 Ga0157370_10003274 3300013104 Bacteria 19086
106 Ga0157370_10065129 3300013104 Bacteria 3448
107 Ga0157370_11150784 3300013104 Bacteria 700
108 Ga0157369_10091933 3300013105 Bacteria 3238
109 Ga0157369_10395868 3300013105 Bacteria 1433
110 Ga0157378_10057659 3300013297 Bacteria 3462
111 Ga0163162_10088524 3300013306 Bacteria 3175
112 Ga0163162_10324044 3300013306 Bacteria 1673
113 Ga0163162_10593777 3300013306 Bacteria 1234
114 Ga0157372_10209343 3300013307 Bacteria 2260
115 Ga0157372_10309101 3300013307 Bacteria 1840
116 Ga0157372_10379526 3300013307 Bacteria 1647
117 Ga0157372_10782144 3300013307 Bacteria 1109
118 Ga0163163_10274255 3300014325 Bacteria 1738
119 Ga0163163_12028935 3300014325 Bacteria 635
120 Ga0207425_1000020 3300025245 Bacteria 372623
121 Ga0209148_1000966 3300025254 Bacteria 18702
122 Ga0209565_1000008 3300025263 Bacteria 774179
123 Ga0209565_1000517 3300025263 Bacteria 27833
124 Ga0209565_1018091 3300025263 Bacteria 1531
125 Ga0209455_1000265 3300025272 Bacteria 59804
126 Ga0209673_1000984 3300025273 Bacteria 34864
127 Ga0209673_1027096 3300025273 Bacteria 1869
128 Ga0209676_1005519 3300025292 Bacteria 6572
129 Ga0209025_1000326 3300025294 Bacteria 106087
130 Ga0209564_1001114 3300025295 Bacteria 31654
131 Ga0209758_1000004 3300025297 Bacteria 1375322
132 Ga0209758_1041718 3300025297 Bacteria 1711
133 Ga0209758_1048400 3300025297 Bacteria 1512
134 Ga0209050_1000001 3300025298 Bacteria 3563507
135 Ga0209050_1000010 3300025298 Bacteria 980454
136 Ga0209050_1000119 3300025298 Bacteria 200661
137 Ga0209050_1011453 3300025298 Bacteria 4201
138 Ga0209256_1000009 3300025299 Bacteria 922071
139 Ga0209256_1000010 3300025299 Bacteria 912110
140 Ga0207426_1076361 3300025302 Bacteria 920
141 Ga0209051_1000476 3300025303 Bacteria 51944
142 Ga0209257_1000009 3300025304 Bacteria 1205047
143 Ga0209257_1001491 3300025304 Bacteria 27480
144 Ga0209257_1004025 3300025304 Bacteria 11823
145 Ga0209257_1004030 3300025304 Bacteria 11815
146 Ga0209257_1025233 3300025304 Bacteria 2036
147 Ga0207697_10165521 3300025315 Bacteria 966
148 Ga0207647_10012064 3300025904 Bacteria 6032
149 Ga0207647_10022031 3300025904 Bacteria 4240
150 Ga0207647_10237760 3300025904 Bacteria 1047
151 Ga0207705_10003397 3300025909 Bacteria 12105
152 Ga0207705_10005607 3300025909 Bacteria 9379
153 Ga0207705_10044283 3300025909 Bacteria 3198
154 Ga0207705_10053019 3300025909 Bacteria 2921
155 Ga0207705_10092633 3300025909 Bacteria 2214
156 Ga0207705_10093890 3300025909 Bacteria 2200
157 Ga0207695_10009022 3300025913 Bacteria 12397
158 Ga0207695_10045258 3300025913 Bacteria 4672
159 Ga0207657_10037530 3300025919 Bacteria 4324
160 Ga0207657_10048868 3300025919 Bacteria 3691
161 Ga0207646_10466647 3300025922 Bacteria 1139
162 Ga0207681_10313334 3300025923 Bacteria 1245
163 Ga0207681_11185099 3300025923 Bacteria 642
164 Ga0207659_10079848 3300025926 Bacteria 2415
165 Ga0207664_10101672 3300025929 Bacteria 2376
166 Ga0207644_10551064 3300025931 Bacteria 954
167 Ga0207690_10476629 3300025932 Bacteria 1007
168 Ga0207706_10553406 3300025933 Bacteria 990
169 Ga0207706_11106845 3300025933 Bacteria 662
170 Ga0207670_10293517 3300025936 Bacteria 1271
171 Ga0207669_10268185 3300025937 Bacteria 1281
172 Ga0207711_10027503 3300025941 Bacteria 4777
173 Ga0207661_10025714 3300025944 Bacteria 4478
174 Ga0207661_10326631 3300025944 Bacteria 1380
175 Ga0207667_10004725 3300025949 Bacteria 16676
176 Ga0207667_10084585 3300025949 Bacteria 3284
177 Ga0207667_11314095 3300025949 Bacteria 699
178 Ga0207651_10319581 3300025960 Bacteria 1297
179 Ga0207640_10005176 3300025981 Bacteria 7094
180 Ga0207640_10141008 3300025981 Bacteria 1757
181 Ga0207640_10796919 3300025981 Bacteria 818
182 Ga0207658_10000247 3300025986 Bacteria 56367
183 Ga0207658_11395504 3300025986 Bacteria 641
184 Ga0207677_10628404 3300026023 Bacteria 945
185 Ga0207703_10004107 3300026035 Bacteria 12018
186 Ga0207703_10122658 3300026035 Bacteria 2233
187 Ga0207639_10011965 3300026041 Bacteria 6037
188 Ga0207678_10054006 3300026067 Bacteria 3461
189 Ga0207678_10243509 3300026067 Bacteria 1540
190 Ga0207678_11411719 3300026067 Bacteria 615
191 Ga0207702_10024823 3300026078 Bacteria 4973
192 Ga0207641_10039290 3300026088 Bacteria 3957
193 Ga0207676_10000698 3300026095 Bacteria 26476
194 Ga0207674_10077656 3300026116 Bacteria 3326
195 Ga0207698_10194641 3300026142 Bacteria 1810
196 Ga0268266_10000212 3300028379 Bacteria 101029
197 Ga0268266_10068772 3300028379 Bacteria 3067
198 Ga0268266_11091994 3300028379 Bacteria 772
199 Ga0268266_11401416 3300028379 Bacteria 674
200 Ga0268264_10357547 3300028381 Bacteria 1392
201 Ga0268264_11111494 3300028381 Bacteria 799
202 Ga0307517_10012037 3300028786 Bacteria 11936
203 Ga0307508_10048378 3300031616 Bacteria 3788
204 Ga0307516_10509277 3300031730 Bacteria 858
205 Ga0307405_11131898 3300031731 Bacteria 674
206 Ga0307413_10592416 3300031824 Bacteria 906
207 Ga0307412_10005594 3300031911 Bacteria 7054
208 Ga0307412_10285723 3300031911 Bacteria 1297
209 Ga0307409_100138618 3300031995 Bacteria 2092
210 Ga0307414_10898737 3300032004 Bacteria 812
211 Ga0307411_10224473 3300032005 Bacteria 1460
212 Ga0307415_100746379 3300032126 Bacteria 888
213 Ga0307415_100937714 3300032126 Bacteria 800
214 Ga0373937_0734219 3300036401 Bacteria 935
215 Ga0316584_0494350 3300036712 Bacteria 860
216 Ga0395899_0000261 3300037312 Bacteria 69173
217 Ga0395899_0077373 3300037312 Bacteria 2426
218 Ga0395900_0000036 3300037418 Bacteria 250619
219 Ga0395900_0018921 3300037418 Bacteria 7024
220 Ga0395900_0152869 3300037418 Bacteria 2357
221 Ga0395900_0361237 3300037418 Bacteria 1423
222 Ga0395900_0619088 3300037418 Bacteria 1021
223 Ga0395898_0038482 3300037466 Bacteria 4740
224 Ga0395898_0151528 3300037466 Bacteria 2218
225 Ga0395898_1094344 3300037466 Bacteria 730
226 Ga0395898_1592673 3300037466 Bacteria 577
227 Ga0395905_0122435 3300037471 Bacteria 2445
228 Ga0395905_0122436 3300037471 Bacteria 2445
229 Ga0395905_0225050 3300037471 Bacteria 1755
230 Ga0395905_0380865 3300037471 Bacteria 1304
231 Ga0395905_0440283 3300037471 Bacteria 1200
232 Ga0395905_0649134 3300037471 Bacteria 957
233 Ga0395901_0000036 3300038443 Bacteria 214274
234 Ga0395901_0046250 3300038443 Bacteria 4520
235 Ga0395901_0136603 3300038443 Bacteria 2576
236 Ga0395901_0153715 3300038443 Bacteria 2417
237 Ga0395901_0446941 3300038443 Bacteria 1322
238 Ga0395901_1425147 3300038443 Bacteria 650
239 Ga0237819_00888 3300038705 Bacteria 9340
240 Ga0436365_0844923 3300039437 Bacteria 1098
241 Ga0439436_0031218 3300041404 Bacteria 1546
242 Ga0439439_0030302 3300041406 Bacteria 1375
243 Ga0439461_0000401 3300041410 Bacteria 6223
244 Ga0439461_0003962 3300041410 Bacteria 2457
245 Ga0439461_0056450 3300041410 Bacteria 882
246 Ga0439466_0063592 3300041411 Bacteria 1184
247 Ga0439465_0000627 3300041413 Bacteria 10744
248 Ga0439465_0005451 3300041413 Bacteria 4060
249 Ga0451802_0426601 3300041460 Bacteria 1161
250 Ga0451806_485393 3300041462 Bacteria 1506
251 Ga0451807_0311261 3300041486 Bacteria 527
252 Ga0451807_2091825 3300041486 Bacteria 2076
253 Ga0451807_2184805 3300041486 Bacteria 868
254 Ga0451807_2273132 3300041486 Bacteria 787
255 Ga0451833_0261071 3300041491 Bacteria 677
256 Ga0451845_0466150 3300041501 Bacteria 678
257 Ga0451849_0497525 3300041505 Bacteria 820
258 Ga0439431_0001201 3300041997 Bacteria 5677
259 Ga0439431_0006211 3300041997 Bacteria 2637
260 Ga0439433_0083331 3300041999 Bacteria 780
261 Ga0439442_001095 3300042002 Bacteria 5447
262 Ga0439445_0003076 3300042004 Bacteria 3735
263 Ga0439445_0034898 3300042004 Bacteria 1319
264 Ga0439445_0057555 3300042004 Bacteria 1058
265 Ga0439448_0001613 3300042005 Bacteria 5914
266 Ga0439432_003876 3300042006 Bacteria 5510
267 Ga0439432_048601 3300042006 Bacteria 1328
268 Ga0439432_050917 3300042006 Bacteria 1292
269 Ga0439449_0029904 3300042007 Bacteria 2030
270 Ga0439452_015418 3300042010 Bacteria 2098
271 Ga0439452_090540 3300042010 Bacteria 661
272 Ga0439455_0000665 3300042012 Bacteria 5048
273 Ga0439457_084332 3300042014 Bacteria 732
274 Ga0439462_0005700 3300042015 Bacteria 3076
275 Ga0450919_010509 3300042121 Bacteria 1057
276 Ga0439434_0000154 3300042435 Bacteria 18366
277 Ga0439434_0015895 3300042435 Bacteria 2245
278 Ga0451577_1021248 3300042876 Bacteria 742
279 Ga0466966_0250358 3300044684 Bacteria 1067
280 Ga0466964_0059227 3300044706 Bacteria 1590
281 Ga0466957_0290505 3300044842 Bacteria 1096
282 Ga0466957_0438841 3300044842 Bacteria 898
283 Ga0466958_0251130 3300045836 Bacteria 1131
284 Ga0495627_001263 3300046453 Bacteria 15596
285 Ga0495627_024433 3300046453 Bacteria 1970
286 Ga0495638_0026431 3300046460 Bacteria 3761
287 Ga0495638_0165618 3300046460 Bacteria 1272
288 Ga0495650_0004264 3300046471 Bacteria 9884
289 Ga0495650_0028660 3300046471 Bacteria 2551
290 Ga0495605_0080975 3300046474 Bacteria 1519
291 Ga0495639_0276285 3300046475 Bacteria 834
292 Ga0495596_0001235 3300046500 Bacteria 14901
293 Ga0495596_0009693 3300046500 Bacteria 4229
294 Ga0495607_0089883 3300046501 Bacteria 1666
295 Ga0495607_0173419 3300046501 Bacteria 1087
296 Ga0495583_0000138 3300046506 Bacteria 123486
297 Ga0495583_0014330 3300046506 Bacteria 4379
298 Ga0495583_0029868 3300046506 Bacteria 2662
299 Ga0495606_0013819 3300046507 Bacteria 6346
300 Ga0495606_0125507 3300046507 Bacteria 1531
301 Ga0495610_0000020 3300046512 Bacteria 344007
302 Ga0495610_0000436 3300046512 Bacteria 42966
303 Ga0495610_0007293 3300046512 Bacteria 7400
304 Ga0495620_0014254 3300046515 Bacteria 4045
305 Ga0495632_0002246 3300046519 Bacteria 14875
306 Ga0495632_0077765 3300046519 Bacteria 1586
307 Ga0495643_0000351 3300046522 Bacteria 62687
308 Ga0495643_0027117 3300046522 Bacteria 3223
309 Ga0495643_0094771 3300046522 Bacteria 1536
310 Ga0495643_0193572 3300046522 Bacteria 980
311 Ga0495654_0022730 3300046530 Bacteria 3252
312 Ga0495654_0038036 3300046530 Bacteria 2408
313 Ga0495654_0042153 3300046530 Bacteria 2267
314 Ga0495609_0008810 3300046538 Bacteria 4910
315 Ga0495609_0277302 3300046538 Bacteria 686
316 Ga0495597_0209764 3300046542 Bacteria 777
317 Ga0495668_0129885 3300046616 Bacteria 1379
318 Ga0495625_0000332 3300046660 Bacteria 71947
319 Ga0495625_0006478 3300046660 Bacteria 10407
320 Ga0495625_0081849 3300046660 Bacteria 2246
321 Ga0495625_0152175 3300046660 Bacteria 1555
322 Ga0495661_0358817 3300046665 Bacteria 716
323 Ga0495670_0000007 3300046691 Bacteria 247088
324 Ga0495670_0134301 3300046691 Bacteria 1291
325 Ga0495670_0195865 3300046691 Bacteria 1069
326 Ga0495671_0318455 3300046692 Bacteria 747
327 Ga0495671_0596311 3300046692 Bacteria 525
328 Ga0495649_0048221 3300046694 Bacteria 2315
329 Ga0495649_0127086 3300046694 Bacteria 1346
330 Ga0495673_0060991 3300047469 Bacteria 1616
331 Ga0495681_0000052 3300047470 Bacteria 106939
332 Ga0495681_0248961 3300047470 Bacteria 702
333 Ga0495686_0000137 3300047472 Bacteria 148290
334 Ga0495686_0009797 3300047472 Bacteria 6875
335 Ga0495686_0247764 3300047472 Bacteria 1002
336 Ga0495686_0260303 3300047472 Bacteria 971
337 Ga0495593_0313566 3300047673 Bacteria 784
338 Ga0495615_0000161 3300048090 Bacteria 17005
339 Ga0495626_0001891 3300048091 Bacteria 15640
340 Ga0496100_0260769 3300048903 Bacteria 1285
341 Ga0496101_0170881 3300048904 Bacteria 1671
342 Ga0496102_0018645 3300048905 Bacteria 6102
343 Ga0496103_0000372 3300048906 Bacteria 40272
344 Ga0496108_0000974 3300048911 Bacteria 22322
345 Ga0496109_1563996 3300048912 Bacteria 594
346 Ga0496110_0710990 3300048913 Bacteria 907
347 Ga0496115_0013578 3300048918 Bacteria 6163
348 Ga0496116_0000035 3300048919 Bacteria 402424
349 Ga0496116_0001243 3300048919 Bacteria 29596
350 Ga0496117_0002288 3300048920 Bacteria 24709
351 Ga0496117_0075769 3300048920 Bacteria 2233
352 Ga0496117_0142888 3300048920 Bacteria 1430
353 Ga0496118_0000097 3300048921 Bacteria 160837
354 Ga0496119_0041785 3300048922 Bacteria 2915
355 Ga0496119_0292856 3300048922 Bacteria 805
356 Ga0496121_0000529 3300048924 Bacteria 72533
357 Ga0496121_0004707 3300048924 Bacteria 18061
358 Ga0496122_0012103 3300048925 Bacteria 8640
359 Ga0496122_0012922 3300048925 Bacteria 8243
360 Ga0496122_0030042 3300048925 Bacteria 4564
361 Ga0496122_0043758 3300048925 Bacteria 3504
362 Ga0496123_0009769 3300048926 Bacteria 8575
363 Ga0496123_0014492 3300048926 Bacteria 6530
364 Ga0496123_0016411 3300048926 Bacteria 6017
365 Ga0496124_0000175 3300048927 Bacteria 128785
366 Ga0496124_0001077 3300048927 Bacteria 43137
367 Ga0496124_0001397 3300048927 Bacteria 36152
368 Ga0496124_0020916 3300048927 Bacteria 6036
369 Ga0496124_0028126 3300048927 Bacteria 5032
370 Ga0496124_0032604 3300048927 Bacteria 4597
371 Ga0496124_0075447 3300048927 Bacteria 2785
372 Ga0496124_0109574 3300048927 Bacteria 2225
373 Ga0496124_0336382 3300048927 Bacteria 1074
374 Ga0496125_0011588 3300048928 Bacteria 8808
375 Ga0496125_0052748 3300048928 Bacteria 3342
376 Ga0496125_0064270 3300048928 Bacteria 2917
377 Ga0496126_0000084 3300048929 Bacteria 217111
378 Ga0496126_0018207 3300048929 Bacteria 6970
379 Ga0496126_0559123 3300048929 Bacteria 907
380 Ga0501036_0682492 3300049572 Bacteria 849
381 Ga0501047_0409755 3300049581 Bacteria 1188
382 Ga0501047_0502509 3300049581 Bacteria 1039
383 Ga0501067_0029365 3300049583 Bacteria 3047
384 Ga0501073_1284843 3300049589 Bacteria 502
385 Ga0501080_0606768 3300049742 Bacteria 971
386 Ga0501044_0000645 3300049823 Bacteria 42153
387 nmdc:mga03683_262422_c1 3300050489 Bacteria 804
388 nmdc:mga0k408_22208_c1 3300050493 Bacteria 3572
389 nmdc:mga0k408_245502_c1 3300050493 Bacteria 1069
390 nmdc:mga07m45_273715_c1 3300050496 Bacteria 982
391 nmdc:mga07m45_383134_c1 3300050496 Bacteria 816
392 nmdc:mga07m45_440957_c1 3300050496 Bacteria 755
393 nmdc:mga07m45_88712_c1 3300050496 Bacteria 1770
394 Ga0500643_008899 3300053087 Bacteria 3893
395 Ga0500646_0055965 3300053090 Bacteria 1149
396 Ga0500646_0070768 3300053090 Bacteria 1046
397 Ga0500647_0033512 3300053091 Bacteria 2450
398 Ga0500566_0009957 3300053094 Bacteria 5611
399 Ga0500641_0006979 3300053096 Bacteria 4020
400 Ga0500555_000408 3300053103 Bacteria 17901
401 Ga0500595_003562 3300053119 Bacteria 7231
402 Ga0500597_087403 3300053120 Bacteria 1353
403 Ga0500608_001275 3300053122 Bacteria 8977
404 Ga0500614_116540 3300053123 Bacteria 783
405 Ga0500652_225984 3300053131 Bacteria 751
406 Ga0500658_0007532 3300053134 Bacteria 4024
407 Ga0500559_0024071 3300053136 Bacteria 2588
408 Ga0500568_0003001 3300053139 Bacteria 9652
409 Ga0500568_0007579 3300053139 Bacteria 5311
410 Ga0500573_0107862 3300053140 Bacteria 1561
411 Ga0500577_0484836 3300053142 Bacteria 540
412 Ga0500604_0000112 3300053151 Bacteria 24965
413 Ga0500616_0000261 3300053153 Bacteria 80995
414 Ga0500616_0045169 3300053153 Bacteria 2348
415 Ga0500624_000001 3300053157 Bacteria 284974
416 Ga0500637_0000156 3300053178 Bacteria 24981
417 Ga0500567_009501 3300053723 Bacteria 4636
418 Ga0500625_000041 3300053729 Bacteria 35224
419 Ga0500645_018899 3300053730 Bacteria 2147
420 Ga0466962_0100053 3300061719 Bacteria 1392
421 2946787945 2946787523 Bacteria 4366789
422 2511126173 2510917021 Bacteria 5705459
423 2600224935 2599185359 Bacteria 4772316
424 2644128876 2643221622 Bacteria 4212502
425 2739650382 2739367664 Bacteria 4114334
426 2740028855 2739367865 Bacteria 4114482
427 2819552675 2818991438 Bacteria 5793701
428 2819713179 2818991466 Bacteria 4748179
429 2848299128 2848297114 Bacteria 3608511
430 2879166629 2879163058 Bacteria 4223965
431 2885429738 2885429604 Bacteria 3642894
432 2919141159 2919138771 Bacteria 5281312
433 2928030939 2928027323 Bacteria 4382488
434 2928527719 2928526807 Bacteria 4760224
435 2928971648 2928968154 Bacteria 4633371
436 2984557696 2984555340 Bacteria 4247089
437 2990266290 2990265787 Bacteria 3943888
438 2993358986 2993356040 Bacteria 4247105
439 2993695917 2993693658 Bacteria 4040749
440 8057103322 8057101203 Bacteria 5034064
441 SwRhRL2b_contig_3660127
442 ARcpr5oldR_c006759
443 JGI24740J21852_10036872
444 JGI24739J22299_10016001
445 JGI24739J22299_10056395
446 JGI24739J22299_10068911
447 JGI24737J22298_10011329
448 JGI24735J21928_10060947
449 JGI24751J29686_10000235
450 JGI25150J39212_1000046
451 JGI25151J46595_10036630
452 JGI25153J46596_10000099
453 JGI25153J46596_10016306
454 Ga0055526_1002118
455 Ga0055537_1014546
456 Ga0055537_1021421
457 Ga0055524_1000654
458 Ga0055536_1006952
459 Ga0055530_10000359
460 Ga0055540_1001341
461 Ga0055531_10000601
462 Ga0055531_10007812
463 Ga0055543_1027817
464 Ga0065165_1004977
465 Ga0065165_1005771
466 Ga0065165_1037471
467 Ga0065165_1049330
468 Ga0065165_1073372
469 Ga0065704_10000222
470 Ga0065707_10104231
471 Ga0070658_10017088
472 Ga0070658_10024479
473 Ga0070658_10046779
474 Ga0070658_10063002
475 Ga0070658_10554219
476 Ga0070658_10568692
477 Ga0070658_11058911
478 Ga0070683_100047251
479 Ga0068869_100296467
480 Ga0070666_10219383
481 Ga0070680_100532270
482 Ga0070682_100382760
483 Ga0068868_100000011
484 Ga0070660_100009903
485 Ga0070660_100028750
486 Ga0070660_100082118
487 Ga0070661_100167299
488 Ga0070692_10007622
489 Ga0070692_10028769
490 Ga0070692_10035267
491 Ga0070669_100243302
492 Ga0070669_100471779
493 Ga0070671_100519588
494 Ga0070671_100612495
495 Ga0070673_100417564
496 Ga0070659_100079521
497 Ga0070667_100000261
498 Ga0070663_100066739
499 Ga0070663_100176653
500 Ga0070663_101640127
501 Ga0070707_100564541
502 Ga0070679_100253519
503 Ga0070684_100038687
504 Ga0068853_100235781
505 Ga0070665_100000319
506 Ga0070665_100134424
507 Ga0070665_101113188
508 Ga0068855_100013984
509 Ga0068855_100098367
510 Ga0068855_100636339
511 Ga0068855_101908529
512 Ga0070664_101277557
513 Ga0068854_100146658
514 Ga0068854_100196707
515 Ga0068854_100780933
516 Ga0068854_101546263
517 Ga0068856_100145004
518 Ga0068852_100000249
519 Ga0068852_100308428
520 Ga0068852_101257945
521 Ga0068864_100001790
522 Ga0068861_101140397
523 Ga0068858_100006070
524 Ga0068858_100066211
525 Ga0068860_100373339
526 Ga0068860_100447047
527 Ga0068862_100156451
528 Ga0070717_10673027
529 Ga0075362_10300605
530 Ga0075366_10008380
531 Ga0075370_10241514
532 Ga0075370_10271964
533 Ga0075370_10377609
534 Ga0068871_100938055
535 Ga0068865_100612680
536 Ga0105240_10012397
537 Ga0105240_10023568
538 Ga0105248_10014412
539 Ga0105237_10043395
540 Ga0105238_10423973
541 Ga0157373_10064725
542 Ga0157371_10026445
543 Ga0157371_10100411
544 Ga0157371_10490837
545 Ga0157370_10003274
546 Ga0157370_10065129
547 Ga0157370_11150784
548 Ga0157369_10091933
549 Ga0157369_10395868
550 Ga0157378_10057659
551 Ga0163162_10088524
552 Ga0163162_10324044
553 Ga0163162_10593777
554 Ga0157372_10209343
555 Ga0157372_10309101
556 Ga0157372_10379526
557 Ga0157372_10782144
558 Ga0163163_10274255
559 Ga0163163_12028935
560 Ga0207425_1000020
561 Ga0209148_1000966
562 Ga0209565_1000008
563 Ga0209565_1000517
564 Ga0209565_1018091
565 Ga0209455_1000265
566 Ga0209673_1000984
567 Ga0209673_1027096
568 Ga0209676_1005519
569 Ga0209025_1000326
570 Ga0209564_1001114
571 Ga0209758_1000004
572 Ga0209758_1041718
573 Ga0209758_1048400
574 Ga0209050_1000001
575 Ga0209050_1000010
576 Ga0209050_1000119
577 Ga0209050_1011453
578 Ga0209256_1000009
579 Ga0209256_1000010
580 Ga0207426_1076361
581 Ga0209051_1000476
582 Ga0209257_1000009
583 Ga0209257_1001491
584 Ga0209257_1004025
585 Ga0209257_1004030
586 Ga0209257_1025233
587 Ga0207697_10165521
588 Ga0207647_10012064
589 Ga0207647_10022031
590 Ga0207647_10237760
591 Ga0207705_10003397
592 Ga0207705_10005607
593 Ga0207705_10044283
594 Ga0207705_10053019
595 Ga0207705_10092633
596 Ga0207705_10093890
597 Ga0207695_10009022
598 Ga0207695_10045258
599 Ga0207657_10037530
600 Ga0207657_10048868
601 Ga0207646_10466647
602 Ga0207681_10313334
603 Ga0207681_11185099
604 Ga0207659_10079848
605 Ga0207664_10101672
606 Ga0207644_10551064
607 Ga0207690_10476629
608 Ga0207706_10553406
609 Ga0207706_11106845
610 Ga0207670_10293517
611 Ga0207669_10268185
612 Ga0207711_10027503
613 Ga0207661_10025714
614 Ga0207661_10326631
615 Ga0207667_10004725
616 Ga0207667_10084585
617 Ga0207667_11314095
618 Ga0207651_10319581
619 Ga0207640_10005176
620 Ga0207640_10141008
621 Ga0207640_10796919
622 Ga0207658_10000247
623 Ga0207658_11395504
624 Ga0207677_10628404
625 Ga0207703_10004107
626 Ga0207703_10122658
627 Ga0207639_10011965
628 Ga0207678_10054006
629 Ga0207678_10243509
630 Ga0207678_11411719
631 Ga0207702_10024823
632 Ga0207641_10039290
633 Ga0207676_10000698
634 Ga0207674_10077656
635 Ga0207698_10194641
636 Ga0268266_10000212
637 Ga0268266_10068772
638 Ga0268266_11091994
639 Ga0268266_11401416
640 Ga0268264_10357547
641 Ga0268264_11111494
642 Ga0307517_10012037
643 Ga0307508_10048378
644 Ga0307516_10509277
645 Ga0307405_11131898
646 Ga0307413_10592416
647 Ga0307412_10005594
648 Ga0307412_10285723
649 Ga0307409_100138618
650 Ga0307414_10898737
651 Ga0307411_10224473
652 Ga0307415_100746379
653 Ga0307415_100937714
654 Ga0373937_0734219
655 Ga0316584_0494350
656 Ga0395899_0000261
657 Ga0395899_0077373
658 Ga0395900_0000036
659 Ga0395900_0018921
660 Ga0395900_0152869
661 Ga0395900_0361237
662 Ga0395900_0619088
663 Ga0395898_0038482
664 Ga0395898_0151528
665 Ga0395898_1094344
666 Ga0395898_1592673
667 Ga0395905_0122435
668 Ga0395905_0122436
669 Ga0395905_0225050
670 Ga0395905_0380865
671 Ga0395905_0440283
672 Ga0395905_0649134
673 Ga0395901_0000036
674 Ga0395901_0046250
675 Ga0395901_0136603
676 Ga0395901_0153715
677 Ga0395901_0446941
678 Ga0395901_1425147
679 Ga0237819_00888
680 Ga0436365_0844923
681 Ga0439436_0031218
682 Ga0439439_0030302
683 Ga0439461_0000401
684 Ga0439461_0003962
685 Ga0439461_0056450
686 Ga0439466_0063592
687 Ga0439465_0000627
688 Ga0439465_0005451
689 Ga0451802_0426601
690 Ga0451806_485393
691 Ga0451807_0311261
692 Ga0451807_2091825
693 Ga0451807_2184805
694 Ga0451807_2273132
695 Ga0451833_0261071
696 Ga0451845_0466150
697 Ga0451849_0497525
698 Ga0439431_0001201
699 Ga0439431_0006211
700 Ga0439433_0083331
701 Ga0439442_001095
702 Ga0439445_0003076
703 Ga0439445_0034898
704 Ga0439445_0057555
705 Ga0439448_0001613
706 Ga0439432_003876
707 Ga0439432_048601
708 Ga0439432_050917
709 Ga0439449_0029904
710 Ga0439452_015418
711 Ga0439452_090540
712 Ga0439455_0000665
713 Ga0439457_084332
714 Ga0439462_0005700
715 Ga0450919_010509
716 Ga0439434_0000154
717 Ga0439434_0015895
718 Ga0451577_1021248
719 Ga0466966_0250358
720 Ga0466964_0059227
721 Ga0466957_0290505
722 Ga0466957_0438841
723 Ga0466958_0251130
724 Ga0495627_001263
725 Ga0495627_024433
726 Ga0495638_0026431
727 Ga0495638_0165618
728 Ga0495650_0004264
729 Ga0495650_0028660
730 Ga0495605_0080975
731 Ga0495639_0276285
732 Ga0495596_0001235
733 Ga0495596_0009693
734 Ga0495607_0089883
735 Ga0495607_0173419
736 Ga0495583_0000138
737 Ga0495583_0014330
738 Ga0495583_0029868
739 Ga0495606_0013819
740 Ga0495606_0125507
741 Ga0495610_0000020
742 Ga0495610_0000436
743 Ga0495610_0007293
744 Ga0495620_0014254
745 Ga0495632_0002246
746 Ga0495632_0077765
747 Ga0495643_0000351
748 Ga0495643_0027117
749 Ga0495643_0094771
750 Ga0495643_0193572
751 Ga0495654_0022730
752 Ga0495654_0038036
753 Ga0495654_0042153
754 Ga0495609_0008810
755 Ga0495609_0277302
756 Ga0495597_0209764
757 Ga0495668_0129885
758 Ga0495625_0000332
759 Ga0495625_0006478
760 Ga0495625_0081849
761 Ga0495625_0152175
762 Ga0495661_0358817
763 Ga0495670_0000007
764 Ga0495670_0134301
765 Ga0495670_0195865
766 Ga0495671_0318455
767 Ga0495671_0596311
768 Ga0495649_0048221
769 Ga0495649_0127086
770 Ga0495673_0060991
771 Ga0495681_0000052
772 Ga0495681_0248961
773 Ga0495686_0000137
774 Ga0495686_0009797
775 Ga0495686_0247764
776 Ga0495686_0260303
777 Ga0495593_0313566
778 Ga0495615_0000161
779 Ga0495626_0001891
780 Ga0496100_0260769
781 Ga0496101_0170881
782 Ga0496102_0018645
783 Ga0496103_0000372
784 Ga0496108_0000974
785 Ga0496109_1563996
786 Ga0496110_0710990
787 Ga0496115_0013578
788 Ga0496116_0000035
789 Ga0496116_0001243
790 Ga0496117_0002288
791 Ga0496117_0075769
792 Ga0496117_0142888
793 Ga0496118_0000097
794 Ga0496119_0041785
795 Ga0496119_0292856
796 Ga0496121_0000529
797 Ga0496121_0004707
798 Ga0496122_0012103
799 Ga0496122_0012922
800 Ga0496122_0030042
801 Ga0496122_0043758
802 Ga0496123_0009769
803 Ga0496123_0014492
804 Ga0496123_0016411
805 Ga0496124_0000175
806 Ga0496124_0001077
807 Ga0496124_0001397
808 Ga0496124_0020916
809 Ga0496124_0028126
810 Ga0496124_0032604
811 Ga0496124_0075447
812 Ga0496124_0109574
813 Ga0496124_0336382
814 Ga0496125_0011588
815 Ga0496125_0052748
816 Ga0496125_0064270
817 Ga0496126_0000084
818 Ga0496126_0018207
819 Ga0496126_0559123
820 Ga0501036_0682492
821 Ga0501047_0409755
822 Ga0501047_0502509
823 Ga0501067_0029365
824 Ga0501073_1284843
825 Ga0501080_0606768
826 Ga0501044_0000645
827 nmdc:mga03683_262422_c1
828 nmdc:mga0k408_22208_c1
829 nmdc:mga0k408_245502_c1
830 nmdc:mga07m45_273715_c1
831 nmdc:mga07m45_383134_c1
832 nmdc:mga07m45_440957_c1
833 nmdc:mga07m45_88712_c1
834 Ga0500643_008899
835 Ga0500646_0055965
836 Ga0500646_0070768
837 Ga0500647_0033512
838 Ga0500566_0009957
839 Ga0500641_0006979
840 Ga0500555_000408
841 Ga0500595_003562
842 Ga0500597_087403
843 Ga0500608_001275
844 Ga0500614_116540
845 Ga0500652_225984
846 Ga0500658_0007532
847 Ga0500559_0024071
848 Ga0500568_0003001
849 Ga0500568_0007579
850 Ga0500573_0107862
851 Ga0500577_0484836
852 Ga0500604_0000112
853 Ga0500616_0000261
854 Ga0500616_0045169
855 Ga0500624_000001
856 Ga0500637_0000156
857 Ga0500567_009501
858 Ga0500625_000041
859 Ga0500645_018899
860 Ga0466962_0100053
861 2946787945
862 2511126173
863 2600224935
864 2644128876
865 2739650382
866 2740028855
867 2819552675
868 2819713179
869 2848299128
870 2879166629
871 2885429738
872 2919141159
873 2928030939
874 2928527719
875 2928971648
876 2984557696
877 2990266290
878 2993358986
879 2993695917
880 8057103322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

36

109

0.91

PF05239

PRC

PRC-barrel domain

115

187

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.7913 5 90
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7869 5 167
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7826 5 167
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.7752 5 90
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7402 89 169
ID Description Score Start End Superfamily
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9103 90 161 2.30.30.240
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8867 5 88 2.40.30.60
3a1pC02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8865 90 161 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8801 89 161 2.30.30.240
af_Q8IJ86_392_490_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8645 6 87 2.40.30.60
ID Description Score Start End GO Terms
AF-A0A520FBT1-F1-model_v4 deleted 0.942 94 166
AF-A0A520FBT1-F1-model_v4 deleted 0.9063 94 166
AF-A0A7W7ADM9-F1-model_v4 Ribosome maturation factor RimM 0.8903 3 167 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A6J4BUI0-F1-model_v4 Ribosome maturation factor RimM 0.8881 28 168 GO:0005737
GO:0005840
GO:0006364
GO:0043022
AF-A0A7W7ADM9-F1-model_v4 Ribosome maturation factor RimM 0.8802 3 167 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Map