F444302

General Info

Members Datasets Scaffolds Average Seq Length
439 252 439 139

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0449303|Ga0501071_0449303_407_913
Length 168
Sequence MSISSALFDESLEGDRGSPDNGWRNSMHVEPYLFFEGRCEEAVEFYRKALGAEVLALMRYKDSPEPAPPGKLPPGSENKVMHSLLRIGDTTLMASDGLAQGRPSFQGFSLSITVPDETRAEKVFTALADGGQIHMPLAKTFWSPRFGMVADRFGVGWMINVREGGSDR

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
233 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.71
Nodule 0
Rhizoplane 0.91
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1003780 3300002705 Bacteria 4827
2 JGI25156J39149_1004103 3300002705 Bacteria 4530
3 JGI25162J39368_1000273 3300002737 Bacteria 49838
4 JGI25154J39366_1004264 3300002738 Bacteria 2619
5 JGI25157J39369_1001033 3300002741 Bacteria 12779
6 JGI25157J39369_1002480 3300002741 Bacteria 4530
7 JGI25164J39214_1000004 3300002772 Bacteria 350814
8 JGI25165J46597_1000110 3300003214 Bacteria 148234
9 Ga0055539_1016469 3300003752 Bacteria 896
10 Ga0055533_1000893 3300003756 Bacteria 8992
11 Ga0055525_1000306 3300003759 Bacteria 40206
12 Ga0055527_1000060 3300003760 Bacteria 92147
13 Ga0055527_1000099 3300003760 Bacteria 65504
14 Ga0055527_1008497 3300003760 Bacteria 1224
15 Ga0055535_1000176 3300003761 Bacteria 68521
16 Ga0055535_1000190 3300003761 Bacteria 65500
17 Ga0055535_1000412 3300003761 Bacteria 40225
18 Ga0055535_1000480 3300003761 Bacteria 36096
19 Ga0055542_1000148 3300003762 Bacteria 88393
20 Ga0055542_1000171 3300003762 Bacteria 80629
21 Ga0055542_1000218 3300003762 Bacteria 69908
22 Ga0055542_1000498 3300003762 Bacteria 36096
23 Ga0055529_1000092 3300003763 Bacteria 137763
24 Ga0055529_1000174 3300003763 Bacteria 88393
25 Ga0055529_1000388 3300003763 Bacteria 47502
26 Ga0065715_10135553 3300005293 Bacteria 1936
27 Ga0065707_10340755 3300005295 Bacteria 924
28 Ga0065707_10467095 3300005295 Bacteria 785
29 Ga0065707_10667661 3300005295 Bacteria 655
30 Ga0070676_10069323 3300005328 Bacteria 2113
31 Ga0070690_100003131 3300005330 Bacteria 9007
32 Ga0070670_100189578 3300005331 Bacteria 1786
33 Ga0070677_10220476 3300005333 Unclassified 926
34 Ga0068869_100017527 3300005334 Bacteria 4855
35 Ga0068869_100076864 3300005334 Bacteria 2482
36 Ga0070666_10716573 3300005335 Bacteria 734
37 Ga0070680_100449915 3300005336 Bacteria 1100
38 Ga0070682_100346801 3300005337 Bacteria 1106
39 Ga0068868_100011157 3300005338 Bacteria 6543
40 Ga0068868_100653292 3300005338 Bacteria 937
41 Ga0070689_100002770 3300005340 Bacteria 11501
42 Ga0070691_10053401 3300005341 Bacteria 1933
43 Ga0070691_10668905 3300005341 Unclassified 620
44 Ga0070687_100030158 3300005343 Bacteria 2649
45 Ga0070692_10073040 3300005345 Bacteria 1832
46 Ga0070668_100001893 3300005347 Bacteria 15297
47 Ga0070668_100214129 3300005347 Bacteria 1586
48 Ga0070675_101607630 3300005354 Unclassified 600
49 Ga0070671_100557687 3300005355 Bacteria 988
50 Ga0070674_100466011 3300005356 Bacteria 1046
51 Ga0070688_100476269 3300005365 Bacteria 938
52 Ga0070659_100397411 3300005366 Bacteria 1163
53 Ga0070667_100011832 3300005367 Bacteria 7214
54 Ga0070667_100464344 3300005367 Bacteria 1158
55 Ga0070714_100010824 3300005435 Bacteria 7224
56 Ga0070701_10000237 3300005438 Bacteria 17648
57 Ga0070705_100029997 3300005440 Bacteria 2999
58 Ga0070700_100156656 3300005441 Bacteria 1563
59 Ga0070694_100052546 3300005444 Bacteria 2755
60 Ga0070694_101079652 3300005444 Bacteria 669
61 Ga0070708_100399487 3300005445 Bacteria 1296
62 Ga0070678_100021263 3300005456 Bacteria 4275
63 Ga0070678_100137798 3300005456 Bacteria 1948
64 Ga0070678_100205905 3300005456 Unclassified 1627
65 Ga0070662_100709841 3300005457 Unclassified 851
66 Ga0070681_10001344 3300005458 Bacteria 21461
67 Ga0070681_11585848 3300005458 Bacteria 580
68 Ga0068867_100278132 3300005459 Bacteria 1372
69 Ga0068867_101423083 3300005459 Bacteria 643
70 Ga0070706_100023139 3300005467 Bacteria 5722
71 Ga0070706_100999901 3300005467 Bacteria 771
72 Ga0070707_100208599 3300005468 Bacteria 1904
73 Ga0070698_101153588 3300005471 Bacteria 724
74 Ga0070698_101570539 3300005471 Bacteria 610
75 Ga0070699_100244048 3300005518 Bacteria 1604
76 Ga0070699_100649197 3300005518 Bacteria 963
77 Ga0070699_101097932 3300005518 Bacteria 730
78 Ga0070699_101617786 3300005518 Bacteria 593
79 Ga0070697_100094922 3300005536 Bacteria 2472
80 Ga0070697_100554429 3300005536 Bacteria 1008
81 Ga0068853_100173482 3300005539 Bacteria 1952
82 Ga0068853_100262935 3300005539 Bacteria 1587
83 Ga0070672_100339641 3300005543 Bacteria 1279
84 Ga0070686_100016222 3300005544 Bacteria 4329
85 Ga0070695_100035223 3300005545 Bacteria 3144
86 Ga0070696_100068002 3300005546 Bacteria 2500
87 Ga0070696_100099686 3300005546 Unclassified 2080
88 Ga0070696_101632972 3300005546 Bacteria 554
89 Ga0070693_100052490 3300005547 Bacteria 2338
90 Ga0070665_101292082 3300005548 Unclassified 740
91 Ga0070704_100166634 3300005549 Bacteria 1748
92 Ga0070704_100680532 3300005549 Bacteria 911
93 Ga0070704_101167322 3300005549 Bacteria 701
94 Ga0068855_100605079 3300005563 Bacteria 1181
95 Ga0070664_100992089 3300005564 Bacteria 789
96 Ga0068856_100000597 3300005614 Bacteria 39489
97 Ga0070702_100042204 3300005615 Bacteria 2563
98 Ga0070702_101238503 3300005615 Bacteria 603
99 Ga0068859_100048323 3300005617 Bacteria 4274
100 Ga0068859_100135765 3300005617 Bacteria 2533
101 Ga0068859_101427552 3300005617 Bacteria 764
102 Ga0068864_100089501 3300005618 Bacteria 2712
103 Ga0068866_10000969 3300005718 Bacteria 12617
104 Ga0068861_100061073 3300005719 Bacteria 2891
105 Ga0068861_101284950 3300005719 Bacteria 711
106 Ga0068870_10102867 3300005840 Bacteria 1618
107 Ga0068870_10680097 3300005840 Bacteria 708
108 Ga0068863_100025068 3300005841 Bacteria 5688
109 Ga0068858_100020569 3300005842 Bacteria 6166
110 Ga0068858_100043817 3300005842 Bacteria 4148
111 Ga0068860_100094977 3300005843 Bacteria 2842
112 Ga0068860_100785908 3300005843 Bacteria 965
113 Ga0068862_100256974 3300005844 Bacteria 1593
114 Ga0081538_10011348 3300005981 Bacteria 7224
115 Ga0081538_10139068 3300005981 Bacteria 1124
116 Ga0070717_10200878 3300006028 Bacteria 1746
117 Ga0070717_11031318 3300006028 Unclassified 749
118 Ga0070716_100867106 3300006173 Bacteria 704
119 Ga0070712_100187824 3300006175 Bacteria 1615
120 Ga0097621_100008730 3300006237 Bacteria 7321
121 Ga0097621_100356004 3300006237 Bacteria 1303
122 Ga0068871_100021911 3300006358 Bacteria 4920
123 Ga0068871_100223451 3300006358 Bacteria 1632
124 Ga0075428_100465484 3300006844 Bacteria 1353
125 Ga0075428_100746090 3300006844 Bacteria 1042
126 Ga0075433_10001741 3300006852 Bacteria 16243
127 Ga0075433_10039912 3300006852 Bacteria 4061
128 Ga0075433_10059137 3300006852 Bacteria 3353
129 Ga0075433_11146551 3300006852 Unclassified 675
130 Ga0075434_100043473 3300006871 Bacteria 4456
131 Ga0075434_100054599 3300006871 Bacteria 3969
132 Ga0075434_100181307 3300006871 Bacteria 2126
133 Ga0075434_100277619 3300006871 Bacteria 1695
134 Ga0068865_100013040 3300006881 Bacteria 5242
135 Ga0068865_101637407 3300006881 Unclassified 579
136 Ga0075436_100022957 3300006914 Bacteria 4286
137 Ga0075436_100432376 3300006914 Bacteria 957
138 Ga0097620_100048323 3300006931 Bacteria 4274
139 Ga0097620_100135769 3300006931 Bacteria 2533
140 Ga0075435_100187599 3300007076 Bacteria 1749
141 Ga0099794_10124631 3300007265 Unclassified 1298
142 Ga0105240_10002014 3300009093 Bacteria 33505
143 Ga0105240_10686938 3300009093 Bacteria 1118
144 Ga0111539_10008085 3300009094 Bacteria 13406
145 Ga0111539_10178971 3300009094 Bacteria 2477
146 Ga0111539_10231158 3300009094 Unclassified 2153
147 Ga0105245_10010349 3300009098 Bacteria 8124
148 Ga0105247_10963762 3300009101 Bacteria 663
149 Ga0114129_10024186 3300009147 Bacteria 8609
150 Ga0114129_10047542 3300009147 Bacteria 6028
151 Ga0114129_10060098 3300009147 Bacteria 5314
152 Ga0114129_10427481 3300009147 Bacteria 1741
153 Ga0114129_10447506 3300009147 Bacteria 1694
154 Ga0114129_10589416 3300009147 Bacteria 1442
155 Ga0105243_10029651 3300009148 Bacteria 4208
156 Ga0105243_11601481 3300009148 Bacteria 678
157 Ga0105241_10099988 3300009174 Bacteria 2304
158 Ga0105241_10617935 3300009174 Bacteria 981
159 Ga0105242_10043364 3300009176 Bacteria 3639
160 Ga0105242_10211117 3300009176 Bacteria 1730
161 Ga0105242_10527956 3300009176 Unclassified 1127
162 Ga0105248_10299319 3300009177 Unclassified 1811
163 Ga0105237_10007555 3300009545 Bacteria 11880
164 Ga0105237_10773204 3300009545 Bacteria 967
165 Ga0105238_10236047 3300009551 Bacteria 1806
166 Ga0105249_10086184 3300009553 Bacteria 2929
167 Ga0105239_10003920 3300010375 Bacteria 18029
168 Ga0105239_11032572 3300010375 Unclassified 945
169 Ga0105246_10122453 3300011119 Bacteria 1930
170 Ga0157373_10260123 3300013100 Unclassified 1228
171 Ga0157370_10150186 3300013104 Bacteria 2168
172 Ga0157369_10128665 3300013105 Unclassified 2684
173 Ga0157378_10020834 3300013297 Bacteria 5765
174 Ga0157372_10202314 3300013307 Bacteria 2301
175 Ga0157372_10441018 3300013307 Bacteria 1518
176 Ga0157372_11457363 3300013307 Bacteria 789
177 Ga0157375_11836806 3300013308 Bacteria 719
178 Ga0157375_12043562 3300013308 Bacteria 681
179 Ga0157375_12597512 3300013308 Bacteria 605
180 Ga0163163_10062769 3300014325 Bacteria 3682
181 Ga0163163_10305276 3300014325 Bacteria 1644
182 Ga0163163_11775035 3300014325 Bacteria 677
183 Ga0163163_12202699 3300014325 Unclassified 610
184 Ga0157380_10068276 3300014326 Bacteria 2865
185 Ga0157380_10087041 3300014326 Bacteria 2568
186 Ga0157380_10519109 3300014326 Bacteria 1161
187 Ga0157379_10062590 3300014968 Bacteria 3327
188 Ga0157379_10417434 3300014968 Bacteria 1235
189 Ga0157379_11907332 3300014968 Unclassified 586
190 Ga0157376_10582491 3300014969 Bacteria 1111
191 Ga0157376_11892098 3300014969 Bacteria 633
192 Ga0206350_11483264 3300020080 Bacteria 658
193 Ga0206353_11245200 3300020082 Bacteria 565
194 Ga0209566_116915 3300025225 Bacteria 630
195 Ga0209674_100058 3300025226 Bacteria 286902
196 Ga0209674_100634 3300025226 Bacteria 12780
197 Ga0209672_100043 3300025228 Bacteria 270302
198 Ga0209672_100061 3300025228 Bacteria 206098
199 Ga0209672_100077 3300025228 Bacteria 158067
200 Ga0209672_103090 3300025228 Bacteria 3609
201 Ga0209147_119738 3300025229 Unclassified 618
202 Ga0209563_100062 3300025230 Bacteria 264769
203 Ga0207427_100031 3300025231 Bacteria 350866
204 Ga0209437_100061 3300025233 Bacteria 350866
205 Ga0209258_100054 3300025242 Bacteria 339063
206 Ga0209258_100076 3300025242 Bacteria 270302
207 Ga0209258_100097 3300025242 Bacteria 216963
208 Ga0209258_100447 3300025242 Bacteria 45725
209 Ga0209646_1000520 3300025246 Bacteria 17062
210 Ga0209026_1000130 3300025250 Bacteria 120413
211 Ga0209026_1002128 3300025250 Bacteria 7747
212 Ga0209677_104056 3300025253 Bacteria 4405
213 Ga0209148_1000063 3300025254 Bacteria 346881
214 Ga0209148_1000066 3300025254 Bacteria 339063
215 Ga0209148_1000082 3300025254 Bacteria 270302
216 Ga0209148_1000438 3300025254 Bacteria 45725
217 Ga0209759_1000176 3300025256 Bacteria 105921
218 Ga0209759_1000218 3300025256 Bacteria 88056
219 Ga0209233_1000076 3300025261 Bacteria 350866
220 Ga0209455_1000078 3300025272 Bacteria 270237
221 Ga0209455_1000096 3300025272 Bacteria 217006
222 Ga0209455_1000101 3300025272 Bacteria 206098
223 Ga0209455_1023691 3300025272 Bacteria 1146
224 Ga0207697_10187203 3300025315 Bacteria 908
225 Ga0207642_10005834 3300025899 Bacteria 4051
226 Ga0207710_10562298 3300025900 Unclassified 595
227 Ga0207645_10080854 3300025907 Bacteria 2083
228 Ga0207645_10135804 3300025907 Bacteria 1602
229 Ga0207643_10009369 3300025908 Bacteria 5261
230 Ga0207684_10364671 3300025910 Bacteria 1243
231 Ga0207684_11050968 3300025910 Bacteria 679
232 Ga0207707_10003802 3300025912 Bacteria 13379
233 Ga0207707_11312849 3300025912 Bacteria 581
234 Ga0207695_10030150 3300025913 Bacteria 5975
235 Ga0207671_10004483 3300025914 Bacteria 13310
236 Ga0207693_10184994 3300025915 Bacteria 1640
237 Ga0207660_10131127 3300025917 Bacteria 1908
238 Ga0207660_10889344 3300025917 Bacteria 727
239 Ga0207646_10315464 3300025922 Bacteria 1413
240 Ga0207646_10495365 3300025922 Bacteria 1101
241 Ga0207681_10920110 3300025923 Unclassified 733
242 Ga0207681_11654457 3300025923 Unclassified 535
243 Ga0207650_10535967 3300025925 Bacteria 981
244 Ga0207650_10558996 3300025925 Bacteria 960
245 Ga0207659_10067858 3300025926 Bacteria 2592
246 Ga0207659_10152076 3300025926 Bacteria 1808
247 Ga0207659_10374750 3300025926 Bacteria 1186
248 Ga0207687_10037464 3300025927 Bacteria 3309
249 Ga0207687_10468711 3300025927 Bacteria 1047
250 Ga0207664_10035254 3300025929 Bacteria 3859
251 Ga0207690_10499764 3300025932 Bacteria 983
252 Ga0207706_10143256 3300025933 Bacteria 2102
253 Ga0207686_10005545 3300025934 Bacteria 6765
254 Ga0207686_10253078 3300025934 Bacteria 1288
255 Ga0207709_10011731 3300025935 Bacteria 4831
256 Ga0207670_10054795 3300025936 Bacteria 2692
257 Ga0207670_10685178 3300025936 Bacteria 847
258 Ga0207704_10010236 3300025938 Bacteria 4564
259 Ga0207665_10112340 3300025939 Bacteria 1916
260 Ga0207691_10040379 3300025940 Bacteria 4311
261 Ga0207711_10581607 3300025941 Bacteria 1045
262 Ga0207711_10624442 3300025941 Unclassified 1005
263 Ga0207689_10007444 3300025942 Bacteria 9596
264 Ga0207689_10012803 3300025942 Bacteria 7164
265 Ga0207651_11055420 3300025960 Bacteria 727
266 Ga0207712_10198002 3300025961 Bacteria 1591
267 Ga0207668_10045961 3300025972 Bacteria 2980
268 Ga0207668_12051644 3300025972 Bacteria 515
269 Ga0207658_10225089 3300025986 Bacteria 1580
270 Ga0207658_10290514 3300025986 Bacteria 1405
271 Ga0207677_10156137 3300026023 Bacteria 1767
272 Ga0207703_10042952 3300026035 Bacteria 3627
273 Ga0207639_11255339 3300026041 Bacteria 695
274 Ga0207708_10000230 3300026075 Bacteria 44125
275 Ga0207708_10128287 3300026075 Bacteria 1981
276 Ga0207702_10002528 3300026078 Bacteria 17224
277 Ga0207702_11234823 3300026078 Unclassified 741
278 Ga0207641_10499163 3300026088 Bacteria 1181
279 Ga0207648_10000484 3300026089 Bacteria 44276
280 Ga0207648_10327327 3300026089 Bacteria 1378
281 Ga0207676_10175492 3300026095 Bacteria 1871
282 Ga0207674_10399901 3300026116 Bacteria 1328
283 Ga0207675_100000833 3300026118 Bacteria 30676
284 Ga0207675_100043251 3300026118 Bacteria 4207
285 Ga0207675_100294420 3300026118 Bacteria 1579
286 Ga0207675_100453946 3300026118 Bacteria 1270
287 Ga0207683_10063133 3300026121 Bacteria 3263
288 Ga0207683_10343224 3300026121 Bacteria 1370
289 Ga0207698_10494213 3300026142 Bacteria 1189
290 Ga0209588_1043287 3300027671 Bacteria 1454
291 Ga0207428_10000749 3300027907 Bacteria 37159
292 Ga0268266_10120147 3300028379 Bacteria 2338
293 Ga0268266_10525474 3300028379 Bacteria 1132
294 Ga0268265_10026808 3300028380 Bacteria 4103
295 Ga0268265_10072780 3300028380 Bacteria 2682
296 Ga0268264_10893624 3300028381 Bacteria 891
297 Ga0265338_10377901 3300028800 Unclassified 1014
298 Ga0307413_11374016 3300031824 Bacteria 620
299 Ga0373935_0858543 3300035692 Bacteria 671
300 Ga0373937_0803332 3300036401 Unclassified 889
301 Ga0373937_1706075 3300036401 Bacteria 577
302 Ga0373937_1768224 3300036401 Bacteria 565
303 Ga0373925_0159301 3300037068 Bacteria 1777
304 Ga0373925_0521390 3300037068 Bacteria 976
305 Ga0395899_0000229 3300037312 Bacteria 76239
306 Ga0395899_0012184 3300037312 Bacteria 6583
307 Ga0395900_0009326 3300037418 Bacteria 10061
308 Ga0395900_1075543 3300037418 Bacteria 722
309 Ga0395900_1663943 3300037418 Bacteria 549
310 Ga0395898_0000013 3300037466 Bacteria 458788
311 Ga0395898_0000120 3300037466 Bacteria 209091
312 Ga0395905_0540129 3300037471 Bacteria 1067
313 Ga0395901_0147061 3300038443 Bacteria 2476
314 Ga0395901_0191303 3300038443 Bacteria 2146
315 Ga0395901_0386428 3300038443 Bacteria 1440
316 Ga0395901_1870384 3300038443 Bacteria 548
317 Ga0242420_080641 3300038996 Bacteria 672
318 Ga0436361_1053571 3300039447 Bacteria 559
319 Ga0439441_050283 3300042001 Bacteria 857
320 Ga0439460_0238605 3300042461 Bacteria 626
321 Ga0451577_0010838 3300042876 Bacteria 8664
322 Ga0451577_0052820 3300042876 Bacteria 3629
323 Ga0451577_0895622 3300042876 Bacteria 799
324 Ga0466969_0117747 3300044656 Bacteria 1238
325 Ga0466969_0148765 3300044656 Bacteria 1079
326 Ga0466975_0186954 3300044661 Bacteria 1415
327 Ga0453683_0020960 3300044673 Bacteria 4174
328 Ga0466965_0764363 3300044683 Bacteria 557
329 Ga0466966_0368347 3300044684 Bacteria 863
330 Ga0466961_0000425 3300044693 Bacteria 26967
331 Ga0466961_0057631 3300044693 Bacteria 2472
332 Ga0466961_0071214 3300044693 Bacteria 2206
333 Ga0466961_0211032 3300044693 Bacteria 1198
334 Ga0466963_0055091 3300044694 Bacteria 2644
335 Ga0466964_0022855 3300044706 Bacteria 2429
336 Ga0453684_0008690 3300044712 Bacteria 18066
337 Ga0453684_0053588 3300044712 Bacteria 5264
338 Ga0466971_0042379 3300044719 Bacteria 2045
339 Ga0466968_0156294 3300044735 Bacteria 1050
340 Ga0466968_0168943 3300044735 Bacteria 1013
341 Ga0466970_0055394 3300044765 Bacteria 2117
342 Ga0466970_0161998 3300044765 Bacteria 1237
343 Ga0466957_0000910 3300044842 Bacteria 15137
344 Ga0466959_0000078 3300045049 Bacteria 61514
345 Ga0466959_0061562 3300045049 Bacteria 2728
346 Ga0466959_0106891 3300045049 Bacteria 2000
347 Ga0451576_0016242 3300045051 Bacteria 8222
348 Ga0451576_0657597 3300045051 Bacteria 1101
349 Ga0451576_0712300 3300045051 Bacteria 1054
350 Ga0451576_1380683 3300045051 Bacteria 733
351 Ga0466958_0005568 3300045836 Bacteria 6792
352 Ga0466958_0025772 3300045836 Bacteria 3470
353 Ga0466958_0298776 3300045836 Bacteria 1034
354 Ga0466967_0066507 3300045976 Bacteria 3212
355 Ga0496102_1591206 3300048905 Bacteria 572
356 Ga0496103_0293997 3300048906 Bacteria 1045
357 Ga0496107_0434627 3300048910 Bacteria 976
358 Ga0496110_0584374 3300048913 Bacteria 1014
359 Ga0501298_014167 3300049521 Bacteria 1421
360 Ga0501031_0002585 3300049568 Bacteria 11541
361 Ga0501031_0120537 3300049568 Bacteria 1713
362 Ga0501032_0035910 3300049569 Bacteria 3386
363 Ga0501032_0038645 3300049569 Bacteria 3249
364 Ga0501033_0920838 3300049570 Bacteria 587
365 Ga0501036_0033901 3300049572 Bacteria 4319
366 Ga0501036_0440714 3300049572 Bacteria 1085
367 Ga0501036_1464172 3300049572 Unclassified 553
368 Ga0501037_0019515 3300049573 Bacteria 5001
369 Ga0501037_0114523 3300049573 Bacteria 1941
370 Ga0501038_0061960 3300049574 Bacteria 3198
371 Ga0501038_0424067 3300049574 Bacteria 1026
372 Ga0501039_0000579 3300049575 Bacteria 26468
373 Ga0501039_0008322 3300049575 Bacteria 7903
374 Ga0501040_0012694 3300049576 Bacteria 5527
375 Ga0501040_0041514 3300049576 Bacteria 3134
376 Ga0501040_0941922 3300049576 Bacteria 626
377 Ga0501041_0001198 3300049577 Bacteria 14177
378 Ga0501041_0206268 3300049577 Bacteria 1232
379 Ga0501042_0009910 3300049578 Bacteria 6366
380 Ga0501042_0013636 3300049578 Bacteria 5534
381 Ga0501043_0302029 3300049579 Bacteria 1223
382 Ga0501046_0025658 3300049580 Bacteria 4821
383 Ga0501046_0135619 3300049580 Bacteria 1864
384 Ga0501048_0009546 3300049582 Bacteria 7283
385 Ga0501067_0800697 3300049583 Bacteria 531
386 Ga0501070_0436350 3300049586 Bacteria 1057
387 Ga0501070_1110002 3300049586 Unclassified 610
388 Ga0501071_0007956 3300049587 Bacteria 6994
389 Ga0501071_0449303 3300049587 Bacteria 986
390 Ga0501072_0123834 3300049588 Bacteria 2060
391 Ga0501072_0405660 3300049588 Bacteria 1081
392 Ga0501075_0225102 3300049591 Unclassified 1431
393 Ga0501075_0594070 3300049591 Bacteria 844
394 Ga0501075_0681267 3300049591 Bacteria 783
395 Ga0501076_0033241 3300049592 Bacteria 4027
396 Ga0501076_0736806 3300049592 Bacteria 813
397 Ga0501076_0785055 3300049592 Bacteria 786
398 Ga0501076_1491267 3300049592 Bacteria 555
399 Ga0501077_0883665 3300049593 Bacteria 575
400 Ga0501233_031140 3300049668 Bacteria 1206
401 Ga0501261_124939 3300049690 Bacteria 513
402 Ga0501080_0559757 3300049742 Unclassified 1018
403 Ga0501080_1098278 3300049742 Bacteria 687
404 Ga0501081_0276062 3300049743 Bacteria 1230
405 Ga0501081_0814075 3300049743 Bacteria 703
406 Ga0501083_0706578 3300049744 Bacteria 656
407 Ga0501035_0004846 3300049822 Bacteria 12760
408 Ga0501035_0188225 3300049822 Bacteria 1776
409 Ga0501045_1288363 3300049824 Bacteria 532
410 nmdc:mga04h51_273778_c1 3300050495 Bacteria 682
411 nmdc:mga05p37_161958_c1 3300050507 Bacteria 2732
412 nmdc:mga05p37_201133_c1 3300050507 Bacteria 2413
413 nmdc:mga05p37_407420_c1 3300050507 Bacteria 1586
414 nmdc:mga05p37_490852_c1 3300050507 Bacteria 1412
415 nmdc:mga05p37_546270_c1 3300050507 Bacteria 1320
416 nmdc:mga05p37_648697_c1 3300050507 Bacteria 1182
417 nmdc:mga08y16_137151_c1 3300050511 Bacteria 2543
418 nmdc:mga08y16_20675_c1 3300050511 Bacteria 6948
419 nmdc:mga08y16_51684_c1 3300050511 Bacteria 4300
420 nmdc:mga0n895_251503_c1 3300050512 Bacteria 1793
421 nmdc:mga0n895_31132_c1 3300050512 Bacteria 5105
422 nmdc:mga0n895_327530_c1 3300050512 Bacteria 1552
423 nmdc:mga0n895_334635_c1 3300050512 Bacteria 1534
424 nmdc:mga0n895_52123_c1 3300050512 Bacteria 4015
425 nmdc:mga0rr50_188004_c1 3300050513 Bacteria 1691
426 nmdc:mga0rr50_444592_c1 3300050513 Bacteria 1099
427 nmdc:mga08x19_14445_c1 3300050514 Bacteria 4789
428 nmdc:mga08x19_152676_c1 3300050514 Bacteria 1565
429 nmdc:mga0a205_128903_c1 3300050515 Bacteria 2430
430 nmdc:mga0a205_1480_c1 3300050515 Bacteria 17180
431 nmdc:mga0a205_5481_c1 3300050515 Bacteria 11426
432 Ga0495619_0267845 3300053085 Bacteria 1184
433 Ga0500556_0000646 3300053104 Bacteria 21836
434 Ga0501084_0225386 3300054114 Bacteria 1582
435 Ga0587062_081300 3300059639 Bacteria 602
436 Ga0587075_053609 3300059644 Bacteria 710
437 Ga0466962_0343938 3300061719 Bacteria 742
438 Ga0466962_0633396 3300061719 Bacteria 546
439 Ga0530510_0274239 3300061734 Unclassified 1259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10143256 Ga0207706_101432561 122
2 3300049568 Ga0501031_0002585 Ga0501031_0002585_2241_2624 124
3 3300049569 Ga0501032_0038645 Ga0501032_0038645_1307_1690 124
4 3300049572 Ga0501036_0440714 Ga0501036_0440714_205_588 124
5 3300049573 Ga0501037_0019515 Ga0501037_0019515_2833_3216 124
6 3300049574 Ga0501038_0424067 Ga0501038_0424067_65_448 124
7 3300049575 Ga0501039_0000579 Ga0501039_0000579_18007_18390 124
8 3300049576 Ga0501040_0012694 Ga0501040_0012694_3871_4254 124
9 3300049577 Ga0501041_0206268 Ga0501041_0206268_22_405 124
10 3300049578 Ga0501042_0013636 Ga0501042_0013636_1525_1908 124
11 3300049580 Ga0501046_0025658 Ga0501046_0025658_800_1183 124
12 3300049822 Ga0501035_0188225 Ga0501035_0188225_242_625 124
13 3300009177 Ga0105248_10299319 Ga0105248_102993191 126
14 3300025941 Ga0207711_10624442 Ga0207711_106244422 126
15 3300009176 Ga0105242_10527956 Ga0105242_105279561 130
16 3300005295 Ga0065707_10467095 Ga0065707_104670951 132
17 3300005295 Ga0065707_10667661 Ga0065707_106676611 132
18 3300005338 Ga0068868_100653292 Ga0068868_1006532921 132
19 3300005457 Ga0070662_100709841 Ga0070662_1007098413 132
20 3300005467 Ga0070706_100999901 Ga0070706_1009999011 132
21 3300005546 Ga0070696_100099686 Ga0070696_1000996863 132
22 3300005549 Ga0070704_100166634 Ga0070704_1001666342 132
23 3300005549 Ga0070704_100680532 Ga0070704_1006805321 132
24 3300005615 Ga0070702_101238503 Ga0070702_1012385031 132
25 3300005617 Ga0068859_101427552 Ga0068859_1014275522 132
26 3300006173 Ga0070716_100867106 Ga0070716_1008671061 132
27 3300006844 Ga0075428_100465484 Ga0075428_1004654842 132
28 3300006852 Ga0075433_10001741 Ga0075433_100017414 132
29 3300006852 Ga0075433_10039912 Ga0075433_100399124 132
30 3300006871 Ga0075434_100043473 Ga0075434_1000434732 132
31 3300006881 Ga0068865_101637407 Ga0068865_1016374071 132
32 3300007076 Ga0075435_100187599 Ga0075435_1001875991 132
33 3300007265 Ga0099794_10124631 Ga0099794_101246311 132
34 3300009093 Ga0105240_10686938 Ga0105240_106869382 132
35 3300009094 Ga0111539_10008085 Ga0111539_1000808512 132
36 3300009094 Ga0111539_10231158 Ga0111539_102311583 132
37 3300009147 Ga0114129_10047542 Ga0114129_100475426 132
38 3300009147 Ga0114129_10589416 Ga0114129_105894161 132
39 3300009148 Ga0105243_11601481 Ga0105243_116014811 132
40 3300009174 Ga0105241_10099988 Ga0105241_100999882 132
41 3300009176 Ga0105242_10211117 Ga0105242_102111172 132
42 3300010375 Ga0105239_11032572 Ga0105239_110325722 132
43 3300013100 Ga0157373_10260123 Ga0157373_102601231 132
44 3300013307 Ga0157372_11457363 Ga0157372_114573631 132
45 3300013308 Ga0157375_12043562 Ga0157375_120435621 132
46 3300013308 Ga0157375_12597512 Ga0157375_125975121 132
47 3300014325 Ga0163163_10062769 Ga0163163_100627696 132
48 3300020080 Ga0206350_11483264 Ga0206350_114832641 132
49 3300020082 Ga0206353_11245200 Ga0206353_112452001 132
50 3300025934 Ga0207686_10253078 Ga0207686_102530782 132
51 3300025939 Ga0207665_10112340 Ga0207665_101123402 132
52 3300026075 Ga0207708_10128287 Ga0207708_101282872 132
53 3300026116 Ga0207674_10399901 Ga0207674_103999012 132
54 3300027671 Ga0209588_1043287 Ga0209588_10432872 132
55 3300027907 Ga0207428_10000749 Ga0207428_1000074932 132
56 3300042876 Ga0451577_0010838 Ga0451577_0010838_717_1136 132
57 3300044673 Ga0453683_0020960 Ga0453683_0020960_2848_3267 132
58 3300044712 Ga0453684_0008690 Ga0453684_0008690_16638_17057 132
59 3300045051 Ga0451576_0016242 Ga0451576_0016242_2311_2715 132
60 3300045051 Ga0451576_0712300 Ga0451576_0712300_73_492 132
61 3300048905 Ga0496102_1591206 Ga0496102_1591206_80_484 132
62 3300048906 Ga0496103_0293997 Ga0496103_0293997_140_544 132
63 3300048910 Ga0496107_0434627 Ga0496107_0434627_109_513 132
64 3300048913 Ga0496110_0584374 Ga0496110_0584374_533_937 132
65 3300049568 Ga0501031_0120537 Ga0501031_0120537_680_1132 132
66 3300049569 Ga0501032_0035910 Ga0501032_0035910_2602_3054 132
67 3300049572 Ga0501036_0033901 Ga0501036_0033901_2010_2462 132
68 3300049573 Ga0501037_0114523 Ga0501037_0114523_182_634 132
69 3300049574 Ga0501038_0061960 Ga0501038_0061960_1440_1892 132
70 3300049575 Ga0501039_0008322 Ga0501039_0008322_6633_7085 132
71 3300049576 Ga0501040_0041514 Ga0501040_0041514_2548_3000 132
72 3300049577 Ga0501041_0001198 Ga0501041_0001198_2739_3191 132
73 3300049578 Ga0501042_0009910 Ga0501042_0009910_3143_3595 132
74 3300049579 Ga0501043_0302029 Ga0501043_0302029_186_638 132
75 3300049580 Ga0501046_0135619 Ga0501046_0135619_1186_1638 132
76 3300049582 Ga0501048_0009546 Ga0501048_0009546_2845_3297 132
77 3300049583 Ga0501067_0800697 Ga0501067_0800697_103_507 132
78 3300049586 Ga0501070_1110002 Ga0501070_1110002_135_587 132
79 3300049587 Ga0501071_0007956 Ga0501071_0007956_2385_2837 132
80 3300049588 Ga0501072_0123834 Ga0501072_0123834_423_875 132
81 3300049591 Ga0501075_0225102 Ga0501075_0225102_759_1211 132
82 3300049592 Ga0501076_0033241 Ga0501076_0033241_109_561 132
83 3300049822 Ga0501035_0004846 Ga0501035_0004846_11517_11969 132
84 3300050507 nmdc:mga05p37_407420_c1 nmdc:mga05p37_407420_c1_232_636 132
85 3300050507 nmdc:mga05p37_648697_c1 nmdc:mga05p37_648697_c1_513_932 132
86 3300050511 nmdc:mga08y16_20675_c1 nmdc:mga08y16_20675_c1_5728_6147 132
87 3300050511 nmdc:mga08y16_51684_c1 nmdc:mga08y16_51684_c1_1923_2342 132
88 3300050512 nmdc:mga0n895_31132_c1 nmdc:mga0n895_31132_c1_716_1135 132
89 3300050512 nmdc:mga0n895_52123_c1 nmdc:mga0n895_52123_c1_2487_2906 132
90 3300050513 nmdc:mga0rr50_188004_c1 nmdc:mga0rr50_188004_c1_1161_1580 132
91 3300050515 nmdc:mga0a205_128903_c1 nmdc:mga0a205_128903_c1_1814_2218 132
92 3300050515 nmdc:mga0a205_1480_c1 nmdc:mga0a205_1480_c1_3562_3981 132
93 3300050515 nmdc:mga0a205_5481_c1 nmdc:mga0a205_5481_c1_7430_7849 132
94 3300059639 Ga0587062_081300 Ga0587062_081300_124_528 132
95 3300059644 Ga0587075_053609 Ga0587075_053609_163_567 132
96 3300005366 Ga0070659_100397411 Ga0070659_1003974112 133
97 3300005539 Ga0068853_100173482 Ga0068853_1001734822 133
98 3300005563 Ga0068855_100605079 Ga0068855_1006050792 133
99 3300013104 Ga0157370_10150186 Ga0157370_101501862 133
100 3300013307 Ga0157372_10202314 Ga0157372_102023143 133
101 3300013307 Ga0157372_10441018 Ga0157372_104410182 133
102 3300014325 Ga0163163_11775035 Ga0163163_117750351 133
103 3300025932 Ga0207690_10499764 Ga0207690_104997642 133
104 3300038443 Ga0395901_0191303 Ga0395901_0191303_546_953 133
105 3300042876 Ga0451577_0052820 Ga0451577_0052820_2276_2683 133
106 3300005295 Ga0065707_10340755 Ga0065707_103407551 134
107 3300005355 Ga0070671_100557687 Ga0070671_1005576871 134
108 3300005518 Ga0070699_101617786 Ga0070699_1016177861 134
109 3300005546 Ga0070696_101632972 Ga0070696_1016329721 134
110 3300006852 Ga0075433_11146551 Ga0075433_111465512 134
111 3300009147 Ga0114129_10447506 Ga0114129_104475062 134
112 3300025922 Ga0207646_10315464 Ga0207646_103154641 134
113 3300025926 Ga0207659_10374750 Ga0207659_103747502 134
114 3300039447 Ga0436361_1053571 Ga0436361_1053571_28_438 134
115 3300042001 Ga0439441_050283 Ga0439441_050283_57_470 134
116 3300042461 Ga0439460_0238605 Ga0439460_0238605_145_558 134
117 3300049593 Ga0501077_0883665 Ga0501077_0883665_68_478 134
118 3300049743 Ga0501081_0814075 Ga0501081_0814075_66_482 134
119 3300050507 nmdc:mga05p37_490852_c1 nmdc:mga05p37_490852_c1_523_963 134
120 3300005293 Ga0065715_10135553 Ga0065715_101355533 135
121 3300005328 Ga0070676_10069323 Ga0070676_100693233 135
122 3300005331 Ga0070670_100189578 Ga0070670_1001895782 135
123 3300005333 Ga0070677_10220476 Ga0070677_102204761 135
124 3300005334 Ga0068869_100076864 Ga0068869_1000768643 135
125 3300005335 Ga0070666_10716573 Ga0070666_107165731 135
126 3300005336 Ga0070680_100449915 Ga0070680_1004499152 135
127 3300005341 Ga0070691_10668905 Ga0070691_106689052 135
128 3300005347 Ga0070668_100001893 Ga0070668_10000189322 135
129 3300005347 Ga0070668_100214129 Ga0070668_1002141293 135
130 3300005354 Ga0070675_101607630 Ga0070675_1016076301 135
131 3300005356 Ga0070674_100466011 Ga0070674_1004660112 135
132 3300005367 Ga0070667_100011832 Ga0070667_1000118326 135
133 3300005367 Ga0070667_100464344 Ga0070667_1004643441 135
134 3300005435 Ga0070714_100010824 Ga0070714_1000108246 135
135 3300005444 Ga0070694_101079652 Ga0070694_1010796521 135
136 3300005445 Ga0070708_100399487 Ga0070708_1003994872 135
137 3300005456 Ga0070678_100205905 Ga0070678_1002059052 135
138 3300005458 Ga0070681_10001344 Ga0070681_100013444 135
139 3300005459 Ga0068867_100278132 Ga0068867_1002781321 135
140 3300005467 Ga0070706_100023139 Ga0070706_1000231394 135
141 3300005468 Ga0070707_100208599 Ga0070707_1002085993 135
142 3300005471 Ga0070698_101153588 Ga0070698_1011535882 135
143 3300005471 Ga0070698_101570539 Ga0070698_1015705391 135
144 3300005518 Ga0070699_100244048 Ga0070699_1002440484 135
145 3300005518 Ga0070699_100649197 Ga0070699_1006491971 135
146 3300005518 Ga0070699_101097932 Ga0070699_1010979321 135
147 3300005536 Ga0070697_100094922 Ga0070697_1000949222 135
148 3300005536 Ga0070697_100554429 Ga0070697_1005544291 135
149 3300005543 Ga0070672_100339641 Ga0070672_1003396412 135
150 3300005545 Ga0070695_100035223 Ga0070695_1000352234 135
151 3300005548 Ga0070665_101292082 Ga0070665_1012920821 135
152 3300005549 Ga0070704_101167322 Ga0070704_1011673221 135
153 3300005564 Ga0070664_100992089 Ga0070664_1009920892 135
154 3300005617 Ga0068859_100135765 Ga0068859_1001357651 135
155 3300005618 Ga0068864_100089501 Ga0068864_1000895012 135
156 3300005719 Ga0068861_101284950 Ga0068861_1012849502 135
157 3300005840 Ga0068870_10680097 Ga0068870_106800972 135
158 3300005841 Ga0068863_100025068 Ga0068863_1000250685 135
159 3300005842 Ga0068858_100020569 Ga0068858_1000205696 135
160 3300005843 Ga0068860_100785908 Ga0068860_1007859082 135
161 3300005844 Ga0068862_100256974 Ga0068862_1002569742 135
162 3300005981 Ga0081538_10011348 Ga0081538_100113487 135
163 3300005981 Ga0081538_10139068 Ga0081538_101390682 135
164 3300006028 Ga0070717_10200878 Ga0070717_102008782 135
165 3300006175 Ga0070712_100187824 Ga0070712_1001878242 135
166 3300006237 Ga0097621_100356004 Ga0097621_1003560042 135
167 3300006358 Ga0068871_100021911 Ga0068871_1000219117 135
168 3300006844 Ga0075428_100746090 Ga0075428_1007460902 135
169 3300006871 Ga0075434_100054599 Ga0075434_1000545997 135
170 3300006871 Ga0075434_100277619 Ga0075434_1002776192 135
171 3300006914 Ga0075436_100432376 Ga0075436_1004323761 135
172 3300006931 Ga0097620_100135769 Ga0097620_1001357693 135
173 3300009094 Ga0111539_10178971 Ga0111539_101789712 135
174 3300009101 Ga0105247_10963762 Ga0105247_109637621 135
175 3300009147 Ga0114129_10024186 Ga0114129_100241865 135
176 3300009147 Ga0114129_10427481 Ga0114129_104274813 135
177 3300011119 Ga0105246_10122453 Ga0105246_101224534 135
178 3300013105 Ga0157369_10128665 Ga0157369_101286652 135
179 3300013308 Ga0157375_11836806 Ga0157375_118368062 135
180 3300014325 Ga0163163_10305276 Ga0163163_103052764 135
181 3300014325 Ga0163163_12202699 Ga0163163_122026992 135
182 3300014326 Ga0157380_10068276 Ga0157380_100682761 135
183 3300014326 Ga0157380_10519109 Ga0157380_105191092 135
184 3300014968 Ga0157379_10417434 Ga0157379_104174342 135
185 3300014968 Ga0157379_11907332 Ga0157379_119073322 135
186 3300014969 Ga0157376_11892098 Ga0157376_118920982 135
187 3300025315 Ga0207697_10187203 Ga0207697_101872032 135
188 3300025900 Ga0207710_10562298 Ga0207710_105622981 135
189 3300025907 Ga0207645_10080854 Ga0207645_100808543 135
190 3300025910 Ga0207684_10364671 Ga0207684_103646712 135
191 3300025910 Ga0207684_11050968 Ga0207684_110509681 135
192 3300025912 Ga0207707_10003802 Ga0207707_100038023 135
193 3300025915 Ga0207693_10184994 Ga0207693_101849943 135
194 3300025917 Ga0207660_10889344 Ga0207660_108893442 135
195 3300025922 Ga0207646_10495365 Ga0207646_104953651 135
196 3300025923 Ga0207681_10920110 Ga0207681_109201101 135
197 3300025923 Ga0207681_11654457 Ga0207681_116544572 135
198 3300025925 Ga0207650_10535967 Ga0207650_105359671 135
199 3300025925 Ga0207650_10558996 Ga0207650_105589961 135
200 3300025926 Ga0207659_10067858 Ga0207659_100678583 135
201 3300025926 Ga0207659_10152076 Ga0207659_101520762 135
202 3300025927 Ga0207687_10468711 Ga0207687_104687112 135
203 3300025929 Ga0207664_10035254 Ga0207664_100352545 135
204 3300025936 Ga0207670_10685178 Ga0207670_106851781 135
205 3300025940 Ga0207691_10040379 Ga0207691_100403794 135
206 3300025941 Ga0207711_10581607 Ga0207711_105816071 135
207 3300025942 Ga0207689_10007444 Ga0207689_100074447 135
208 3300025960 Ga0207651_11055420 Ga0207651_110554202 135
209 3300025972 Ga0207668_10045961 Ga0207668_100459612 135
210 3300025972 Ga0207668_12051644 Ga0207668_120516441 135
211 3300025986 Ga0207658_10225089 Ga0207658_102250892 135
212 3300025986 Ga0207658_10290514 Ga0207658_102905142 135
213 3300026088 Ga0207641_10499163 Ga0207641_104991632 135
214 3300026089 Ga0207648_10327327 Ga0207648_103273272 135
215 3300026095 Ga0207676_10175492 Ga0207676_101754922 135
216 3300026118 Ga0207675_100043251 Ga0207675_1000432516 135
217 3300026118 Ga0207675_100294420 Ga0207675_1002944202 135
218 3300026118 Ga0207675_100453946 Ga0207675_1004539461 135
219 3300026142 Ga0207698_10494213 Ga0207698_104942132 135
220 3300028379 Ga0268266_10120147 Ga0268266_101201471 135
221 3300028379 Ga0268266_10525474 Ga0268266_105254742 135
222 3300028380 Ga0268265_10072780 Ga0268265_100727803 135
223 3300028381 Ga0268264_10893624 Ga0268264_108936242 135
224 3300028800 Ga0265338_10377901 Ga0265338_103779011 135
225 3300035692 Ga0373935_0858543 Ga0373935_0858543_189_602 135
226 3300036401 Ga0373937_1768224 Ga0373937_1768224_82_495 135
227 3300037068 Ga0373925_0521390 Ga0373925_0521390_332_766 135
228 3300037418 Ga0395900_1663943 Ga0395900_1663943_113_526 135
229 3300038996 Ga0242420_080641 Ga0242420_080641_202_615 135
230 3300049570 Ga0501033_0920838 Ga0501033_0920838_92_505 135
231 3300049743 Ga0501081_0276062 Ga0501081_0276062_688_1101 135
232 3300049744 Ga0501083_0706578 Ga0501083_0706578_48_461 135
233 3300050495 nmdc:mga04h51_273778_c1 nmdc:mga04h51_273778_c1_63_671 135
234 3300050507 nmdc:mga05p37_201133_c1 nmdc:mga05p37_201133_c1_743_1156 135
235 3300050507 nmdc:mga05p37_546270_c1 nmdc:mga05p37_546270_c1_570_983 135
236 3300050511 nmdc:mga08y16_137151_c1 nmdc:mga08y16_137151_c1_933_1349 135
237 3300050512 nmdc:mga0n895_327530_c1 nmdc:mga0n895_327530_c1_284_697 135
238 3300050512 nmdc:mga0n895_334635_c1 nmdc:mga0n895_334635_c1_576_989 135
239 3300050514 nmdc:mga08x19_152676_c1 nmdc:mga08x19_152676_c1_54_470 135
240 3300053104 Ga0500556_0000646 Ga0500556_0000646_21312_21737 135
241 3300061734 Ga0530510_0274239 Ga0530510_0274239_488_901 135
242 3300005458 Ga0070681_11585848 Ga0070681_115858481 136
243 3300006871 Ga0075434_100181307 Ga0075434_1001813074 136
244 3300009545 Ga0105237_10773204 Ga0105237_107732042 136
245 3300031824 Ga0307413_11374016 Ga0307413_113740162 136
246 3300045051 Ga0451576_0657597 Ga0451576_0657597_474_968 136
247 3300045836 Ga0466958_0298776 Ga0466958_0298776_413_829 136
248 3300049586 Ga0501070_0436350 Ga0501070_0436350_577_1023 136
249 3300049742 Ga0501080_0559757 Ga0501080_0559757_138_617 136
250 3300050512 nmdc:mga0n895_251503_c1 nmdc:mga0n895_251503_c1_291_707 136
251 3300061719 Ga0466962_0633396 Ga0466962_0633396_13_438 136
252 3300002705 JGI25156J39149_1003780 JGI25156J39149_10037805 137
253 3300002705 JGI25156J39149_1004103 JGI25156J39149_10041035 137
254 3300002737 JGI25162J39368_1000273 JGI25162J39368_10002735 137
255 3300002738 JGI25154J39366_1004264 JGI25154J39366_10042642 137
256 3300002741 JGI25157J39369_1001033 JGI25157J39369_10010336 137
257 3300002741 JGI25157J39369_1002480 JGI25157J39369_10024802 137
258 3300002772 JGI25164J39214_1000004 JGI25164J39214_100000489 137
259 3300003214 JGI25165J46597_1000110 JGI25165J46597_100011064 137
260 3300003752 Ga0055539_1016469 Ga0055539_10164692 137
261 3300003756 Ga0055533_1000893 Ga0055533_10008937 137
262 3300003759 Ga0055525_1000306 Ga0055525_100030611 137
263 3300003760 Ga0055527_1000060 Ga0055527_100006071 137
264 3300003760 Ga0055527_1000099 Ga0055527_100009912 137
265 3300003760 Ga0055527_1008497 Ga0055527_10084973 137
266 3300003761 Ga0055535_1000176 Ga0055535_100017648 137
267 3300003761 Ga0055535_1000190 Ga0055535_100019041 137
268 3300003761 Ga0055535_1000412 Ga0055535_100041211 137
269 3300003761 Ga0055535_1000480 Ga0055535_10004807 137
270 3300003762 Ga0055542_1000148 Ga0055542_100014862 137
271 3300003762 Ga0055542_1000171 Ga0055542_100017158 137
272 3300003762 Ga0055542_1000218 Ga0055542_100021843 137
273 3300003762 Ga0055542_1000498 Ga0055542_100049826 137
274 3300003763 Ga0055529_1000092 Ga0055529_100009292 137
275 3300003763 Ga0055529_1000174 Ga0055529_100017462 137
276 3300003763 Ga0055529_1000388 Ga0055529_10003889 137
277 3300005330 Ga0070690_100003131 Ga0070690_10000313112 137
278 3300005334 Ga0068869_100017527 Ga0068869_1000175277 137
279 3300005337 Ga0070682_100346801 Ga0070682_1003468011 137
280 3300005338 Ga0068868_100011157 Ga0068868_1000111579 137
281 3300005340 Ga0070689_100002770 Ga0070689_10000277012 137
282 3300005341 Ga0070691_10053401 Ga0070691_100534012 137
283 3300005343 Ga0070687_100030158 Ga0070687_1000301582 137
284 3300005345 Ga0070692_10073040 Ga0070692_100730402 137
285 3300005365 Ga0070688_100476269 Ga0070688_1004762692 137
286 3300005438 Ga0070701_10000237 Ga0070701_1000023714 137
287 3300005440 Ga0070705_100029997 Ga0070705_1000299974 137
288 3300005441 Ga0070700_100156656 Ga0070700_1001566563 137
289 3300005444 Ga0070694_100052546 Ga0070694_1000525465 137
290 3300005456 Ga0070678_100021263 Ga0070678_1000212632 137
291 3300005456 Ga0070678_100137798 Ga0070678_1001377982 137
292 3300005459 Ga0068867_101423083 Ga0068867_1014230831 137
293 3300005539 Ga0068853_100262935 Ga0068853_1002629352 137
294 3300005544 Ga0070686_100016222 Ga0070686_1000162228 137
295 3300005546 Ga0070696_100068002 Ga0070696_1000680023 137
296 3300005547 Ga0070693_100052490 Ga0070693_1000524902 137
297 3300005614 Ga0068856_100000597 Ga0068856_10000059725 137
298 3300005615 Ga0070702_100042204 Ga0070702_1000422042 137
299 3300005617 Ga0068859_100048323 Ga0068859_1000483236 137
300 3300005718 Ga0068866_10000969 Ga0068866_1000096911 137
301 3300005719 Ga0068861_100061073 Ga0068861_1000610735 137
302 3300005840 Ga0068870_10102867 Ga0068870_101028673 137
303 3300005842 Ga0068858_100043817 Ga0068858_1000438173 137
304 3300005843 Ga0068860_100094977 Ga0068860_1000949772 137
305 3300006028 Ga0070717_11031318 Ga0070717_110313182 137
306 3300006237 Ga0097621_100008730 Ga0097621_10000873011 137
307 3300006358 Ga0068871_100223451 Ga0068871_1002234512 137
308 3300006852 Ga0075433_10059137 Ga0075433_100591375 137
309 3300006881 Ga0068865_100013040 Ga0068865_1000130408 137
310 3300006914 Ga0075436_100022957 Ga0075436_1000229576 137
311 3300006931 Ga0097620_100048323 Ga0097620_1000483236 137
312 3300009093 Ga0105240_10002014 Ga0105240_1000201416 137
313 3300009098 Ga0105245_10010349 Ga0105245_1001034912 137
314 3300009147 Ga0114129_10060098 Ga0114129_100600984 137
315 3300009148 Ga0105243_10029651 Ga0105243_100296517 137
316 3300009174 Ga0105241_10617935 Ga0105241_106179352 137
317 3300009176 Ga0105242_10043364 Ga0105242_100433642 137
318 3300009545 Ga0105237_10007555 Ga0105237_100075553 137
319 3300009551 Ga0105238_10236047 Ga0105238_102360472 137
320 3300009553 Ga0105249_10086184 Ga0105249_100861843 137
321 3300010375 Ga0105239_10003920 Ga0105239_100039209 137
322 3300013297 Ga0157378_10020834 Ga0157378_100208343 137
323 3300014326 Ga0157380_10087041 Ga0157380_100870414 137
324 3300014968 Ga0157379_10062590 Ga0157379_100625904 137
325 3300014969 Ga0157376_10582491 Ga0157376_105824912 137
326 3300025225 Ga0209566_116915 Ga0209566_1169152 137
327 3300025226 Ga0209674_100058 Ga0209674_10005890 137
328 3300025226 Ga0209674_100634 Ga0209674_1006346 137
329 3300025228 Ga0209672_100043 Ga0209672_100043144 137
330 3300025228 Ga0209672_100061 Ga0209672_10006188 137
331 3300025228 Ga0209672_100077 Ga0209672_10007766 137
332 3300025228 Ga0209672_103090 Ga0209672_1030903 137
333 3300025229 Ga0209147_119738 Ga0209147_1197381 137
334 3300025230 Ga0209563_100062 Ga0209563_100062135 137
335 3300025231 Ga0207427_100031 Ga0207427_100031216 137
336 3300025233 Ga0209437_100061 Ga0209437_10006189 137
337 3300025242 Ga0209258_100054 Ga0209258_10005488 137
338 3300025242 Ga0209258_100076 Ga0209258_100076144 137
339 3300025242 Ga0209258_100097 Ga0209258_10009785 137
340 3300025242 Ga0209258_100447 Ga0209258_10044735 137
341 3300025246 Ga0209646_1000520 Ga0209646_10005202 137
342 3300025250 Ga0209026_1000130 Ga0209026_100013069 137
343 3300025250 Ga0209026_1002128 Ga0209026_10021284 137
344 3300025253 Ga0209677_104056 Ga0209677_1040562 137
345 3300025254 Ga0209148_1000063 Ga0209148_100006385 137
346 3300025254 Ga0209148_1000066 Ga0209148_100006688 137
347 3300025254 Ga0209148_1000082 Ga0209148_1000082144 137
348 3300025254 Ga0209148_1000438 Ga0209148_100043835 137
349 3300025256 Ga0209759_1000176 Ga0209759_100017627 137
350 3300025256 Ga0209759_1000218 Ga0209759_100021871 137
351 3300025261 Ga0209233_1000076 Ga0209233_1000076216 137
352 3300025272 Ga0209455_1000078 Ga0209455_1000078144 137
353 3300025272 Ga0209455_1000096 Ga0209455_100009685 137
354 3300025272 Ga0209455_1000101 Ga0209455_100010188 137
355 3300025272 Ga0209455_1023691 Ga0209455_10236911 137
356 3300025899 Ga0207642_10005834 Ga0207642_100058345 137
357 3300025907 Ga0207645_10135804 Ga0207645_101358042 137
358 3300025908 Ga0207643_10009369 Ga0207643_100093693 137
359 3300025912 Ga0207707_11312849 Ga0207707_113128491 137
360 3300025913 Ga0207695_10030150 Ga0207695_100301502 137
361 3300025914 Ga0207671_10004483 Ga0207671_100044837 137
362 3300025917 Ga0207660_10131127 Ga0207660_101311273 137
363 3300025927 Ga0207687_10037464 Ga0207687_100374646 137
364 3300025934 Ga0207686_10005545 Ga0207686_100055458 137
365 3300025935 Ga0207709_10011731 Ga0207709_100117318 137
366 3300025936 Ga0207670_10054795 Ga0207670_100547952 137
367 3300025938 Ga0207704_10010236 Ga0207704_100102362 137
368 3300025942 Ga0207689_10012803 Ga0207689_100128034 137
369 3300025961 Ga0207712_10198002 Ga0207712_101980023 137
370 3300026023 Ga0207677_10156137 Ga0207677_101561373 137
371 3300026035 Ga0207703_10042952 Ga0207703_100429522 137
372 3300026041 Ga0207639_11255339 Ga0207639_112553391 137
373 3300026075 Ga0207708_10000230 Ga0207708_1000023027 137
374 3300026078 Ga0207702_10002528 Ga0207702_1000252812 137
375 3300026078 Ga0207702_11234823 Ga0207702_112348232 137
376 3300026089 Ga0207648_10000484 Ga0207648_1000048413 137
377 3300026118 Ga0207675_100000833 Ga0207675_10000083320 137
378 3300026121 Ga0207683_10063133 Ga0207683_100631333 137
379 3300026121 Ga0207683_10343224 Ga0207683_103432242 137
380 3300028380 Ga0268265_10026808 Ga0268265_100268087 137
381 3300036401 Ga0373937_0803332 Ga0373937_0803332_60_506 137
382 3300036401 Ga0373937_1706075 Ga0373937_1706075_88_534 137
383 3300037068 Ga0373925_0159301 Ga0373925_0159301_1156_1602 137
384 3300037312 Ga0395899_0000229 Ga0395899_0000229_49896_50309 137
385 3300037312 Ga0395899_0012184 Ga0395899_0012184_1252_1665 137
386 3300037418 Ga0395900_0009326 Ga0395900_0009326_7508_7921 137
387 3300037418 Ga0395900_1075543 Ga0395900_1075543_261_680 137
388 3300037466 Ga0395898_0000013 Ga0395898_0000013_365758_366171 137
389 3300037466 Ga0395898_0000120 Ga0395898_0000120_108774_109187 137
390 3300037471 Ga0395905_0540129 Ga0395905_0540129_291_746 137
391 3300038443 Ga0395901_0147061 Ga0395901_0147061_1264_1677 137
392 3300038443 Ga0395901_0386428 Ga0395901_0386428_406_819 137
393 3300038443 Ga0395901_1870384 Ga0395901_1870384_103_522 137
394 3300042876 Ga0451577_0895622 Ga0451577_0895622_231_668 137
395 3300044656 Ga0466969_0117747 Ga0466969_0117747_426_839 137
396 3300044656 Ga0466969_0148765 Ga0466969_0148765_400_813 137
397 3300044661 Ga0466975_0186954 Ga0466975_0186954_640_1053 137
398 3300044683 Ga0466965_0764363 Ga0466965_0764363_55_468 137
399 3300044684 Ga0466966_0368347 Ga0466966_0368347_303_716 137
400 3300044693 Ga0466961_0000425 Ga0466961_0000425_10278_10691 137
401 3300044693 Ga0466961_0057631 Ga0466961_0057631_1230_1643 137
402 3300044693 Ga0466961_0071214 Ga0466961_0071214_831_1244 137
403 3300044693 Ga0466961_0211032 Ga0466961_0211032_370_783 137
404 3300044694 Ga0466963_0055091 Ga0466963_0055091_1099_1512 137
405 3300044706 Ga0466964_0022855 Ga0466964_0022855_1845_2258 137
406 3300044712 Ga0453684_0053588 Ga0453684_0053588_2638_3075 137
407 3300044719 Ga0466971_0042379 Ga0466971_0042379_864_1277 137
408 3300044735 Ga0466968_0156294 Ga0466968_0156294_65_478 137
409 3300044735 Ga0466968_0168943 Ga0466968_0168943_116_535 137
410 3300044765 Ga0466970_0055394 Ga0466970_0055394_934_1347 137
411 3300044765 Ga0466970_0161998 Ga0466970_0161998_399_812 137
412 3300044842 Ga0466957_0000910 Ga0466957_0000910_9162_9575 137
413 3300045049 Ga0466959_0000078 Ga0466959_0000078_23705_24118 137
414 3300045049 Ga0466959_0061562 Ga0466959_0061562_426_839 137
415 3300045049 Ga0466959_0106891 Ga0466959_0106891_348_761 137
416 3300045051 Ga0451576_1380683 Ga0451576_1380683_214_660 137
417 3300045836 Ga0466958_0005568 Ga0466958_0005568_5670_6104 137
418 3300045836 Ga0466958_0025772 Ga0466958_0025772_1235_1648 137
419 3300045976 Ga0466967_0066507 Ga0466967_0066507_851_1264 137
420 3300049521 Ga0501298_014167 Ga0501298_014167_105_527 137
421 3300049572 Ga0501036_1464172 Ga0501036_1464172_88_510 137
422 3300049576 Ga0501040_0941922 Ga0501040_0941922_17_448 137
423 3300049587 Ga0501071_0449303 Ga0501071_0449303_407_913 137
424 3300049588 Ga0501072_0405660 Ga0501072_0405660_515_1021 137
425 3300049591 Ga0501075_0594070 Ga0501075_0594070_137_643 137
426 3300049591 Ga0501075_0681267 Ga0501075_0681267_61_483 137
427 3300049592 Ga0501076_0736806 Ga0501076_0736806_39_464 137
428 3300049592 Ga0501076_0785055 Ga0501076_0785055_246_752 137
429 3300049592 Ga0501076_1491267 Ga0501076_1491267_26_463 137
430 3300049668 Ga0501233_031140 Ga0501233_031140_702_1124 137
431 3300049690 Ga0501261_124939 Ga0501261_124939_27_449 137
432 3300049742 Ga0501080_1098278 Ga0501080_1098278_145_567 137
433 3300049824 Ga0501045_1288363 Ga0501045_1288363_82_504 137
434 3300050507 nmdc:mga05p37_161958_c1 nmdc:mga05p37_161958_c1_1468_1887 137
435 3300050513 nmdc:mga0rr50_444592_c1 nmdc:mga0rr50_444592_c1_546_965 137
436 3300050514 nmdc:mga08x19_14445_c1 nmdc:mga08x19_14445_c1_2883_3302 137
437 3300053085 Ga0495619_0267845 Ga0495619_0267845_126_545 137
438 3300054114 Ga0501084_0225386 Ga0501084_0225386_898_1404 137
439 3300061719 Ga0466962_0343938 Ga0466962_0343938_139_552 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

159

0.83

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

27

160

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8781 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8776 1 133
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8656 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8648 1 133
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8527 1 135
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.957 80 134 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9224 76 133 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9223 7 137 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8931 76 133 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8777 7 137 3.10.180.10
ID Description Score Start End GO Terms
AF-I3U1V8-F1-model_v4 Glyoxalase 0.9886 80 133
AF-A0A3C0BKM2-F1-model_v4 PhnB-like domain-containing protein 0.9881 80 137
AF-A0A1U9YSZ7-F1-model_v4 Uncharacterized protein 0.9863 83 135
AF-A0A2A9RJP0-F1-model_v4 deleted 0.9754 80 136
AF-A0A6M4FTM7-F1-model_v4 VOC family protein 0.9751 80 135

Feature Viewer

pLDDT pTM Quality
91 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map