F444096

General Info

Members Datasets Scaffolds Average Seq Length
438 245 430 217

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0034107|Ga0500568_0034107_983_1645
Length 220
Sequence MTNRLALFDCDGTLVDSQANICQSMEEAFQLGGLVAPERSAIRRIIGLSVVEAIAALSPELDDARHRTLAEEYKASFFRLRASGAMEEEPLFDGMIAALDALAKAGWLFGVATGKSDRGLARILAHHGIADRFVTLQTADRHPSKPHPSMVELAMAEAGASPETTVMIGDTSYDMMMGRAAGTRALGVAWGYHPPEELHAAGAHAVAETVASLPAHMETV

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
8 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
9 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
228 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
229 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
230 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
231 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
232 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
238 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
239 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
240 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 0.46
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 2.05
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008003 3300001979 Bacteria 4250
2 JGI24739J22299_10079499 3300001989 Bacteria 1009
3 JGI24737J22298_10036420 3300001990 Bacteria 1519
4 JGI24735J21928_10006017 3300002067 Bacteria 4010
5 JGI24735J21928_10015098 3300002067 Bacteria 2413
6 JGI24735J21928_10052464 3300002067 Bacteria 1176
7 JGI24738J21930_10000862 3300002075 Bacteria 8714
8 JGI24738J21930_10008667 3300002075 Bacteria 2310
9 JGI24738J21930_10015637 3300002075 Bacteria 1611
10 JGI24749J21850_1000352 3300002076 Bacteria 6855
11 JGI24751J29686_10000208 3300002459 Bacteria 25368
12 rootH1_10096314 3300003316 Bacteria 1563
13 rootH1_10096314 3300003323 Bacteria 2650
14 Ga0065707_10242376 3300005295 Bacteria 1151
15 Ga0070658_10000106 3300005327 Bacteria 74827
16 Ga0070658_10009822 3300005327 Bacteria 7688
17 Ga0070658_10228111 3300005327 Bacteria 1576
18 Ga0070658_10429868 3300005327 Bacteria 1136
19 Ga0070676_10000539 3300005328 Bacteria 18309
20 Ga0070683_100008964 3300005329 Bacteria 8527
21 Ga0070670_100000024 3300005331 Bacteria 189811
22 Ga0070670_100000027 3300005331 Bacteria 186072
23 Ga0070670_100043672 3300005331 Bacteria 3853
24 Ga0070670_100179018 3300005331 Bacteria 1840
25 Ga0068869_100000897 3300005334 Bacteria 17161
26 Ga0070666_10208694 3300005335 Bacteria 1375
27 Ga0070680_100014541 3300005336 Bacteria 6158
28 Ga0070680_100203080 3300005336 Bacteria 1672
29 Ga0068868_100000016 3300005338 Bacteria 102357
30 Ga0070660_100001721 3300005339 Bacteria 14994
31 Ga0070660_100012845 3300005339 Bacteria 5989
32 Ga0070660_100024601 3300005339 Bacteria 4467
33 Ga0070660_100035885 3300005339 Bacteria 3753
34 Ga0070660_100298154 3300005339 Bacteria 1321
35 Ga0070660_100342420 3300005339 Bacteria 1230
36 Ga0070661_100009749 3300005344 Bacteria 6658
37 Ga0070661_100060699 3300005344 Bacteria 2774
38 Ga0070661_100122473 3300005344 Bacteria 1949
39 Ga0070661_100525945 3300005344 Bacteria 949
40 Ga0070692_10036566 3300005345 Bacteria 2492
41 Ga0070668_100000027 3300005347 Bacteria 89913
42 Ga0070669_100000047 3300005353 Bacteria 118892
43 Ga0070669_100022152 3300005353 Bacteria 4544
44 Ga0070669_100176901 3300005353 Bacteria 1667
45 Ga0070671_100000517 3300005355 Bacteria 27085
46 Ga0070671_100045799 3300005355 Bacteria 3637
47 Ga0070674_100010143 3300005356 Bacteria 5677
48 Ga0070673_100000017 3300005364 Bacteria 112829
49 Ga0070659_100010665 3300005366 Bacteria 6767
50 Ga0070659_100092203 3300005366 Bacteria 2429
51 Ga0070659_100115805 3300005366 Bacteria 2166
52 Ga0070659_100129198 3300005366 Bacteria 2051
53 Ga0070659_100234503 3300005366 Bacteria 1517
54 Ga0070667_100000017 3300005367 Bacteria 230531
55 Ga0070667_100000143 3300005367 Bacteria 90358
56 Ga0070667_100005804 3300005367 Bacteria 10302
57 Ga0070667_100009122 3300005367 Bacteria 8209
58 Ga0070709_10186278 3300005434 Bacteria 1461
59 Ga0070714_100013377 3300005435 Bacteria 6577
60 Ga0070713_100848387 3300005436 Bacteria 877
61 Ga0070700_100542189 3300005441 Bacteria 902
62 Ga0070708_100136957 3300005445 Bacteria 2269
63 Ga0070663_100000796 3300005455 Bacteria 17138
64 Ga0070663_100119062 3300005455 Bacteria 1992
65 Ga0070663_100152128 3300005455 Bacteria 1775
66 Ga0070662_100005284 3300005457 Bacteria 8242
67 Ga0070662_100020051 3300005457 Bacteria 4550
68 Ga0070662_100095599 3300005457 Bacteria 2240
69 Ga0070662_100109768 3300005457 Bacteria 2100
70 Ga0070662_100275838 3300005457 Bacteria 1359
71 Ga0070662_100378112 3300005457 Bacteria 1165
72 Ga0070681_10183513 3300005458 Bacteria 2013
73 Ga0068867_100000013 3300005459 Bacteria 112835
74 Ga0070707_100600538 3300005468 Bacteria 1063
75 Ga0070679_100232149 3300005530 Bacteria 1804
76 Ga0070684_100158341 3300005535 Bacteria 2053
77 Ga0070684_100958964 3300005535 Bacteria 802
78 Ga0068853_100018243 3300005539 Bacteria 5805
79 Ga0068853_100233091 3300005539 Bacteria 1685
80 Ga0070693_100031868 3300005547 Bacteria 2894
81 Ga0068855_100062852 3300005563 Bacteria 4334
82 Ga0068855_100112911 3300005563 Bacteria 3118
83 Ga0068855_100113543 3300005563 Bacteria 3107
84 Ga0068855_100399949 3300005563 Bacteria 1505
85 Ga0070664_100022817 3300005564 Bacteria 5162
86 Ga0070664_100457181 3300005564 Bacteria 1173
87 Ga0068857_100043590 3300005577 Bacteria 3979
88 Ga0068857_100340249 3300005577 Bacteria 1388
89 Ga0068854_100004495 3300005578 Bacteria 8794
90 Ga0068854_100255631 3300005578 Bacteria 1401
91 Ga0068854_100378527 3300005578 Bacteria 1166
92 Ga0068852_100073474 3300005616 Bacteria 3008
93 Ga0068852_100146209 3300005616 Bacteria 2193
94 Ga0068852_100164455 3300005616 Bacteria 2075
95 Ga0068852_100318949 3300005616 Bacteria 1509
96 Ga0068859_100068195 3300005617 Bacteria 3592
97 Ga0068859_100172865 3300005617 Bacteria 2242
98 Ga0068859_100779677 3300005617 Bacteria 1044
99 Ga0068864_100000036 3300005618 Bacteria 189811
100 Ga0068864_100000100 3300005618 Bacteria 85101
101 Ga0068864_100004795 3300005618 Bacteria 11081
102 Ga0068861_100014302 3300005719 Bacteria 5566
103 Ga0068861_100021348 3300005719 Bacteria 4654
104 Ga0068863_100000025 3300005841 Bacteria 186072
105 Ga0068863_100001489 3300005841 Bacteria 23203
106 Ga0068863_100002193 3300005841 Bacteria 19382
107 Ga0068863_100078729 3300005841 Bacteria 3122
108 Ga0068858_100000103 3300005842 Bacteria 88754
109 Ga0068858_101052441 3300005842 Bacteria 798
110 Ga0068860_100000056 3300005843 Bacteria 202751
111 Ga0068860_100000181 3300005843 Bacteria 101627
112 Ga0068862_100000027 3300005844 Bacteria 186072
113 Ga0068862_100000033 3300005844 Bacteria 176515
114 Ga0068862_100030592 3300005844 Bacteria 4538
115 Ga0075366_10361102 3300006195 Bacteria 892
116 Ga0097621_100042519 3300006237 Bacteria 3660
117 Ga0068871_100046305 3300006358 Bacteria 3503
118 Ga0068865_100000007 3300006881 Bacteria 185316
119 Ga0097620_100068194 3300006931 Bacteria 3592
120 Ga0097620_100172856 3300006931 Bacteria 2242
121 Ga0097620_100779619 3300006931 Bacteria 1044
122 Ga0105251_10000159 3300009011 Bacteria 68974
123 Ga0105245_10001117 3300009098 Bacteria 24272
124 Ga0105247_10002348 3300009101 Bacteria 12907
125 Ga0105243_10000118 3300009148 Bacteria 91438
126 Ga0105241_10097165 3300009174 Bacteria 2334
127 Ga0105242_10000196 3300009176 Bacteria 46996
128 Ga0105248_10000026 3300009177 Bacteria 257155
129 Ga0105248_10000091 3300009177 Bacteria 101191
130 Ga0105248_10000117 3300009177 Bacteria 90169
131 Ga0105248_10014281 3300009177 Bacteria 8743
132 Ga0105248_10096390 3300009177 Bacteria 3332
133 Ga0105237_10180910 3300009545 Bacteria 2109
134 Ga0105238_10046443 3300009551 Bacteria 4383
135 Ga0105238_10179420 3300009551 Bacteria 2095
136 Ga0105238_10331424 3300009551 Bacteria 1509
137 Ga0105249_10000110 3300009553 Bacteria 111292
138 Ga0105249_10030391 3300009553 Bacteria 4883
139 Ga0105249_10128148 3300009553 Bacteria 2419
140 Ga0105249_10374129 3300009553 Bacteria 1449
141 Ga0105239_10081502 3300010375 Bacteria 3562
142 Ga0105239_10728809 3300010375 Bacteria 1134
143 Ga0105246_10000313 3300011119 Bacteria 25771
144 Ga0105246_10001202 3300011119 Bacteria 15122
145 Ga0105246_10331057 3300011119 Bacteria 1241
146 Ga0157373_10028832 3300013100 Bacteria 4003
147 Ga0157371_10168989 3300013102 Bacteria 1562
148 Ga0157371_10173437 3300013102 Bacteria 1541
149 Ga0157370_10175975 3300013104 Bacteria 1989
150 Ga0157369_10094918 3300013105 Bacteria 3183
151 Ga0157369_10166611 3300013105 Bacteria 2323
152 Ga0157374_10000189 3300013296 Bacteria 57356
153 Ga0157374_10249045 3300013296 Bacteria 1748
154 Ga0157378_10000264 3300013297 Bacteria 51230
155 Ga0157378_10377826 3300013297 Bacteria 1391
156 Ga0163162_10785672 3300013306 Bacteria 1070
157 Ga0157372_10106932 3300013307 Bacteria 3201
158 Ga0157372_10314220 3300013307 Bacteria 1824
159 Ga0157372_10604998 3300013307 Bacteria 1278
160 Ga0157372_10659734 3300013307 Bacteria 1218
161 Ga0157375_10000436 3300013308 Bacteria 37738
162 Ga0163163_10122145 3300014325 Bacteria 2639
163 Ga0157380_10261660 3300014326 Unclassified 1572
164 Ga0157377_10006746 3300014745 Bacteria 5499
165 Ga0157379_10200180 3300014968 Bacteria 1806
166 Ga0157376_10000081 3300014969 Bacteria 72584
167 Ga0163161_10000889 3300017792 Bacteria 23198
168 Ga0206354_11297273 3300020081 Bacteria 3163
169 Ga0206353_10734548 3300020082 Bacteria 11682
170 Ga0209455_1000852 3300025272 Bacteria 16300
171 Ga0207697_10069606 3300025315 Bacteria 1473
172 Ga0207713_1013727 3300025735 Bacteria 4253
173 Ga0207710_10180110 3300025900 Bacteria 1036
174 Ga0207680_10116567 3300025903 Bacteria 1741
175 Ga0207647_10002587 3300025904 Bacteria 13693
176 Ga0207647_10012237 3300025904 Bacteria 5980
177 Ga0207647_10025797 3300025904 Bacteria 3854
178 Ga0207645_10009653 3300025907 Bacteria 6666
179 Ga0207645_10088379 3300025907 Bacteria 1992
180 Ga0207705_10000002 3300025909 Bacteria 2046852
181 Ga0207705_10000078 3300025909 Bacteria 120247
182 Ga0207705_10006309 3300025909 Bacteria 8800
183 Ga0207705_10008392 3300025909 Bacteria 7543
184 Ga0207705_10020175 3300025909 Bacteria 4768
185 Ga0207705_10404269 3300025909 Bacteria 1056
186 Ga0207705_10404387 3300025909 Bacteria 1056
187 Ga0207707_10027736 3300025912 Bacteria 4952
188 Ga0207707_10506466 3300025912 Bacteria 1029
189 Ga0207695_10089973 3300025913 Bacteria 3086
190 Ga0207671_10001230 3300025914 Bacteria 30301
191 Ga0207671_10227210 3300025914 Bacteria 1463
192 Ga0207660_10630285 3300025917 Bacteria 874
193 Ga0207657_10001650 3300025919 Bacteria 24065
194 Ga0207657_10002766 3300025919 Bacteria 18890
195 Ga0207657_10012537 3300025919 Bacteria 8360
196 Ga0207657_10034852 3300025919 Bacteria 4519
197 Ga0207657_10040899 3300025919 Bacteria 4104
198 Ga0207657_10149472 3300025919 Bacteria 1903
199 Ga0207657_10161823 3300025919 Bacteria 1817
200 Ga0207657_10464528 3300025919 Bacteria 993
201 Ga0207649_10225286 3300025920 Bacteria 1338
202 Ga0207652_10018425 3300025921 Bacteria 5726
203 Ga0207681_10000014 3300025923 Bacteria 353422
204 Ga0207681_10013312 3300025923 Bacteria 5088
205 Ga0207694_10036314 3300025924 Bacteria 3782
206 Ga0207694_10391566 3300025924 Bacteria 1155
207 Ga0207650_10000015 3300025925 Bacteria 369173
208 Ga0207650_10000243 3300025925 Bacteria 59507
209 Ga0207650_10327292 3300025925 Bacteria 1256
210 Ga0207687_10001736 3300025927 Bacteria 15019
211 Ga0207700_10723459 3300025928 Bacteria 889
212 Ga0207664_10045186 3300025929 Bacteria 3453
213 Ga0207644_10000066 3300025931 Bacteria 76450
214 Ga0207644_10013756 3300025931 Bacteria 5404
215 Ga0207690_10077557 3300025932 Bacteria 2310
216 Ga0207690_10099351 3300025932 Bacteria 2075
217 Ga0207706_10006555 3300025933 Bacteria 10783
218 Ga0207706_10006922 3300025933 Bacteria 10484
219 Ga0207706_10018370 3300025933 Bacteria 6292
220 Ga0207706_10030960 3300025933 Bacteria 4770
221 Ga0207706_10035652 3300025933 Bacteria 4421
222 Ga0207706_10148586 3300025933 Bacteria 2061
223 Ga0207706_10289940 3300025933 Bacteria 1427
224 Ga0207686_10000260 3300025934 Bacteria 39872
225 Ga0207709_10000156 3300025935 Bacteria 93099
226 Ga0207709_10499993 3300025935 Bacteria 948
227 Ga0207669_10037263 3300025937 Bacteria 2788
228 Ga0207704_10000017 3300025938 Bacteria 154190
229 Ga0207711_10000004 3300025941 Bacteria 870636
230 Ga0207711_10002409 3300025941 Bacteria 16703
231 Ga0207711_10008194 3300025941 Bacteria 8748
232 Ga0207661_10263746 3300025944 Bacteria 1535
233 Ga0207667_10034052 3300025949 Bacteria 5473
234 Ga0207667_10047029 3300025949 Bacteria 4568
235 Ga0207667_10119340 3300025949 Bacteria 2718
236 Ga0207667_10140301 3300025949 Bacteria 2488
237 Ga0207667_10157047 3300025949 Bacteria 2340
238 Ga0207651_10000011 3300025960 Bacteria 191950
239 Ga0207712_10000701 3300025961 Bacteria 25878
240 Ga0207712_10068069 3300025961 Bacteria 2549
241 Ga0207668_10000012 3300025972 Bacteria 182541
242 Ga0207640_10000067 3300025981 Bacteria 85026
243 Ga0207640_10088966 3300025981 Bacteria 2133
244 Ga0207640_10327107 3300025981 Bacteria 1223
245 Ga0207658_10000011 3300025986 Bacteria 239620
246 Ga0207658_10000164 3300025986 Bacteria 70677
247 Ga0207658_10001400 3300025986 Bacteria 18802
248 Ga0207658_10004090 3300025986 Bacteria 10173
249 Ga0207677_10000173 3300026023 Bacteria 50916
250 Ga0207703_10000538 3300026035 Bacteria 38989
251 Ga0207639_10014604 3300026041 Bacteria 5530
252 Ga0207639_10151574 3300026041 Bacteria 1942
253 Ga0207639_10238419 3300026041 Bacteria 1580
254 Ga0207639_10257639 3300026041 Bacteria 1524
255 Ga0207639_10614630 3300026041 Bacteria 1003
256 Ga0207678_10006666 3300026067 Bacteria 10234
257 Ga0207678_10079011 3300026067 Bacteria 2817
258 Ga0207678_10094849 3300026067 Bacteria 2550
259 Ga0207678_10426658 3300026067 Bacteria 1150
260 Ga0207678_10433926 3300026067 Bacteria 1140
261 Ga0207708_10155182 3300026075 Bacteria 1805
262 Ga0207702_10000974 3300026078 Bacteria 29347
263 Ga0207702_10028743 3300026078 Bacteria 4623
264 Ga0207641_10000018 3300026088 Bacteria 298209
265 Ga0207641_10000228 3300026088 Bacteria 72357
266 Ga0207641_10000755 3300026088 Bacteria 34850
267 Ga0207641_10051482 3300026088 Bacteria 3487
268 Ga0207648_10000045 3300026089 Bacteria 111963
269 Ga0207648_10052058 3300026089 Bacteria 3580
270 Ga0207676_10000021 3300026095 Bacteria 296572
271 Ga0207676_10000027 3300026095 Bacteria 245868
272 Ga0207676_10003587 3300026095 Bacteria 10968
273 Ga0207674_10002120 3300026116 Bacteria 25085
274 Ga0207674_10066719 3300026116 Bacteria 3623
275 Ga0207674_10280267 3300026116 Bacteria 1615
276 Ga0207675_100006708 3300026118 Bacteria 10884
277 Ga0207698_10006861 3300026142 Bacteria 7123
278 Ga0207698_10037377 3300026142 Bacteria 3575
279 Ga0207698_10158495 3300026142 Bacteria 1976
280 Ga0207698_10268060 3300026142 Bacteria 1572
281 Ga0209974_10038274 3300027876 Bacteria 1594
282 Ga0268265_10000013 3300028380 Bacteria 341536
283 Ga0268265_10000042 3300028380 Bacteria 186086
284 Ga0268265_10004259 3300028380 Bacteria 9991
285 Ga0268264_10000089 3300028381 Bacteria 234760
286 Ga0268264_10000144 3300028381 Bacteria 168841
287 Ga0307513_10330813 3300031456 Bacteria 1278
288 Ga0307408_100033258 3300031548 Bacteria 3601
289 Ga0307408_100060343 3300031548 Bacteria 2764
290 Ga0307408_100362387 3300031548 Bacteria 1233
291 Ga0316579_10020451 3300031691 Bacteria 2937
292 Ga0307405_10062717 3300031731 Bacteria 2355
293 Ga0307405_10125871 3300031731 Bacteria 1762
294 Ga0307405_10512514 3300031731 Bacteria 964
295 Ga0307413_10009976 3300031824 Bacteria 4577
296 Ga0307413_10058443 3300031824 Bacteria 2364
297 Ga0307413_10079455 3300031824 Bacteria 2097
298 Ga0307413_10190840 3300031824 Bacteria 1471
299 Ga0307410_10093418 3300031852 Bacteria 2140
300 Ga0307410_10306529 3300031852 Bacteria 1255
301 Ga0307406_10029506 3300031901 Bacteria 3322
302 Ga0307406_10042156 3300031901 Bacteria 2848
303 Ga0307406_10143624 3300031901 Bacteria 1693
304 Ga0307407_10013484 3300031903 Bacteria 3969
305 Ga0307407_10053879 3300031903 Bacteria 2316
306 Ga0307407_10431042 3300031903 Bacteria 952
307 Ga0307412_10161243 3300031911 Bacteria 1666
308 Ga0307409_100031534 3300031995 Bacteria 3827
309 Ga0307409_100040513 3300031995 Bacteria 3469
310 Ga0307416_100005058 3300032002 Bacteria 8040
311 Ga0307416_100057036 3300032002 Bacteria 3156
312 Ga0307416_100798298 3300032002 Bacteria 1039
313 Ga0307414_10024901 3300032004 Bacteria 3823
314 Ga0307414_10126535 3300032004 Bacteria 1975
315 Ga0307414_10292389 3300032004 Bacteria 1374
316 Ga0307411_10241131 3300032005 Bacteria 1415
317 Ga0307411_10243437 3300032005 Bacteria 1409
318 Ga0307411_10416309 3300032005 Bacteria 1115
319 Ga0307415_100012336 3300032126 Bacteria 4938
320 Ga0307415_100106044 3300032126 Bacteria 2074
321 Ga0307415_100158480 3300032126 Bacteria 1751
322 Ga0307415_100199060 3300032126 Bacteria 1588
323 Ga0316583_10122427 3300032133 Bacteria 906
324 Ga0373943_0263751 3300035170 Bacteria 970
325 Ga0373931_0088346 3300035691 Bacteria 1722
326 Ga0373927_0401446 3300035695 Bacteria 904
327 Ga0316582_0002286 3300036647 Bacteria 8940
328 Ga0316584_0021485 3300036712 Bacteria 4692
329 Ga0395899_0000140 3300037312 Bacteria 109989
330 Ga0395900_0000075 3300037418 Bacteria 183525
331 Ga0395900_0127129 3300037418 Bacteria 2614
332 Ga0395900_0250373 3300037418 Bacteria 1773
333 Ga0395898_0000055 3300037466 Bacteria 278557
334 Ga0395898_0590052 3300037466 Bacteria 1054
335 Ga0395905_0000067 3300037471 Bacteria 181887
336 Ga0395905_0061106 3300037471 Bacteria 3524
337 Ga0395905_0066681 3300037471 Bacteria 3371
338 Ga0395905_0109845 3300037471 Bacteria 2589
339 Ga0316581_0067078 3300037588 Bacteria 1102
340 Ga0436364_1451790 3300037853 Bacteria 1745
341 Ga0395901_0000874 3300038443 Bacteria 33249
342 Ga0395901_0017781 3300038443 Bacteria 7257
343 Ga0395901_0242802 3300038443 Bacteria 1878
344 Ga0237819_00574 3300038705 Bacteria 12342
345 Ga0451798_1156044 3300041458 Bacteria 1584
346 Ga0451806_238307 3300041462 Bacteria 2723
347 Ga0451807_1818061 3300041486 Bacteria 2350
348 Ga0451849_0048903 3300041505 Bacteria 915
349 Ga0451843_1270735 3300041509 Bacteria 1296
350 Ga0451843_1272912 3300041509 Bacteria 919
351 Ga0439448_0005409 3300042005 Bacteria 3642
352 Ga0439448_0005846 3300042005 Bacteria 3516
353 Ga0439449_0182011 3300042007 Bacteria 786
354 Ga0439450_101917 3300042008 Bacteria 729
355 Ga0439455_0000825 3300042012 Bacteria 4727
356 Ga0439455_0002152 3300042012 Bacteria 3523
357 Ga0439455_0025538 3300042012 Bacteria 1436
358 Ga0439458_0004928 3300042157 Bacteria 3029
359 Ga0439458_0009578 3300042157 Bacteria 2158
360 Ga0466973_0153270 3300044659 Bacteria 1817
361 Ga0466964_0123065 3300044706 Bacteria 1172
362 Ga0466968_0005545 3300044735 Bacteria 4725
363 Ga0466967_0028379 3300045976 Bacteria 4671
364 Ga0495638_0053645 3300046460 Bacteria 2509
365 Ga0495638_0285980 3300046460 Bacteria 894
366 Ga0495607_0081994 3300046501 Bacteria 1771
367 Ga0495583_0001045 3300046506 Bacteria 31275
368 Ga0495606_0001951 3300046507 Bacteria 25484
369 Ga0495610_0000061 3300046512 Bacteria 130986
370 Ga0495620_0015611 3300046515 Bacteria 3829
371 Ga0495632_0115290 3300046519 Bacteria 1259
372 Ga0495643_0060686 3300046522 Bacteria 2007
373 Ga0495609_0075629 3300046538 Bacteria 1476
374 Ga0495633_0242385 3300046558 Bacteria 823
375 Ga0495661_0096728 3300046665 Bacteria 1669
376 Ga0495670_0150470 3300046691 Bacteria 1220
377 Ga0495676_0317671 3300047321 Bacteria 1047
378 Ga0495673_0176176 3300047469 Bacteria 812
379 Ga0495686_0000182 3300047472 Bacteria 119682
380 Ga0495602_0007292 3300048088 Bacteria 11575
381 Ga0496103_0030428 3300048906 Bacteria 3285
382 Ga0496103_0346101 3300048906 Bacteria 956
383 Ga0496104_0014234 3300048907 Bacteria 7179
384 Ga0496105_0000481 3300048908 Bacteria 26219
385 Ga0496107_0584905 3300048910 Bacteria 826
386 Ga0496111_0233183 3300048914 Bacteria 1367
387 Ga0496117_0004134 3300048920 Bacteria 16237
388 Ga0496118_0011321 3300048921 Bacteria 8719
389 Ga0496118_0069894 3300048921 Bacteria 2539
390 Ga0496119_0045682 3300048922 Bacteria 2743
391 Ga0496121_0138766 3300048924 Bacteria 1807
392 Ga0496122_0000579 3300048925 Bacteria 75073
393 Ga0496123_0001402 3300048926 Bacteria 33737
394 Ga0496124_0008457 3300048927 Bacteria 10757
395 Ga0496125_0004105 3300048928 Bacteria 17024
396 Ga0496125_0021250 3300048928 Bacteria 6061
397 Ga0496126_0139607 3300048929 Bacteria 2087
398 Ga0496126_0292433 3300048929 Bacteria 1347
399 Ga0496126_0628722 3300048929 Bacteria 843
400 Ga0501031_0438703 3300049568 Bacteria 844
401 Ga0501033_0305257 3300049570 Bacteria 1120
402 Ga0501034_0364413 3300049571 Bacteria 1372
403 Ga0501043_0134872 3300049579 Bacteria 1934
404 Ga0501046_0408016 3300049580 Bacteria 981
405 Ga0501047_0000644 3300049581 Bacteria 36698
406 Ga0501047_0049234 3300049581 Bacteria 4069
407 Ga0501047_0170168 3300049581 Bacteria 2048
408 Ga0501048_0210948 3300049582 Bacteria 1377
409 Ga0501239_017457 3300049672 Bacteria 855
410 Ga0501249_000549 3300049679 Bacteria 9020
411 Ga0501257_000029 3300049686 Bacteria 42945
412 Ga0501270_017660 3300049767 Bacteria 1047
413 Ga0501273_020887 3300049770 Bacteria 886
414 Ga0501280_003066 3300049776 Bacteria 2631
415 Ga0501044_0116912 3300049823 Bacteria 2671
416 Ga0501044_0129248 3300049823 Bacteria 2521
417 Ga0501044_0382053 3300049823 Bacteria 1323
418 Ga0500643_000121 3300053087 Bacteria 81461
419 Ga0500643_004524 3300053087 Bacteria 6250
420 Ga0500651_0002188 3300053093 Bacteria 10235
421 Ga0500641_0012360 3300053096 Bacteria 3116
422 Ga0500555_000460 3300053103 Bacteria 16899
423 Ga0500618_005557 3300053125 Bacteria 3815
424 Ga0500642_0001441 3300053130 Bacteria 6825
425 Ga0500655_000061 3300053133 Bacteria 29562
426 Ga0500568_0034107 3300053139 Bacteria 2084
427 Ga0500616_0027249 3300053153 Bacteria 3156
428 Ga0500622_0003437 3300053156 Bacteria 10591
429 Ga0500570_000268 3300053724 Bacteria 17871
430 Ga0500645_008660 3300053730 Bacteria 3455

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100298154 Ga0070660_1002981543 186
2 3300044706 Ga0466964_0123065 Ga0466964_0123065_592_1158 186
3 3300002067 JGI24735J21928_10052464 JGI24735J21928_100524642 187
4 3300005344 Ga0070661_100060699 Ga0070661_1000606993 187
5 3300005457 Ga0070662_100378112 Ga0070662_1003781122 187
6 3300005563 Ga0068855_100399949 Ga0068855_1003999493 187
7 3300005577 Ga0068857_100043590 Ga0068857_1000435902 187
8 3300013105 Ga0157369_10094918 Ga0157369_100949185 187
9 3300025912 Ga0207707_10506466 Ga0207707_105064662 187
10 3300025933 Ga0207706_10035652 Ga0207706_100356522 187
11 3300026116 Ga0207674_10002120 Ga0207674_1000212011 187
12 3300009551 Ga0105238_10331424 Ga0105238_103314242 188
13 3300013307 Ga0157372_10659734 Ga0157372_106597342 188
14 3300025924 Ga0207694_10391566 Ga0207694_103915663 188
15 3300025949 Ga0207667_10157047 Ga0207667_101570472 188
16 3300042012 Ga0439455_0025538 Ga0439455_0025538_380_1009 193
17 3300005336 Ga0070680_100203080 Ga0070680_1002030803 194
18 3300005344 Ga0070661_100122473 Ga0070661_1001224732 194
19 3300005366 Ga0070659_100115805 Ga0070659_1001158054 194
20 3300049570 Ga0501033_0305257 Ga0501033_0305257_38_622 194
21 3300046558 Ga0495633_0242385 Ga0495633_0242385_46_633 195
22 3300005434 Ga0070709_10186278 Ga0070709_101862783 201
23 3300005436 Ga0070713_100848387 Ga0070713_1008483871 201
24 3300025928 Ga0207700_10723459 Ga0207700_107234591 201
25 3300048924 Ga0496121_0138766 Ga0496121_0138766_443_1105 201
26 3300005457 Ga0070662_100275838 Ga0070662_1002758382 202
27 3300025933 Ga0207706_10289940 Ga0207706_102899402 202
28 3300031548 Ga0307408_100362387 Ga0307408_1003623871 202
29 3300031901 Ga0307406_10029506 Ga0307406_100295063 202
30 3300031903 Ga0307407_10053879 Ga0307407_100538793 202
31 3300031903 Ga0307407_10431042 Ga0307407_104310421 202
32 3300031995 Ga0307409_100040513 Ga0307409_1000405134 202
33 3300037466 Ga0395898_0590052 Ga0395898_0590052_132_797 202
34 3300042007 Ga0439449_0182011 Ga0439449_0182011_38_703 202
35 3300049672 Ga0501239_017457 Ga0501239_017457_15_680 202
36 3300049767 Ga0501270_017660 Ga0501270_017660_45_710 202
37 3300049770 Ga0501273_020887 Ga0501273_020887_50_715 202
38 3300005366 Ga0070659_100234503 Ga0070659_1002345032 203
39 3300005578 Ga0068854_100378527 Ga0068854_1003785272 203
40 3300013297 Ga0157378_10377826 Ga0157378_103778262 203
41 3300014326 Ga0157380_10261660 Ga0157380_102616602 203
42 3300025919 Ga0207657_10161823 Ga0207657_101618232 203
43 3300025981 Ga0207640_10327107 Ga0207640_103271072 203
44 3300026089 Ga0207648_10052058 Ga0207648_100520585 203
45 3300031731 Ga0307405_10512514 Ga0307405_105125141 203
46 3300032002 Ga0307416_100005058 Ga0307416_1000050589 203
47 3300032126 Ga0307415_100012336 Ga0307415_1000123364 203
48 3300037312 Ga0395899_0000140 Ga0395899_0000140_10143_10808 203
49 3300037418 Ga0395900_0000075 Ga0395900_0000075_87001_87666 203
50 3300037466 Ga0395898_0000055 Ga0395898_0000055_99172_99837 203
51 3300037471 Ga0395905_0000067 Ga0395905_0000067_178721_179386 203
52 3300037471 Ga0395905_0109845 Ga0395905_0109845_1347_2012 203
53 3300038443 Ga0395901_0000874 Ga0395901_0000874_22753_23418 203
54 3300038443 Ga0395901_0017781 Ga0395901_0017781_3488_4153 203
55 3300031456 Ga0307513_10330813 Ga0307513_103308133 204
56 3300048910 Ga0496107_0584905 Ga0496107_0584905_98_766 204
57 3300038443 Ga0395901_0242802 Ga0395901_0242802_236_892 205
58 3300005353 Ga0070669_100176901 Ga0070669_1001769013 206
59 3300005457 Ga0070662_100109768 Ga0070662_1001097682 206
60 3300025933 Ga0207706_10148586 Ga0207706_101485863 206
61 3300042008 Ga0439450_101917 Ga0439450_101917_16_639 207
62 3300005335 Ga0070666_10208694 Ga0070666_102086942 210
63 3300005367 Ga0070667_100000143 Ga0070667_10000014325 210
64 3300005841 Ga0068863_100001489 Ga0068863_1000014896 210
65 3300005843 Ga0068860_100000181 Ga0068860_10000018136 210
66 3300009553 Ga0105249_10374129 Ga0105249_103741292 210
67 3300025986 Ga0207658_10000164 Ga0207658_1000016463 210
68 3300026088 Ga0207641_10000755 Ga0207641_1000075515 210
69 3300028381 Ga0268264_10000144 Ga0268264_10000144101 210
70 3300041505 Ga0451849_0048903 Ga0451849_0048903_220_870 210
71 3300005331 Ga0070670_100043672 Ga0070670_1000436722 211
72 3300009177 Ga0105248_10000117 Ga0105248_1000011777 211
73 3300025925 Ga0207650_10327292 Ga0207650_103272922 211
74 3300035691 Ga0373931_0088346 Ga0373931_0088346_124_789 211
75 3300046538 Ga0495609_0075629 Ga0495609_0075629_541_1224 211
76 iso_pu_bacteria 2643221588 2643950427 214
77 iso_pu_bacteria 2848297114 2848297633 214
78 iso_pu_bacteria 3000865235 3000866649 214
79 iso_pu_bacteria 2643221605 2644040832 215
80 iso_pu_bacteria 2919709256 2919711354 215
81 3300017792 Ga0163161_10000889 Ga0163161_1000088915 216
82 3300031691 Ga0316579_10020451 Ga0316579_100204514 216
83 3300031731 Ga0307405_10125871 Ga0307405_101258713 216
84 3300032133 Ga0316583_10122427 Ga0316583_101224272 216
85 3300036647 Ga0316582_0002286 Ga0316582_0002286_3097_3750 216
86 3300036712 Ga0316584_0021485 Ga0316584_0021485_964_1617 216
87 3300037588 Ga0316581_0067078 Ga0316581_0067078_318_971 216
88 3300046460 Ga0495638_0285980 Ga0495638_0285980_126_776 216
89 3300046501 Ga0495607_0081994 Ga0495607_0081994_465_1115 216
90 3300046512 Ga0495610_0000061 Ga0495610_0000061_45243_45893 216
91 3300046515 Ga0495620_0015611 Ga0495620_0015611_755_1405 216
92 3300048907 Ga0496104_0014234 Ga0496104_0014234_4357_5007 216
93 3300048908 Ga0496105_0000481 Ga0496105_0000481_24819_25469 216
94 3300049581 Ga0501047_0170168 Ga0501047_0170168_984_1634 216
95 3300005327 Ga0070658_10429868 Ga0070658_104298682 217
96 3300005329 Ga0070683_100008964 Ga0070683_1000089644 217
97 3300005339 Ga0070660_100024601 Ga0070660_1000246016 217
98 3300005455 Ga0070663_100119062 Ga0070663_1001190623 217
99 3300005457 Ga0070662_100005284 Ga0070662_1000052847 217
100 3300005535 Ga0070684_100158341 Ga0070684_1001583413 217
101 3300005535 Ga0070684_100958964 Ga0070684_1009589641 217
102 3300005563 Ga0068855_100062852 Ga0068855_1000628526 217
103 3300005564 Ga0070664_100022817 Ga0070664_1000228176 217
104 3300005564 Ga0070664_100457181 Ga0070664_1004571812 217
105 3300005578 Ga0068854_100255631 Ga0068854_1002556312 217
106 3300011119 Ga0105246_10001202 Ga0105246_1000120214 217
107 3300013102 Ga0157371_10168989 Ga0157371_101689893 217
108 3300013307 Ga0157372_10604998 Ga0157372_106049982 217
109 3300025909 Ga0207705_10008392 Ga0207705_100083923 217
110 3300025909 Ga0207705_10404269 Ga0207705_104042692 217
111 3300025909 Ga0207705_10404387 Ga0207705_104043872 217
112 3300025917 Ga0207660_10630285 Ga0207660_106302852 217
113 3300025919 Ga0207657_10034852 Ga0207657_100348526 217
114 3300025919 Ga0207657_10464528 Ga0207657_104645282 217
115 3300025920 Ga0207649_10225286 Ga0207649_102252862 217
116 3300025933 Ga0207706_10006555 Ga0207706_100065558 217
117 3300025944 Ga0207661_10263746 Ga0207661_102637462 217
118 3300025949 Ga0207667_10034052 Ga0207667_100340523 217
119 3300026041 Ga0207639_10614630 Ga0207639_106146302 217
120 3300026067 Ga0207678_10079011 Ga0207678_100790114 217
121 3300026067 Ga0207678_10094849 Ga0207678_100948493 217
122 3300026067 Ga0207678_10426658 Ga0207678_104266582 217
123 3300041509 Ga0451843_1270735 Ga0451843_1270735_260_916 217
124 3300041509 Ga0451843_1272912 Ga0451843_1272912_63_719 217
125 3300049568 Ga0501031_0438703 Ga0501031_0438703_30_686 217
126 3300049571 Ga0501034_0364413 Ga0501034_0364413_688_1344 217
127 3300049581 Ga0501047_0049234 Ga0501047_0049234_1641_2297 217
128 3300049823 Ga0501044_0129248 Ga0501044_0129248_1291_1947 217
129 3300005530 Ga0070679_100232149 Ga0070679_1002321492 218
130 3300026116 Ga0207674_10280267 Ga0207674_102802673 218
131 3300031824 Ga0307413_10190840 Ga0307413_101908402 218
132 3300031852 Ga0307410_10306529 Ga0307410_103065292 218
133 3300032005 Ga0307411_10241131 Ga0307411_102411313 218
134 3300032126 Ga0307415_100199060 Ga0307415_1001990602 218
135 3300046522 Ga0495643_0060686 Ga0495643_0060686_599_1261 218
136 3300053139 Ga0500568_0034107 Ga0500568_0034107_983_1645 218
137 3300053153 Ga0500616_0027249 Ga0500616_0027249_951_1613 218
138 3300001979 JGI24740J21852_10008003 JGI24740J21852_100080034 219
139 3300001989 JGI24739J22299_10079499 JGI24739J22299_100794992 219
140 3300001990 JGI24737J22298_10036420 JGI24737J22298_100364203 219
141 3300002067 JGI24735J21928_10006017 JGI24735J21928_100060173 219
142 3300002067 JGI24735J21928_10015098 JGI24735J21928_100150982 219
143 3300002075 JGI24738J21930_10000862 JGI24738J21930_1000086214 219
144 3300002075 JGI24738J21930_10008667 JGI24738J21930_100086672 219
145 3300002075 JGI24738J21930_10015637 JGI24738J21930_100156372 219
146 3300002076 JGI24749J21850_1000352 JGI24749J21850_100035210 219
147 3300002459 JGI24751J29686_10000208 JGI24751J29686_1000020812 219
148 3300003316 rootH1_10096314 rootH1_100963141 219
149 3300005295 Ga0065707_10242376 Ga0065707_102423762 219
150 3300005327 Ga0070658_10000106 Ga0070658_1000010628 219
151 3300005327 Ga0070658_10009822 Ga0070658_100098224 219
152 3300005327 Ga0070658_10228111 Ga0070658_102281112 219
153 3300005328 Ga0070676_10000539 Ga0070676_100005395 219
154 3300005331 Ga0070670_100000024 Ga0070670_10000002452 219
155 3300005331 Ga0070670_100000027 Ga0070670_1000000276 219
156 3300005331 Ga0070670_100179018 Ga0070670_1001790182 219
157 3300005334 Ga0068869_100000897 Ga0068869_1000008972 219
158 3300005336 Ga0070680_100014541 Ga0070680_1000145413 219
159 3300005338 Ga0068868_100000016 Ga0068868_10000001662 219
160 3300005339 Ga0070660_100001721 Ga0070660_10000172125 219
161 3300005339 Ga0070660_100012845 Ga0070660_1000128456 219
162 3300005339 Ga0070660_100035885 Ga0070660_1000358855 219
163 3300005339 Ga0070660_100342420 Ga0070660_1003424202 219
164 3300005344 Ga0070661_100009749 Ga0070661_1000097499 219
165 3300005344 Ga0070661_100525945 Ga0070661_1005259452 219
166 3300005345 Ga0070692_10036566 Ga0070692_100365664 219
167 3300005347 Ga0070668_100000027 Ga0070668_10000002776 219
168 3300005353 Ga0070669_100000047 Ga0070669_10000004758 219
169 3300005353 Ga0070669_100022152 Ga0070669_1000221523 219
170 3300005355 Ga0070671_100000517 Ga0070671_10000051719 219
171 3300005355 Ga0070671_100045799 Ga0070671_1000457996 219
172 3300005356 Ga0070674_100010143 Ga0070674_1000101434 219
173 3300005364 Ga0070673_100000017 Ga0070673_10000001794 219
174 3300005366 Ga0070659_100010665 Ga0070659_1000106655 219
175 3300005366 Ga0070659_100092203 Ga0070659_1000922032 219
176 3300005366 Ga0070659_100129198 Ga0070659_1001291982 219
177 3300005367 Ga0070667_100000017 Ga0070667_100000017167 219
178 3300005367 Ga0070667_100005804 Ga0070667_10000580411 219
179 3300005367 Ga0070667_100009122 Ga0070667_1000091225 219
180 3300005435 Ga0070714_100013377 Ga0070714_1000133779 219
181 3300005441 Ga0070700_100542189 Ga0070700_1005421892 219
182 3300005445 Ga0070708_100136957 Ga0070708_1001369573 219
183 3300005455 Ga0070663_100000796 Ga0070663_1000007969 219
184 3300005455 Ga0070663_100152128 Ga0070663_1001521282 219
185 3300005457 Ga0070662_100020051 Ga0070662_1000200513 219
186 3300005457 Ga0070662_100095599 Ga0070662_1000955992 219
187 3300005458 Ga0070681_10183513 Ga0070681_101835132 219
188 3300005459 Ga0068867_100000013 Ga0068867_10000001394 219
189 3300005468 Ga0070707_100600538 Ga0070707_1006005382 219
190 3300005539 Ga0068853_100018243 Ga0068853_1000182433 219
191 3300005539 Ga0068853_100233091 Ga0068853_1002330912 219
192 3300005547 Ga0070693_100031868 Ga0070693_1000318682 219
193 3300005563 Ga0068855_100112911 Ga0068855_1001129113 219
194 3300005563 Ga0068855_100113543 Ga0068855_1001135433 219
195 3300005577 Ga0068857_100340249 Ga0068857_1003402491 219
196 3300005578 Ga0068854_100004495 Ga0068854_1000044959 219
197 3300005616 Ga0068852_100073474 Ga0068852_1000734743 219
198 3300005616 Ga0068852_100146209 Ga0068852_1001462092 219
199 3300005616 Ga0068852_100164455 Ga0068852_1001644553 219
200 3300005616 Ga0068852_100318949 Ga0068852_1003189491 219
201 3300005617 Ga0068859_100068195 Ga0068859_1000681953 219
202 3300005617 Ga0068859_100172865 Ga0068859_1001728653 219
203 3300005617 Ga0068859_100779677 Ga0068859_1007796772 219
204 3300005618 Ga0068864_100000036 Ga0068864_10000003653 219
205 3300005618 Ga0068864_100000100 Ga0068864_10000010097 219
206 3300005618 Ga0068864_100004795 Ga0068864_1000047959 219
207 3300005719 Ga0068861_100014302 Ga0068861_1000143026 219
208 3300005719 Ga0068861_100021348 Ga0068861_1000213486 219
209 3300005841 Ga0068863_100000025 Ga0068863_100000025207 219
210 3300005841 Ga0068863_100002193 Ga0068863_10000219310 219
211 3300005841 Ga0068863_100078729 Ga0068863_1000787292 219
212 3300005842 Ga0068858_100000103 Ga0068858_10000010314 219
213 3300005842 Ga0068858_101052441 Ga0068858_1010524411 219
214 3300005843 Ga0068860_100000056 Ga0068860_10000005677 219
215 3300005844 Ga0068862_100000027 Ga0068862_1000000276 219
216 3300005844 Ga0068862_100000033 Ga0068862_10000003351 219
217 3300005844 Ga0068862_100030592 Ga0068862_1000305926 219
218 3300006195 Ga0075366_10361102 Ga0075366_103611022 219
219 3300006237 Ga0097621_100042519 Ga0097621_1000425194 219
220 3300006358 Ga0068871_100046305 Ga0068871_1000463054 219
221 3300006881 Ga0068865_100000007 Ga0068865_100000007126 219
222 3300006931 Ga0097620_100068194 Ga0097620_1000681945 219
223 3300006931 Ga0097620_100172856 Ga0097620_1001728563 219
224 3300006931 Ga0097620_100779619 Ga0097620_1007796192 219
225 3300009011 Ga0105251_10000159 Ga0105251_1000015973 219
226 3300009098 Ga0105245_10001117 Ga0105245_1000111712 219
227 3300009101 Ga0105247_10002348 Ga0105247_100023489 219
228 3300009148 Ga0105243_10000118 Ga0105243_1000011811 219
229 3300009174 Ga0105241_10097165 Ga0105241_100971653 219
230 3300009176 Ga0105242_10000196 Ga0105242_1000019629 219
231 3300009177 Ga0105248_10000026 Ga0105248_10000026222 219
232 3300009177 Ga0105248_10000091 Ga0105248_1000009153 219
233 3300009177 Ga0105248_10014281 Ga0105248_100142812 219
234 3300009177 Ga0105248_10096390 Ga0105248_100963903 219
235 3300009545 Ga0105237_10180910 Ga0105237_101809102 219
236 3300009551 Ga0105238_10046443 Ga0105238_100464432 219
237 3300009551 Ga0105238_10179420 Ga0105238_101794203 219
238 3300009553 Ga0105249_10000110 Ga0105249_1000011019 219
239 3300009553 Ga0105249_10030391 Ga0105249_100303916 219
240 3300009553 Ga0105249_10128148 Ga0105249_101281482 219
241 3300010375 Ga0105239_10081502 Ga0105239_100815022 219
242 3300010375 Ga0105239_10728809 Ga0105239_107288091 219
243 3300011119 Ga0105246_10000313 Ga0105246_1000031317 219
244 3300011119 Ga0105246_10331057 Ga0105246_103310572 219
245 3300013100 Ga0157373_10028832 Ga0157373_100288323 219
246 3300013102 Ga0157371_10173437 Ga0157371_101734373 219
247 3300013104 Ga0157370_10175975 Ga0157370_101759752 219
248 3300013105 Ga0157369_10166611 Ga0157369_101666113 219
249 3300013296 Ga0157374_10000189 Ga0157374_1000018954 219
250 3300013296 Ga0157374_10249045 Ga0157374_102490452 219
251 3300013297 Ga0157378_10000264 Ga0157378_1000026455 219
252 3300013306 Ga0163162_10785672 Ga0163162_107856722 219
253 3300013307 Ga0157372_10106932 Ga0157372_101069323 219
254 3300013307 Ga0157372_10314220 Ga0157372_103142201 219
255 3300013308 Ga0157375_10000436 Ga0157375_1000043611 219
256 3300014325 Ga0163163_10122145 Ga0163163_101221454 219
257 3300014745 Ga0157377_10006746 Ga0157377_100067464 219
258 3300014968 Ga0157379_10200180 Ga0157379_102001802 219
259 3300014969 Ga0157376_10000081 Ga0157376_1000008129 219
260 3300020081 Ga0206354_11297273 Ga0206354_112972732 219
261 3300020082 Ga0206353_10734548 Ga0206353_107345484 219
262 3300025272 Ga0209455_1000852 Ga0209455_100085219 219
263 3300025315 Ga0207697_10069606 Ga0207697_100696063 219
264 3300025735 Ga0207713_1013727 Ga0207713_10137274 219
265 3300025900 Ga0207710_10180110 Ga0207710_101801103 219
266 3300025903 Ga0207680_10116567 Ga0207680_101165673 219
267 3300025904 Ga0207647_10002587 Ga0207647_1000258720 219
268 3300025904 Ga0207647_10012237 Ga0207647_100122374 219
269 3300025904 Ga0207647_10025797 Ga0207647_100257973 219
270 3300025907 Ga0207645_10009653 Ga0207645_100096537 219
271 3300025907 Ga0207645_10088379 Ga0207645_100883792 219
272 3300025909 Ga0207705_10000002 Ga0207705_10000002413 219
273 3300025909 Ga0207705_10000078 Ga0207705_10000078104 219
274 3300025909 Ga0207705_10006309 Ga0207705_100063098 219
275 3300025909 Ga0207705_10020175 Ga0207705_100201758 219
276 3300025912 Ga0207707_10027736 Ga0207707_100277361 219
277 3300025913 Ga0207695_10089973 Ga0207695_100899735 219
278 3300025914 Ga0207671_10001230 Ga0207671_1000123030 219
279 3300025914 Ga0207671_10227210 Ga0207671_102272102 219
280 3300025919 Ga0207657_10001650 Ga0207657_100016506 219
281 3300025919 Ga0207657_10002766 Ga0207657_1000276624 219
282 3300025919 Ga0207657_10012537 Ga0207657_100125379 219
283 3300025919 Ga0207657_10040899 Ga0207657_100408992 219
284 3300025919 Ga0207657_10149472 Ga0207657_101494722 219
285 3300025921 Ga0207652_10018425 Ga0207652_100184253 219
286 3300025923 Ga0207681_10000014 Ga0207681_10000014140 219
287 3300025923 Ga0207681_10013312 Ga0207681_100133125 219
288 3300025924 Ga0207694_10036314 Ga0207694_100363143 219
289 3300025925 Ga0207650_10000015 Ga0207650_10000015154 219
290 3300025925 Ga0207650_10000243 Ga0207650_1000024328 219
291 3300025927 Ga0207687_10001736 Ga0207687_1000173611 219
292 3300025929 Ga0207664_10045186 Ga0207664_100451866 219
293 3300025931 Ga0207644_10000066 Ga0207644_1000006643 219
294 3300025931 Ga0207644_10013756 Ga0207644_100137563 219
295 3300025932 Ga0207690_10077557 Ga0207690_100775574 219
296 3300025932 Ga0207690_10099351 Ga0207690_100993513 219
297 3300025933 Ga0207706_10006922 Ga0207706_100069224 219
298 3300025933 Ga0207706_10018370 Ga0207706_1001837012 219
299 3300025933 Ga0207706_10030960 Ga0207706_100309601 219
300 3300025934 Ga0207686_10000260 Ga0207686_1000026028 219
301 3300025935 Ga0207709_10000156 Ga0207709_1000015626 219
302 3300025935 Ga0207709_10499993 Ga0207709_104999932 219
303 3300025937 Ga0207669_10037263 Ga0207669_100372633 219
304 3300025938 Ga0207704_10000017 Ga0207704_1000001764 219
305 3300025941 Ga0207711_10000004 Ga0207711_10000004237 219
306 3300025941 Ga0207711_10002409 Ga0207711_100024093 219
307 3300025941 Ga0207711_10008194 Ga0207711_100081942 219
308 3300025949 Ga0207667_10047029 Ga0207667_100470294 219
309 3300025949 Ga0207667_10119340 Ga0207667_101193403 219
310 3300025949 Ga0207667_10140301 Ga0207667_101403013 219
311 3300025960 Ga0207651_10000011 Ga0207651_1000001166 219
312 3300025961 Ga0207712_10000701 Ga0207712_1000070119 219
313 3300025961 Ga0207712_10068069 Ga0207712_100680692 219
314 3300025972 Ga0207668_10000012 Ga0207668_1000001275 219
315 3300025981 Ga0207640_10000067 Ga0207640_1000006763 219
316 3300025981 Ga0207640_10088966 Ga0207640_100889662 219
317 3300025986 Ga0207658_10000011 Ga0207658_1000001176 219
318 3300025986 Ga0207658_10001400 Ga0207658_1000140018 219
319 3300025986 Ga0207658_10004090 Ga0207658_100040903 219
320 3300026023 Ga0207677_10000173 Ga0207677_1000017333 219
321 3300026035 Ga0207703_10000538 Ga0207703_1000053828 219
322 3300026041 Ga0207639_10014604 Ga0207639_100146045 219
323 3300026041 Ga0207639_10151574 Ga0207639_101515742 219
324 3300026041 Ga0207639_10238419 Ga0207639_102384192 219
325 3300026041 Ga0207639_10257639 Ga0207639_102576393 219
326 3300026067 Ga0207678_10006666 Ga0207678_100066669 219
327 3300026067 Ga0207678_10433926 Ga0207678_104339262 219
328 3300026075 Ga0207708_10155182 Ga0207708_101551823 219
329 3300026078 Ga0207702_10000974 Ga0207702_100009747 219
330 3300026078 Ga0207702_10028743 Ga0207702_100287433 219
331 3300026088 Ga0207641_10000018 Ga0207641_10000018117 219
332 3300026088 Ga0207641_10000228 Ga0207641_1000022831 219
333 3300026088 Ga0207641_10051482 Ga0207641_100514824 219
334 3300026089 Ga0207648_10000045 Ga0207648_1000004528 219
335 3300026095 Ga0207676_10000021 Ga0207676_10000021248 219
336 3300026095 Ga0207676_10000027 Ga0207676_1000002762 219
337 3300026095 Ga0207676_10003587 Ga0207676_100035878 219
338 3300026116 Ga0207674_10066719 Ga0207674_100667191 219
339 3300026118 Ga0207675_100006708 Ga0207675_10000670810 219
340 3300026142 Ga0207698_10006861 Ga0207698_100068616 219
341 3300026142 Ga0207698_10037377 Ga0207698_100373774 219
342 3300026142 Ga0207698_10158495 Ga0207698_101584953 219
343 3300026142 Ga0207698_10268060 Ga0207698_102680602 219
344 3300027876 Ga0209974_10038274 Ga0209974_100382742 219
345 3300028380 Ga0268265_10000013 Ga0268265_10000013220 219
346 3300028380 Ga0268265_10000042 Ga0268265_100000424 219
347 3300028380 Ga0268265_10004259 Ga0268265_100042598 219
348 3300028381 Ga0268264_10000089 Ga0268264_10000089174 219
349 3300031548 Ga0307408_100033258 Ga0307408_1000332584 219
350 3300031548 Ga0307408_100060343 Ga0307408_1000603433 219
351 3300031731 Ga0307405_10062717 Ga0307405_100627172 219
352 3300031824 Ga0307413_10009976 Ga0307413_100099765 219
353 3300031824 Ga0307413_10058443 Ga0307413_100584433 219
354 3300031824 Ga0307413_10079455 Ga0307413_100794554 219
355 3300031852 Ga0307410_10093418 Ga0307410_100934183 219
356 3300031901 Ga0307406_10042156 Ga0307406_100421563 219
357 3300031901 Ga0307406_10143624 Ga0307406_101436242 219
358 3300031903 Ga0307407_10013484 Ga0307407_100134846 219
359 3300031911 Ga0307412_10161243 Ga0307412_101612433 219
360 3300031995 Ga0307409_100031534 Ga0307409_1000315343 219
361 3300032002 Ga0307416_100057036 Ga0307416_1000570364 219
362 3300032002 Ga0307416_100798298 Ga0307416_1007982982 219
363 3300032004 Ga0307414_10024901 Ga0307414_100249013 219
364 3300032004 Ga0307414_10126535 Ga0307414_101265353 219
365 3300032004 Ga0307414_10292389 Ga0307414_102923892 219
366 3300032005 Ga0307411_10243437 Ga0307411_102434371 219
367 3300032005 Ga0307411_10416309 Ga0307411_104163092 219
368 3300032126 Ga0307415_100106044 Ga0307415_1001060443 219
369 3300032126 Ga0307415_100158480 Ga0307415_1001584803 219
370 3300035170 Ga0373943_0263751 Ga0373943_0263751_105_776 219
371 3300035695 Ga0373927_0401446 Ga0373927_0401446_130_801 219
372 3300037418 Ga0395900_0127129 Ga0395900_0127129_1452_2111 219
373 3300037418 Ga0395900_0250373 Ga0395900_0250373_1015_1674 219
374 3300037471 Ga0395905_0061106 Ga0395905_0061106_92_751 219
375 3300037471 Ga0395905_0066681 Ga0395905_0066681_1817_2476 219
376 3300037853 Ga0436364_1451790 Ga0436364_1451790_607_1269 219
377 3300038705 Ga0237819_00574 Ga0237819_00574_10185_10844 219
378 3300041458 Ga0451798_1156044 Ga0451798_1156044_584_1243 219
379 3300041462 Ga0451806_238307 Ga0451806_238307_729_1388 219
380 3300041486 Ga0451807_1818061 Ga0451807_1818061_1297_1956 219
381 3300042005 Ga0439448_0005409 Ga0439448_0005409_165_824 219
382 3300042005 Ga0439448_0005846 Ga0439448_0005846_1011_1670 219
383 3300042012 Ga0439455_0000825 Ga0439455_0000825_2331_2990 219
384 3300042012 Ga0439455_0002152 Ga0439455_0002152_1912_2571 219
385 3300042157 Ga0439458_0004928 Ga0439458_0004928_1286_1945 219
386 3300042157 Ga0439458_0009578 Ga0439458_0009578_430_1089 219
387 3300044659 Ga0466973_0153270 Ga0466973_0153270_724_1416 219
388 3300044735 Ga0466968_0005545 Ga0466968_0005545_2351_3013 219
389 3300045976 Ga0466967_0028379 Ga0466967_0028379_282_950 219
390 3300046460 Ga0495638_0053645 Ga0495638_0053645_844_1503 219
391 3300046506 Ga0495583_0001045 Ga0495583_0001045_28173_28832 219
392 3300046507 Ga0495606_0001951 Ga0495606_0001951_19236_19898 219
393 3300046519 Ga0495632_0115290 Ga0495632_0115290_158_823 219
394 3300046665 Ga0495661_0096728 Ga0495661_0096728_658_1317 219
395 3300046691 Ga0495670_0150470 Ga0495670_0150470_41_706 219
396 3300047321 Ga0495676_0317671 Ga0495676_0317671_352_1035 219
397 3300047469 Ga0495673_0176176 Ga0495673_0176176_29_694 219
398 3300047472 Ga0495686_0000182 Ga0495686_0000182_115459_116124 219
399 3300048088 Ga0495602_0007292 Ga0495602_0007292_9758_10426 219
400 3300048906 Ga0496103_0030428 Ga0496103_0030428_1054_1716 219
401 3300048906 Ga0496103_0346101 Ga0496103_0346101_149_808 219
402 3300048914 Ga0496111_0233183 Ga0496111_0233183_610_1269 219
403 3300048920 Ga0496117_0004134 Ga0496117_0004134_968_1630 219
404 3300048921 Ga0496118_0011321 Ga0496118_0011321_2815_3477 219
405 3300048921 Ga0496118_0069894 Ga0496118_0069894_1401_2060 219
406 3300048922 Ga0496119_0045682 Ga0496119_0045682_1356_2015 219
407 3300048925 Ga0496122_0000579 Ga0496122_0000579_52543_53202 219
408 3300048926 Ga0496123_0001402 Ga0496123_0001402_26690_27349 219
409 3300048927 Ga0496124_0008457 Ga0496124_0008457_9065_9724 219
410 3300048928 Ga0496125_0004105 Ga0496125_0004105_15419_16078 219
411 3300048928 Ga0496125_0021250 Ga0496125_0021250_3556_4242 219
412 3300048929 Ga0496126_0139607 Ga0496126_0139607_271_933 219
413 3300048929 Ga0496126_0292433 Ga0496126_0292433_94_759 219
414 3300048929 Ga0496126_0628722 Ga0496126_0628722_79_765 219
415 3300049579 Ga0501043_0134872 Ga0501043_0134872_324_989 219
416 3300049580 Ga0501046_0408016 Ga0501046_0408016_141_833 219
417 3300049581 Ga0501047_0000644 Ga0501047_0000644_21698_22390 219
418 3300049582 Ga0501048_0210948 Ga0501048_0210948_159_851 219
419 3300049679 Ga0501249_000549 Ga0501249_000549_231_908 219
420 3300049686 Ga0501257_000029 Ga0501257_000029_5700_6362 219
421 3300049776 Ga0501280_003066 Ga0501280_003066_1935_2597 219
422 3300049823 Ga0501044_0116912 Ga0501044_0116912_1139_1804 219
423 3300049823 Ga0501044_0382053 Ga0501044_0382053_456_1148 219
424 3300053087 Ga0500643_000121 Ga0500643_000121_72656_73318 219
425 3300053087 Ga0500643_004524 Ga0500643_004524_2574_3266 219
426 3300053093 Ga0500651_0002188 Ga0500651_0002188_1290_1961 219
427 3300053096 Ga0500641_0012360 Ga0500641_0012360_2117_2788 219
428 3300053103 Ga0500555_000460 Ga0500555_000460_1124_1783 219
429 3300053125 Ga0500618_005557 Ga0500618_005557_2494_3165 219
430 3300053130 Ga0500642_0001441 Ga0500642_0001441_5501_6172 219
431 3300053133 Ga0500655_000061 Ga0500655_000061_5183_5854 219
432 3300053156 Ga0500622_0003437 Ga0500622_0003437_5768_6439 219
433 3300053724 Ga0500570_000268 Ga0500570_000268_4439_5110 219
434 3300053730 Ga0500645_008660 Ga0500645_008660_2343_3014 219
435 iso_pu_bacteria 2582581305 2585263907 219
436 iso_pu_bacteria 2643221541 2643730696 219
437 iso_pu_bacteria 2643221606 2644044650 219
438 iso_pu_bacteria 2643221671 2644391425 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

6

188

0.94

PF13242

Hydrolase_like

HAD-hyrolase-like

142

213

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

4

182

0.89

PF12710

HAD

haloacid dehalogenase-like hydrolase

6

179

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.9251 1 210
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.9167 1 210
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.9082 2 213
3mc1-assembly1.cif.gz_A crystal structure of a predicted phosphatase from clostridium acetobutylicum 0.8963 1 217
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.8922 1 213
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9396 88 200 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.938 2 215 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9347 99 209 3.40.50.1000
3d6jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9329 87 210 3.40.50.1000
3e58A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9252 88 213 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A352GRB0-F1-model_v4 Haloacid dehalogenase 0.9854 27 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A6H2DRP8-F1-model_v4 HAD-IA family hydrolase 0.9842 1 215 GO:0005829
GO:0006281
GO:0008967
AF-A0A2D6FWS7-F1-model_v4 Haloacid dehalogenase 0.984 2 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A2D7AB06-F1-model_v4 Haloacid dehalogenase 0.9828 1 215 GO:0005829
GO:0006281
GO:0008967
AF-A0A0N0KA37-F1-model_v4 Haloacid dehalogenase 0.9823 2 217 GO:0005829
GO:0006281
GO:0008967

Feature Viewer

pLDDT pTM Quality
94.81 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map