F444165

General Info

Members Datasets Scaffolds Average Seq Length
439 261 878 128

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10070484|Ga0075365_100704843
Length 149
Sequence MDRLRQRADFLAVANGARANSAGFVLQGRLRDDDGPIRVGFTVTKKNGTATERNRIKRRLRELVKRLDVISMRPHSDYVLVGRRTALNRDFATMLDDLRSALGRLERQPKDQVTRPPKIPAGALNRDAGTGSRQDTAPNKDSRASRKPN

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
106 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
107 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
245 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
246 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
247 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
250 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
253 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
254 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
257 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
260 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
261 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0.91
Rhizoplane 3.42
Rhizosphere 80.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10070484 3300006038 Bacteria 2351
2 JGI24740J21852_10007987 3300001979 Bacteria 4256
3 rootH2_10001332 3300003320 Bacteria 2013
4 Ga0070658_10030203 3300005327 Bacteria 4354
5 Ga0070683_100386059 3300005329 Bacteria 1335
6 Ga0070680_101148200 3300005336 Bacteria 671
7 Ga0070691_10550382 3300005341 Bacteria 674
8 Ga0070661_100045073 3300005344 Bacteria 3223
9 Ga0070668_102206620 3300005347 Bacteria 509
10 Ga0070671_100538437 3300005355 Bacteria 1006
11 Ga0070674_100326707 3300005356 Bacteria 1231
12 Ga0070673_100125643 3300005364 Bacteria 2146
13 Ga0070709_10036395 3300005434 Bacteria 2998
14 Ga0070709_10175575 3300005434 Bacteria 1501
15 Ga0070714_100055768 3300005435 Bacteria 3378
16 Ga0070714_100059484 3300005435 Bacteria 3276
17 Ga0070713_100008883 3300005436 Bacteria 7155
18 Ga0070713_100069679 3300005436 Bacteria 2966
19 Ga0070710_10001420 3300005437 Bacteria 11294
20 Ga0070710_10031680 3300005437 Bacteria 2857
21 Ga0070711_100030010 3300005439 Bacteria 3595
22 Ga0070711_100044636 3300005439 Bacteria 3009
23 Ga0070711_100072877 3300005439 Bacteria 2424
24 Ga0070711_100262338 3300005439 Bacteria 1360
25 Ga0070663_100040881 3300005455 Bacteria 3249
26 Ga0070663_100241688 3300005455 Bacteria 1425
27 Ga0070663_100828538 3300005455 Bacteria 795
28 Ga0070678_100166571 3300005456 Bacteria 1791
29 Ga0070684_100006416 3300005535 Bacteria 9101
30 Ga0068853_100038695 3300005539 Bacteria 4063
31 Ga0068853_100106387 3300005539 Bacteria 2486
32 Ga0068853_100473669 3300005539 Bacteria 1180
33 Ga0070693_101252241 3300005547 Bacteria 572
34 Ga0068855_100052955 3300005563 Bacteria 4776
35 Ga0068855_100163441 3300005563 Bacteria 2525
36 Ga0068855_100351875 3300005563 Bacteria 1622
37 Ga0068855_100411952 3300005563 Bacteria 1479
38 Ga0068855_100619338 3300005563 Bacteria 1165
39 Ga0068857_100004936 3300005577 Bacteria 11323
40 Ga0068857_100026544 3300005577 Bacteria 5105
41 Ga0068854_100079504 3300005578 Bacteria 2417
42 Ga0068856_100015417 3300005614 Bacteria 7385
43 Ga0068852_100144033 3300005616 Bacteria 2208
44 Ga0068852_100779030 3300005616 Bacteria 970
45 Ga0068859_100277155 3300005617 Bacteria 1770
46 Ga0068864_100862284 3300005618 Bacteria 893
47 Ga0068864_102232086 3300005618 Bacteria 554
48 Ga0068851_10007470 3300005834 Bacteria 5019
49 Ga0068863_100577797 3300005841 Bacteria 1111
50 Ga0068858_100440553 3300005842 Bacteria 1255
51 Ga0068858_100599432 3300005842 Bacteria 1068
52 Ga0068860_100002621 3300005843 Bacteria 18698
53 Ga0068860_101476148 3300005843 Bacteria 701
54 Ga0068860_101819906 3300005843 Bacteria 631
55 Ga0081540_1241785 3300005983 Bacteria 633
56 Ga0081539_10000040 3300005985 Bacteria 292753
57 Ga0070717_10034234 3300006028 Bacteria 4105
58 Ga0070717_10302312 3300006028 Bacteria 1422
59 Ga0075363_100078867 3300006048 Bacteria 1798
60 Ga0075363_100210886 3300006048 Bacteria 1112
61 Ga0070715_10015304 3300006163 Bacteria 2857
62 Ga0070715_10182746 3300006163 Bacteria 1053
63 Ga0070716_100077900 3300006173 Bacteria 1969
64 Ga0070716_100238167 3300006173 Bacteria 1232
65 Ga0070716_100773836 3300006173 Bacteria 741
66 Ga0070712_100024001 3300006175 Bacteria 4034
67 Ga0070712_100061388 3300006175 Bacteria 2655
68 Ga0070712_100251333 3300006175 Bacteria 1413
69 Ga0075367_10047757 3300006178 Bacteria 2520
70 Ga0075369_10001777 3300006186 Bacteria 7496
71 Ga0075370_10437354 3300006353 Bacteria 786
72 Ga0068871_101869149 3300006358 Bacteria 571
73 Ga0097620_100277154 3300006931 Bacteria 1770
74 Ga0097620_101634636 3300006931 Bacteria 711
75 Ga0099822_1007736 3300006943 Bacteria 13838
76 Ga0099795_10126677 3300007788 Bacteria 1026
77 Ga0105240_10007060 3300009093 Bacteria 16374
78 Ga0105240_10062401 3300009093 Bacteria 4640
79 Ga0105240_10135203 3300009093 Bacteria 2953
80 Ga0105245_11850082 3300009098 Bacteria 657
81 Ga0105247_10172586 3300009101 Bacteria 1439
82 Ga0105241_10007430 3300009174 Bacteria 8067
83 Ga0105242_11483851 3300009176 Bacteria 708
84 Ga0105237_10084135 3300009545 Bacteria 3172
85 Ga0105238_10010839 3300009551 Bacteria 9161
86 Ga0105238_10070856 3300009551 Bacteria 3484
87 Ga0105238_10086869 3300009551 Bacteria 3115
88 Ga0105238_10095136 3300009551 Bacteria 2966
89 Ga0105239_10027444 3300010375 Bacteria 6268
90 Ga0105239_10046827 3300010375 Bacteria 4738
91 Ga0105239_10124511 3300010375 Bacteria 2864
92 Ga0105246_10317578 3300011119 Bacteria 1264
93 Ga0157369_10019064 3300013105 Bacteria 7681
94 Ga0157374_10323839 3300013296 Bacteria 1528
95 Ga0157378_12253697 3300013297 Bacteria 596
96 Ga0163162_12418974 3300013306 Bacteria 604
97 Ga0157375_11978812 3300013308 Bacteria 692
98 Ga0206356_11171809 3300020070 Bacteria 1195
99 Ga0206349_1726204 3300020075 Bacteria 635
100 Ga0206355_1115609 3300020076 Bacteria 519
101 Ga0206350_10301345 3300020080 Bacteria 858
102 Ga0224712_10390141 3300022467 Bacteria 662
103 Ga0209455_1004305 3300025272 Bacteria 4709
104 Ga0209564_1024656 3300025295 Bacteria 2050
105 Ga0209758_1041946 3300025297 Bacteria 1703
106 Ga0209758_1087717 3300025297 Bacteria 920
107 Ga0207656_10003999 3300025321 Bacteria 5110
108 Ga0207692_10009275 3300025898 Bacteria 4103
109 Ga0207692_10065785 3300025898 Bacteria 1893
110 Ga0207692_10376752 3300025898 Bacteria 880
111 Ga0207685_10002118 3300025905 Bacteria 4449
112 Ga0207685_10077566 3300025905 Bacteria 1365
113 Ga0207699_10006222 3300025906 Bacteria 5762
114 Ga0207699_10076033 3300025906 Bacteria 2067
115 Ga0207705_10021571 3300025909 Bacteria 4597
116 Ga0207705_10563217 3300025909 Bacteria 886
117 Ga0207705_10711523 3300025909 Bacteria 781
118 Ga0207654_10003171 3300025911 Bacteria 8305
119 Ga0207707_10002866 3300025912 Bacteria 15405
120 Ga0207695_10001756 3300025913 Bacteria 34405
121 Ga0207695_10126567 3300025913 Bacteria 2516
122 Ga0207695_10173526 3300025913 Bacteria 2080
123 Ga0207671_10008770 3300025914 Bacteria 8517
124 Ga0207671_10063149 3300025914 Bacteria 2752
125 Ga0207671_10132539 3300025914 Bacteria 1914
126 Ga0207693_10019068 3300025915 Bacteria 5459
127 Ga0207693_10030630 3300025915 Bacteria 4250
128 Ga0207693_10333973 3300025915 Bacteria 1186
129 Ga0207663_10006733 3300025916 Bacteria 5907
130 Ga0207663_10029912 3300025916 Bacteria 3206
131 Ga0207663_10678487 3300025916 Bacteria 815
132 Ga0207660_10034013 3300025917 Bacteria 3529
133 Ga0207660_10268925 3300025917 Bacteria 1350
134 Ga0207657_10022988 3300025919 Bacteria 5817
135 Ga0207649_10174380 3300025920 Bacteria 1500
136 Ga0207652_10008977 3300025921 Bacteria 8057
137 Ga0207694_10000306 3300025924 Bacteria 46009
138 Ga0207694_10037886 3300025924 Bacteria 3706
139 Ga0207694_10468790 3300025924 Bacteria 1052
140 Ga0207687_10654159 3300025927 Bacteria 889
141 Ga0207700_10030868 3300025928 Bacteria 3800
142 Ga0207700_10074638 3300025928 Bacteria 2624
143 Ga0207664_10025078 3300025929 Bacteria 4485
144 Ga0207664_10032846 3300025929 Bacteria 3981
145 Ga0207669_10888964 3300025937 Bacteria 743
146 Ga0207665_10004492 3300025939 Bacteria 9257
147 Ga0207665_10110751 3300025939 Bacteria 1929
148 Ga0207665_10175641 3300025939 Bacteria 1549
149 Ga0207665_10218868 3300025939 Bacteria 1395
150 Ga0207661_10021945 3300025944 Bacteria 4795
151 Ga0207667_10031163 3300025949 Bacteria 5759
152 Ga0207667_10073023 3300025949 Bacteria 3566
153 Ga0207667_10091253 3300025949 Bacteria 3147
154 Ga0207668_11803676 3300025972 Bacteria 552
155 Ga0207640_10008967 3300025981 Bacteria 5574
156 Ga0207703_10264293 3300026035 Bacteria 1556
157 Ga0207703_10568180 3300026035 Bacteria 1070
158 Ga0207639_10063626 3300026041 Bacteria 2857
159 Ga0207639_10071852 3300026041 Bacteria 2708
160 Ga0207639_10339995 3300026041 Bacteria 1338
161 Ga0207678_10042270 3300026067 Bacteria 3949
162 Ga0207678_10256331 3300026067 Bacteria 1499
163 Ga0207678_10277465 3300026067 Bacteria 1438
164 Ga0207702_10000122 3300026078 Bacteria 91685
165 Ga0207702_11583646 3300026078 Bacteria 648
166 Ga0207641_10885117 3300026088 Bacteria 886
167 Ga0207676_10133421 3300026095 Bacteria 2115
168 Ga0207674_10002532 3300026116 Bacteria 23029
169 Ga0207674_10022648 3300026116 Bacteria 6742
170 Ga0207683_10108572 3300026121 Bacteria 2483
171 Ga0207698_10019924 3300026142 Bacteria 4605
172 Ga0209589_1000017 3300027357 Bacteria 215546
173 Ga0209489_100018 3300027361 Bacteria 215546
174 Ga0209700_100028 3300027363 Bacteria 215546
175 Ga0209179_1018605 3300027512 Bacteria 1329
176 Ga0268264_10000187 3300028381 Bacteria 129270
177 Ga0268264_11851302 3300028381 Bacteria 613
178 Ga0265337_1044224 3300028556 Bacteria 1271
179 Ga0265326_10084049 3300028558 Bacteria 900
180 Ga0265334_10000741 3300028573 Bacteria 16339
181 Ga0265334_10027190 3300028573 Bacteria 2306
182 Ga0265323_10001701 3300028653 Bacteria 10499
183 Ga0265322_10025296 3300028654 Bacteria 1698
184 Ga0265336_10001237 3300028666 Bacteria 12134
185 Ga0265338_10000973 3300028800 Bacteria 48208
186 Ga0265324_10003799 3300029957 Bacteria 7055
187 Ga0307511_10061000 3300030521 Bacteria 2878
188 Ga0265330_10051564 3300031235 Bacteria 1804
189 Ga0265332_10021522 3300031238 Bacteria 2848
190 Ga0265332_10049596 3300031238 Bacteria 1805
191 Ga0265325_10125720 3300031241 Bacteria 1232
192 Ga0265340_10017258 3300031247 Bacteria 3731
193 Ga0265331_10078793 3300031250 Bacteria 1533
194 Ga0307509_10126290 3300031507 Bacteria 2523
195 Ga0307509_10517575 3300031507 Bacteria 875
196 Ga0265313_10360399 3300031595 Bacteria 575
197 Ga0307508_10786124 3300031616 Bacteria 567
198 Ga0265314_10031666 3300031711 Bacteria 3900
199 Ga0307516_10063860 3300031730 Bacteria 3563
200 Ga0307507_10018905 3300033179 Bacteria 7802
201 Ga0307510_10143717 3300033180 Bacteria 2023
202 Ga0373934_0015896 3300035086 Bacteria 2859
203 Ga0373944_0271976 3300035089 Bacteria 630
204 Ga0373923_0035240 3300035111 Bacteria 2036
205 Ga0373936_0004091 3300035113 Bacteria 5492
206 Ga0373936_0111227 3300035113 Bacteria 1163
207 Ga0373945_0009977 3300035116 Bacteria 3121
208 Ga0373953_0266618 3300035117 Bacteria 745
209 Ga0373954_0000182 3300035118 Bacteria 22786
210 Ga0373954_0003353 3300035118 Bacteria 6778
211 Ga0373956_0001338 3300035119 Bacteria 10168
212 Ga0373956_0014646 3300035119 Bacteria 3278
213 Ga0373957_0025359 3300035120 Bacteria 2135
214 Ga0373957_0057189 3300035120 Bacteria 1503
215 Ga0373943_0006957 3300035170 Bacteria 5074
216 Ga0373946_0002329 3300035171 Bacteria 6718
217 Ga0373955_0000471 3300035172 Bacteria 16944
218 Ga0373955_0051688 3300035172 Bacteria 2239
219 Ga0373955_0064514 3300035172 Bacteria 2030
220 Ga0373924_0001162 3300035410 Bacteria 8447
221 Ga0373924_0009471 3300035410 Bacteria 3569
222 Ga0373924_0238457 3300035410 Bacteria 804
223 Ga0373931_0040944 3300035691 Bacteria 2433
224 Ga0373931_0479679 3300035691 Bacteria 799
225 Ga0373935_0000128 3300035692 Bacteria 34347
226 Ga0373935_0114065 3300035692 Bacteria 1797
227 Ga0373935_0392811 3300035692 Bacteria 995
228 Ga0373927_0000496 3300035695 Bacteria 29963
229 Ga0373933_0002736 3300035724 Bacteria 9861
230 Ga0373933_0034822 3300035724 Bacteria 2937
231 Ga0373933_0051535 3300035724 Bacteria 2461
232 Ga0373933_0213213 3300035724 Bacteria 1238
233 Ga0373947_0008482 3300035725 Bacteria 5918
234 Ga0373947_0555608 3300035725 Bacteria 781
235 Ga0373937_0003217 3300036401 Bacteria 13678
236 Ga0373937_0015775 3300036401 Bacteria 6693
237 Ga0373937_0196802 3300036401 Bacteria 1894
238 Ga0373937_0240251 3300036401 Bacteria 1706
239 Ga0373937_1087381 3300036401 Bacteria 748
240 Ga0373925_0015739 3300037068 Bacteria 5475
241 Ga0373925_0073061 3300037068 Bacteria 2595
242 Ga0395900_0875423 3300037418 Bacteria 823
243 Ga0395905_0205865 3300037471 Bacteria 1844
244 Ga0395905_0591942 3300037471 Bacteria 1011
245 Ga0436364_0094446 3300037853 Bacteria 795
246 Ga0395901_1135916 3300038443 Bacteria 750
247 Ga0436365_1268186 3300039437 Bacteria 4131
248 Ga0436360_0429907 3300039438 Bacteria 2771
249 Ga0436360_1325456 3300039438 Bacteria 2788
250 Ga0436361_0223475 3300039447 Bacteria 2753
251 Ga0436361_0774833 3300039447 Bacteria 1128
252 Ga0436362_0859242 3300039453 Bacteria 600
253 Ga0436362_0946533 3300039453 Bacteria 847
254 Ga0451802_0230462 3300041460 Bacteria 946
255 Ga0466965_0923864 3300044683 Bacteria 510
256 Ga0466964_0094499 3300044706 Bacteria 1307
257 Ga0466957_0305467 3300044842 Bacteria 1070
258 Ga0466959_0015647 3300045049 Bacteria 5531
259 Ga0466967_0482196 3300045976 Bacteria 1215
260 Ga0466967_1355622 3300045976 Bacteria 708
261 Ga0466967_1619590 3300045976 Bacteria 645
262 Ga0495592_0002891 3300046454 Bacteria 12215
263 Ga0495592_0039101 3300046454 Bacteria 3565
264 Ga0495592_0040558 3300046454 Bacteria 3494
265 Ga0495592_0560981 3300046454 Bacteria 701
266 Ga0495603_0000104 3300046455 Bacteria 39821
267 Ga0495603_0015633 3300046455 Bacteria 4593
268 Ga0495629_0003421 3300046459 Bacteria 12007
269 Ga0495629_0005026 3300046459 Bacteria 9912
270 Ga0495629_0056115 3300046459 Bacteria 2754
271 Ga0495641_0000402 3300046461 Bacteria 36037
272 Ga0495651_0005264 3300046462 Bacteria 9861
273 Ga0495651_0147618 3300046462 Bacteria 1698
274 Ga0495651_0300041 3300046462 Bacteria 1078
275 Ga0495653_0013740 3300046463 Bacteria 6598
276 Ga0495653_0297345 3300046463 Bacteria 1054
277 Ga0495580_0001155 3300046472 Bacteria 23222
278 Ga0495582_0000063 3300046473 Bacteria 54381
279 Ga0495639_0000485 3300046475 Bacteria 18953
280 Ga0495639_0372364 3300046475 Bacteria 719
281 Ga0495662_0002193 3300046476 Bacteria 9829
282 Ga0495664_0006710 3300046477 Bacteria 6366
283 Ga0495664_0009975 3300046477 Bacteria 5329
284 Ga0495664_0099029 3300046477 Bacteria 1756
285 Ga0495664_0361549 3300046477 Bacteria 873
286 Ga0495594_0000237 3300046499 Bacteria 26610
287 Ga0495606_0016180 3300046507 Bacteria 5701
288 Ga0495606_0107261 3300046507 Bacteria 1690
289 Ga0495608_0002114 3300046511 Bacteria 14307
290 Ga0495608_0060344 3300046511 Bacteria 2495
291 Ga0495610_0262072 3300046512 Bacteria 680
292 Ga0495618_0035692 3300046514 Bacteria 3121
293 Ga0495618_0050270 3300046514 Bacteria 2633
294 Ga0495628_0022416 3300046516 Bacteria 5187
295 Ga0495628_0027898 3300046516 Bacteria 4590
296 Ga0495628_0031986 3300046516 Bacteria 4251
297 Ga0495630_0010844 3300046517 Bacteria 6581
298 Ga0495648_0001804 3300046524 Bacteria 20615
299 Ga0495666_0029596 3300046526 Bacteria 2694
300 Ga0495652_0010548 3300046529 Bacteria 8372
301 Ga0495652_0032738 3300046529 Bacteria 4543
302 Ga0495652_0045970 3300046529 Bacteria 3750
303 Ga0495652_0805709 3300046529 Bacteria 625
304 Ga0495665_0000290 3300046531 Bacteria 25439
305 Ga0495640_0009118 3300046533 Bacteria 7744
306 Ga0495640_0031188 3300046533 Bacteria 3806
307 Ga0495586_0252577 3300046535 Bacteria 1006
308 Ga0495587_0000403 3300046536 Bacteria 30588
309 Ga0495587_0113348 3300046536 Bacteria 1556
310 Ga0495597_0126537 3300046542 Bacteria 1062
311 Ga0495645_0014513 3300046543 Bacteria 5592
312 Ga0495645_0049441 3300046543 Bacteria 3062
313 Ga0495667_0007602 3300046559 Bacteria 7356
314 Ga0495667_0089543 3300046559 Bacteria 1994
315 Ga0495667_0343422 3300046559 Bacteria 943
316 Ga0495634_0000645 3300046642 Bacteria 33906
317 Ga0495634_0021792 3300046642 Bacteria 4523
318 Ga0495634_0160612 3300046642 Bacteria 1417
319 Ga0495635_0000640 3300046663 Bacteria 22461
320 Ga0495635_0003816 3300046663 Bacteria 10469
321 Ga0495635_0032026 3300046663 Bacteria 3649
322 Ga0495588_0046078 3300046674 Bacteria 2236
323 Ga0495657_0001964 3300046675 Bacteria 17524
324 Ga0495657_0028500 3300046675 Bacteria 3926
325 Ga0495599_0002959 3300046678 Bacteria 9885
326 Ga0495599_0031426 3300046678 Bacteria 3332
327 Ga0495623_0003813 3300046679 Bacteria 9940
328 Ga0495623_0025187 3300046679 Bacteria 3832
329 Ga0495623_0311513 3300046679 Bacteria 867
330 Ga0495646_0003545 3300046680 Bacteria 9724
331 Ga0495646_0128944 3300046680 Bacteria 1425
332 Ga0495646_0153505 3300046680 Bacteria 1279
333 Ga0495646_0602571 3300046680 Bacteria 558
334 Ga0495647_0003293 3300046681 Bacteria 5171
335 Ga0495658_0000702 3300046683 Bacteria 18142
336 Ga0495658_0096792 3300046683 Bacteria 1756
337 Ga0495613_0001448 3300046689 Bacteria 18103
338 Ga0495613_0027327 3300046689 Bacteria 4246
339 Ga0495613_0216911 3300046689 Bacteria 1344
340 Ga0495624_0000224 3300046690 Bacteria 44228
341 Ga0495600_0000221 3300046809 Bacteria 32170
342 Ga0495600_0018058 3300046809 Bacteria 4491
343 Ga0495600_0023763 3300046809 Bacteria 3944
344 Ga0495581_0000168 3300047315 Bacteria 29532
345 Ga0495581_0315687 3300047315 Bacteria 913
346 Ga0495604_0002152 3300047317 Bacteria 15820
347 Ga0495604_0046928 3300047317 Bacteria 3366
348 Ga0495604_0240865 3300047317 Bacteria 1237
349 Ga0495674_0001107 3300047319 Bacteria 25900
350 Ga0495674_0143308 3300047319 Bacteria 2007
351 Ga0495672_0033888 3300047320 Bacteria 3161
352 Ga0495672_0199822 3300047320 Bacteria 1000
353 Ga0495676_0018811 3300047321 Bacteria 6089
354 Ga0495680_0002034 3300047322 Bacteria 21172
355 Ga0495680_0040194 3300047322 Bacteria 3727
356 Ga0495680_0553935 3300047322 Bacteria 774
357 Ga0495675_0000445 3300047444 Bacteria 27423
358 Ga0495675_0020836 3300047444 Bacteria 4172
359 Ga0495685_267875 3300047447 Bacteria 540
360 Ga0495684_0002603 3300047471 Bacteria 14332
361 Ga0495684_0004946 3300047471 Bacteria 10410
362 Ga0495684_0134305 3300047471 Bacteria 1857
363 Ga0495686_0048766 3300047472 Bacteria 2668
364 Ga0495686_0078897 3300047472 Bacteria 2014
365 Ga0495593_0000150 3300047673 Bacteria 34569
366 Ga0495593_0004768 3300047673 Bacteria 8059
367 Ga0495602_0000907 3300048088 Bacteria 28629
368 Ga0496102_0278346 3300048905 Bacteria 1577
369 Ga0496102_0391979 3300048905 Bacteria 1306
370 Ga0496102_1177185 3300048905 Bacteria 686
371 Ga0496103_0832265 3300048906 Bacteria 581
372 Ga0496106_0051866 3300048909 Bacteria 3093
373 Ga0496107_1220151 3300048910 Bacteria 540
374 Ga0496108_1073354 3300048911 Bacteria 685
375 Ga0496110_1337607 3300048913 Bacteria 626
376 Ga0496112_0000055 3300048915 Bacteria 78086
377 Ga0496112_0203342 3300048915 Bacteria 1939
378 Ga0496113_0469326 3300048916 Bacteria 1011
379 Ga0496115_0116418 3300048918 Bacteria 2198
380 Ga0496115_0199416 3300048918 Bacteria 1653
381 Ga0496115_0576157 3300048918 Bacteria 897
382 Ga0496116_0155069 3300048919 Bacteria 1265
383 Ga0496117_0045829 3300048920 Bacteria 3153
384 Ga0496118_0034047 3300048921 Bacteria 4166
385 Ga0496119_0148036 3300048922 Bacteria 1261
386 Ga0496119_0378252 3300048922 Bacteria 680
387 Ga0496119_0427958 3300048922 Bacteria 627
388 Ga0496121_0000144 3300048924 Bacteria 156856
389 Ga0496121_0004170 3300048924 Bacteria 19757
390 Ga0496121_0278555 3300048924 Bacteria 1145
391 Ga0496121_0660622 3300048924 Bacteria 635
392 Ga0496124_0017792 3300048927 Bacteria 6684
393 Ga0496124_0572384 3300048927 Bacteria 741
394 Ga0496125_0022857 3300048928 Bacteria 5793
395 Ga0496125_0119128 3300048928 Bacteria 1888
396 Ga0496126_0008346 3300048929 Bacteria 11179
397 Ga0496126_0035928 3300048929 Bacteria 4638
398 Ga0496126_0041909 3300048929 Bacteria 4232
399 Ga0496126_0122019 3300048929 Bacteria 2259
400 Ga0496126_0411985 3300048929 Bacteria 1094
401 Ga0501044_0985508 3300049823 Bacteria 715
402 nmdc:mga00v17_491735_c1 3300050491 Bacteria 796
403 nmdc:mga0yw44_152593_c1 3300050492 Bacteria 1508
404 nmdc:mga0yw44_82275_c1 3300050492 Bacteria 2020
405 nmdc:mga06z11_84328_c1 3300050494 Bacteria 1712
406 nmdc:mga07m45_108563_c1 3300050496 Bacteria 1286
407 Ga0495601_0064289 3300053077 Bacteria 2333
408 Ga0495601_0066561 3300053077 Bacteria 2293
409 Ga0495601_0185006 3300053077 Bacteria 1362
410 Ga0495601_0237155 3300053077 Bacteria 1191
411 Ga0495601_0285683 3300053077 Bacteria 1075
412 Ga0495612_0018607 3300053078 Bacteria 2781
413 Ga0495612_0060034 3300053078 Bacteria 1574
414 Ga0500635_0057276 3300053080 Bacteria 1350
415 Ga0495655_0071330 3300053083 Bacteria 972
416 Ga0495595_0002289 3300053084 Bacteria 7457
417 Ga0495619_0002350 3300053085 Bacteria 12447
418 Ga0495619_0101356 3300053085 Bacteria 1960
419 Ga0495619_0755060 3300053085 Bacteria 659
420 Ga0500566_0218854 3300053094 Bacteria 948
421 Ga0500654_106898 3300053099 Bacteria 1165
422 Ga0500554_013616 3300053102 Bacteria 2078
423 Ga0500572_010059 3300053111 Bacteria 2252
424 Ga0500595_002699 3300053119 Bacteria 8602
425 Ga0500607_134502 3300053121 Bacteria 1173
426 Ga0500618_022754 3300053125 Bacteria 1521
427 Ga0500559_0000992 3300053136 Bacteria 17693
428 Ga0500559_0072040 3300053136 Bacteria 1557
429 Ga0500586_001179 3300053145 Bacteria 5444
430 Ga0500590_212767 3300053148 Bacteria 805
431 Ga0500603_000276 3300053150 Bacteria 13561
432 Ga0500616_0299144 3300053153 Bacteria 669
433 Ga0500619_050114 3300053154 Bacteria 1349
434 Ga0500639_081947 3300053163 Bacteria 1623
435 Ga0500636_0153080 3300053177 Bacteria 1264
436 Ga0500636_0418279 3300053177 Bacteria 616
437 Ga0500637_0007975 3300053178 Bacteria 5318
438 Ga0500567_235480 3300053723 Bacteria 563
439 Ga0500596_007683 3300053735 Bacteria 1751
440 Ga0075365_10070484
441 JGI24740J21852_10007987
442 rootH2_10001332
443 Ga0070658_10030203
444 Ga0070683_100386059
445 Ga0070680_101148200
446 Ga0070691_10550382
447 Ga0070661_100045073
448 Ga0070668_102206620
449 Ga0070671_100538437
450 Ga0070674_100326707
451 Ga0070673_100125643
452 Ga0070709_10036395
453 Ga0070709_10175575
454 Ga0070714_100055768
455 Ga0070714_100059484
456 Ga0070713_100008883
457 Ga0070713_100069679
458 Ga0070710_10001420
459 Ga0070710_10031680
460 Ga0070711_100030010
461 Ga0070711_100044636
462 Ga0070711_100072877
463 Ga0070711_100262338
464 Ga0070663_100040881
465 Ga0070663_100241688
466 Ga0070663_100828538
467 Ga0070678_100166571
468 Ga0070684_100006416
469 Ga0068853_100038695
470 Ga0068853_100106387
471 Ga0068853_100473669
472 Ga0070693_101252241
473 Ga0068855_100052955
474 Ga0068855_100163441
475 Ga0068855_100351875
476 Ga0068855_100411952
477 Ga0068855_100619338
478 Ga0068857_100004936
479 Ga0068857_100026544
480 Ga0068854_100079504
481 Ga0068856_100015417
482 Ga0068852_100144033
483 Ga0068852_100779030
484 Ga0068859_100277155
485 Ga0068864_100862284
486 Ga0068864_102232086
487 Ga0068851_10007470
488 Ga0068863_100577797
489 Ga0068858_100440553
490 Ga0068858_100599432
491 Ga0068860_100002621
492 Ga0068860_101476148
493 Ga0068860_101819906
494 Ga0081540_1241785
495 Ga0081539_10000040
496 Ga0070717_10034234
497 Ga0070717_10302312
498 Ga0075363_100078867
499 Ga0075363_100210886
500 Ga0070715_10015304
501 Ga0070715_10182746
502 Ga0070716_100077900
503 Ga0070716_100238167
504 Ga0070716_100773836
505 Ga0070712_100024001
506 Ga0070712_100061388
507 Ga0070712_100251333
508 Ga0075367_10047757
509 Ga0075369_10001777
510 Ga0075370_10437354
511 Ga0068871_101869149
512 Ga0097620_100277154
513 Ga0097620_101634636
514 Ga0099822_1007736
515 Ga0099795_10126677
516 Ga0105240_10007060
517 Ga0105240_10062401
518 Ga0105240_10135203
519 Ga0105245_11850082
520 Ga0105247_10172586
521 Ga0105241_10007430
522 Ga0105242_11483851
523 Ga0105237_10084135
524 Ga0105238_10010839
525 Ga0105238_10070856
526 Ga0105238_10086869
527 Ga0105238_10095136
528 Ga0105239_10027444
529 Ga0105239_10046827
530 Ga0105239_10124511
531 Ga0105246_10317578
532 Ga0157369_10019064
533 Ga0157374_10323839
534 Ga0157378_12253697
535 Ga0163162_12418974
536 Ga0157375_11978812
537 Ga0206356_11171809
538 Ga0206349_1726204
539 Ga0206355_1115609
540 Ga0206350_10301345
541 Ga0224712_10390141
542 Ga0209455_1004305
543 Ga0209564_1024656
544 Ga0209758_1041946
545 Ga0209758_1087717
546 Ga0207656_10003999
547 Ga0207692_10009275
548 Ga0207692_10065785
549 Ga0207692_10376752
550 Ga0207685_10002118
551 Ga0207685_10077566
552 Ga0207699_10006222
553 Ga0207699_10076033
554 Ga0207705_10021571
555 Ga0207705_10563217
556 Ga0207705_10711523
557 Ga0207654_10003171
558 Ga0207707_10002866
559 Ga0207695_10001756
560 Ga0207695_10126567
561 Ga0207695_10173526
562 Ga0207671_10008770
563 Ga0207671_10063149
564 Ga0207671_10132539
565 Ga0207693_10019068
566 Ga0207693_10030630
567 Ga0207693_10333973
568 Ga0207663_10006733
569 Ga0207663_10029912
570 Ga0207663_10678487
571 Ga0207660_10034013
572 Ga0207660_10268925
573 Ga0207657_10022988
574 Ga0207649_10174380
575 Ga0207652_10008977
576 Ga0207694_10000306
577 Ga0207694_10037886
578 Ga0207694_10468790
579 Ga0207687_10654159
580 Ga0207700_10030868
581 Ga0207700_10074638
582 Ga0207664_10025078
583 Ga0207664_10032846
584 Ga0207669_10888964
585 Ga0207665_10004492
586 Ga0207665_10110751
587 Ga0207665_10175641
588 Ga0207665_10218868
589 Ga0207661_10021945
590 Ga0207667_10031163
591 Ga0207667_10073023
592 Ga0207667_10091253
593 Ga0207668_11803676
594 Ga0207640_10008967
595 Ga0207703_10264293
596 Ga0207703_10568180
597 Ga0207639_10063626
598 Ga0207639_10071852
599 Ga0207639_10339995
600 Ga0207678_10042270
601 Ga0207678_10256331
602 Ga0207678_10277465
603 Ga0207702_10000122
604 Ga0207702_11583646
605 Ga0207641_10885117
606 Ga0207676_10133421
607 Ga0207674_10002532
608 Ga0207674_10022648
609 Ga0207683_10108572
610 Ga0207698_10019924
611 Ga0209589_1000017
612 Ga0209489_100018
613 Ga0209700_100028
614 Ga0209179_1018605
615 Ga0268264_10000187
616 Ga0268264_11851302
617 Ga0265337_1044224
618 Ga0265326_10084049
619 Ga0265334_10000741
620 Ga0265334_10027190
621 Ga0265323_10001701
622 Ga0265322_10025296
623 Ga0265336_10001237
624 Ga0265338_10000973
625 Ga0265324_10003799
626 Ga0307511_10061000
627 Ga0265330_10051564
628 Ga0265332_10021522
629 Ga0265332_10049596
630 Ga0265325_10125720
631 Ga0265340_10017258
632 Ga0265331_10078793
633 Ga0307509_10126290
634 Ga0307509_10517575
635 Ga0265313_10360399
636 Ga0307508_10786124
637 Ga0265314_10031666
638 Ga0307516_10063860
639 Ga0307507_10018905
640 Ga0307510_10143717
641 Ga0373934_0015896
642 Ga0373944_0271976
643 Ga0373923_0035240
644 Ga0373936_0004091
645 Ga0373936_0111227
646 Ga0373945_0009977
647 Ga0373953_0266618
648 Ga0373954_0000182
649 Ga0373954_0003353
650 Ga0373956_0001338
651 Ga0373956_0014646
652 Ga0373957_0025359
653 Ga0373957_0057189
654 Ga0373943_0006957
655 Ga0373946_0002329
656 Ga0373955_0000471
657 Ga0373955_0051688
658 Ga0373955_0064514
659 Ga0373924_0001162
660 Ga0373924_0009471
661 Ga0373924_0238457
662 Ga0373931_0040944
663 Ga0373931_0479679
664 Ga0373935_0000128
665 Ga0373935_0114065
666 Ga0373935_0392811
667 Ga0373927_0000496
668 Ga0373933_0002736
669 Ga0373933_0034822
670 Ga0373933_0051535
671 Ga0373933_0213213
672 Ga0373947_0008482
673 Ga0373947_0555608
674 Ga0373937_0003217
675 Ga0373937_0015775
676 Ga0373937_0196802
677 Ga0373937_0240251
678 Ga0373937_1087381
679 Ga0373925_0015739
680 Ga0373925_0073061
681 Ga0395900_0875423
682 Ga0395905_0205865
683 Ga0395905_0591942
684 Ga0436364_0094446
685 Ga0395901_1135916
686 Ga0436365_1268186
687 Ga0436360_0429907
688 Ga0436360_1325456
689 Ga0436361_0223475
690 Ga0436361_0774833
691 Ga0436362_0859242
692 Ga0436362_0946533
693 Ga0451802_0230462
694 Ga0466965_0923864
695 Ga0466964_0094499
696 Ga0466957_0305467
697 Ga0466959_0015647
698 Ga0466967_0482196
699 Ga0466967_1355622
700 Ga0466967_1619590
701 Ga0495592_0002891
702 Ga0495592_0039101
703 Ga0495592_0040558
704 Ga0495592_0560981
705 Ga0495603_0000104
706 Ga0495603_0015633
707 Ga0495629_0003421
708 Ga0495629_0005026
709 Ga0495629_0056115
710 Ga0495641_0000402
711 Ga0495651_0005264
712 Ga0495651_0147618
713 Ga0495651_0300041
714 Ga0495653_0013740
715 Ga0495653_0297345
716 Ga0495580_0001155
717 Ga0495582_0000063
718 Ga0495639_0000485
719 Ga0495639_0372364
720 Ga0495662_0002193
721 Ga0495664_0006710
722 Ga0495664_0009975
723 Ga0495664_0099029
724 Ga0495664_0361549
725 Ga0495594_0000237
726 Ga0495606_0016180
727 Ga0495606_0107261
728 Ga0495608_0002114
729 Ga0495608_0060344
730 Ga0495610_0262072
731 Ga0495618_0035692
732 Ga0495618_0050270
733 Ga0495628_0022416
734 Ga0495628_0027898
735 Ga0495628_0031986
736 Ga0495630_0010844
737 Ga0495648_0001804
738 Ga0495666_0029596
739 Ga0495652_0010548
740 Ga0495652_0032738
741 Ga0495652_0045970
742 Ga0495652_0805709
743 Ga0495665_0000290
744 Ga0495640_0009118
745 Ga0495640_0031188
746 Ga0495586_0252577
747 Ga0495587_0000403
748 Ga0495587_0113348
749 Ga0495597_0126537
750 Ga0495645_0014513
751 Ga0495645_0049441
752 Ga0495667_0007602
753 Ga0495667_0089543
754 Ga0495667_0343422
755 Ga0495634_0000645
756 Ga0495634_0021792
757 Ga0495634_0160612
758 Ga0495635_0000640
759 Ga0495635_0003816
760 Ga0495635_0032026
761 Ga0495588_0046078
762 Ga0495657_0001964
763 Ga0495657_0028500
764 Ga0495599_0002959
765 Ga0495599_0031426
766 Ga0495623_0003813
767 Ga0495623_0025187
768 Ga0495623_0311513
769 Ga0495646_0003545
770 Ga0495646_0128944
771 Ga0495646_0153505
772 Ga0495646_0602571
773 Ga0495647_0003293
774 Ga0495658_0000702
775 Ga0495658_0096792
776 Ga0495613_0001448
777 Ga0495613_0027327
778 Ga0495613_0216911
779 Ga0495624_0000224
780 Ga0495600_0000221
781 Ga0495600_0018058
782 Ga0495600_0023763
783 Ga0495581_0000168
784 Ga0495581_0315687
785 Ga0495604_0002152
786 Ga0495604_0046928
787 Ga0495604_0240865
788 Ga0495674_0001107
789 Ga0495674_0143308
790 Ga0495672_0033888
791 Ga0495672_0199822
792 Ga0495676_0018811
793 Ga0495680_0002034
794 Ga0495680_0040194
795 Ga0495680_0553935
796 Ga0495675_0000445
797 Ga0495675_0020836
798 Ga0495685_267875
799 Ga0495684_0002603
800 Ga0495684_0004946
801 Ga0495684_0134305
802 Ga0495686_0048766
803 Ga0495686_0078897
804 Ga0495593_0000150
805 Ga0495593_0004768
806 Ga0495602_0000907
807 Ga0496102_0278346
808 Ga0496102_0391979
809 Ga0496102_1177185
810 Ga0496103_0832265
811 Ga0496106_0051866
812 Ga0496107_1220151
813 Ga0496108_1073354
814 Ga0496110_1337607
815 Ga0496112_0000055
816 Ga0496112_0203342
817 Ga0496113_0469326
818 Ga0496115_0116418
819 Ga0496115_0199416
820 Ga0496115_0576157
821 Ga0496116_0155069
822 Ga0496117_0045829
823 Ga0496118_0034047
824 Ga0496119_0148036
825 Ga0496119_0378252
826 Ga0496119_0427958
827 Ga0496121_0000144
828 Ga0496121_0004170
829 Ga0496121_0278555
830 Ga0496121_0660622
831 Ga0496124_0017792
832 Ga0496124_0572384
833 Ga0496125_0022857
834 Ga0496125_0119128
835 Ga0496126_0008346
836 Ga0496126_0035928
837 Ga0496126_0041909
838 Ga0496126_0122019
839 Ga0496126_0411985
840 Ga0501044_0985508
841 nmdc:mga00v17_491735_c1
842 nmdc:mga0yw44_152593_c1
843 nmdc:mga0yw44_82275_c1
844 nmdc:mga06z11_84328_c1
845 nmdc:mga07m45_108563_c1
846 Ga0495601_0064289
847 Ga0495601_0066561
848 Ga0495601_0185006
849 Ga0495601_0237155
850 Ga0495601_0285683
851 Ga0495612_0018607
852 Ga0495612_0060034
853 Ga0500635_0057276
854 Ga0495655_0071330
855 Ga0495595_0002289
856 Ga0495619_0002350
857 Ga0495619_0101356
858 Ga0495619_0755060
859 Ga0500566_0218854
860 Ga0500654_106898
861 Ga0500554_013616
862 Ga0500572_010059
863 Ga0500595_002699
864 Ga0500607_134502
865 Ga0500618_022754
866 Ga0500559_0000992
867 Ga0500559_0072040
868 Ga0500586_001179
869 Ga0500590_212767
870 Ga0500603_000276
871 Ga0500616_0299144
872 Ga0500619_050114
873 Ga0500639_081947
874 Ga0500636_0153080
875 Ga0500636_0418279
876 Ga0500637_0007975
877 Ga0500567_235480
878 Ga0500596_007683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00825

Ribonuclease_P

Ribonuclease P

1

106

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.8265 8 106
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.8254 8 106
6ov1-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity 0.8146 7 106
6d1r-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein at 2.0 angstrom 0.7998 8 104
1nz0-assembly11.cif.gz_B rnase p protein from thermotoga maritima 0.7867 1 104
ID Description Score Start End Superfamily
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8757 8 108 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8265 8 106 3.30.230.10
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7998 8 104 3.30.230.10
1nz0C00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7885 5 104 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7835 8 108 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A1Q3K9T9-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9598 6 107 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A7W7B0F5-F1-model_v4 Ribonuclease P protein component (EC 3.1.26.5) 0.9516 20 107 GO:0000049
GO:0004526
GO:0030677
GO:0042781
AF-A0A2A4LLV0-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9487 7 108 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A2D7T2T1-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9484 8 106 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A7C5R871-F1-model_v4 Ribonuclease P protein component (EC 3.1.26.5) 0.9475 15 105 GO:0000049
GO:0004526
GO:0030677
GO:0042781

Map