F444096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 438 | 245 | 430 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0034107|Ga0500568_0034107_983_1645 |
| Length | 220 |
| Sequence | MTNRLALFDCDGTLVDSQANICQSMEEAFQLGGLVAPERSAIRRIIGLSVVEAIAALSPELDDARHRTLAEEYKASFFRLRASGAMEEEPLFDGMIAALDALAKAGWLFGVATGKSDRGLARILAHHGIADRFVTLQTADRHPSKPHPSMVELAMAEAGASPETTVMIGDTSYDMMMGRAAGTRALGVAWGYHPPEELHAAGAHAVAETVASLPAHMETV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 4 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 5 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 6 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 7 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 8 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 9 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 176 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 180 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 181 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 184 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 185 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 186 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 228 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 229 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 230 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 232 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 235 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 236 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 237 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 238 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 239 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 240 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 241 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 243 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 244 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 245 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.49 |
| Metatranscriptomes | 0.46 |
| Isolates | 2.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.42 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 88.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008003 | 3300001979 | Bacteria | 4250 |
| 2 | JGI24739J22299_10079499 | 3300001989 | Bacteria | 1009 |
| 3 | JGI24737J22298_10036420 | 3300001990 | Bacteria | 1519 |
| 4 | JGI24735J21928_10006017 | 3300002067 | Bacteria | 4010 |
| 5 | JGI24735J21928_10015098 | 3300002067 | Bacteria | 2413 |
| 6 | JGI24735J21928_10052464 | 3300002067 | Bacteria | 1176 |
| 7 | JGI24738J21930_10000862 | 3300002075 | Bacteria | 8714 |
| 8 | JGI24738J21930_10008667 | 3300002075 | Bacteria | 2310 |
| 9 | JGI24738J21930_10015637 | 3300002075 | Bacteria | 1611 |
| 10 | JGI24749J21850_1000352 | 3300002076 | Bacteria | 6855 |
| 11 | JGI24751J29686_10000208 | 3300002459 | Bacteria | 25368 |
| 12 | rootH1_10096314 | 3300003316 | Bacteria | 1563 |
| 13 | rootH1_10096314 | 3300003323 | Bacteria | 2650 |
| 14 | Ga0065707_10242376 | 3300005295 | Bacteria | 1151 |
| 15 | Ga0070658_10000106 | 3300005327 | Bacteria | 74827 |
| 16 | Ga0070658_10009822 | 3300005327 | Bacteria | 7688 |
| 17 | Ga0070658_10228111 | 3300005327 | Bacteria | 1576 |
| 18 | Ga0070658_10429868 | 3300005327 | Bacteria | 1136 |
| 19 | Ga0070676_10000539 | 3300005328 | Bacteria | 18309 |
| 20 | Ga0070683_100008964 | 3300005329 | Bacteria | 8527 |
| 21 | Ga0070670_100000024 | 3300005331 | Bacteria | 189811 |
| 22 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 23 | Ga0070670_100043672 | 3300005331 | Bacteria | 3853 |
| 24 | Ga0070670_100179018 | 3300005331 | Bacteria | 1840 |
| 25 | Ga0068869_100000897 | 3300005334 | Bacteria | 17161 |
| 26 | Ga0070666_10208694 | 3300005335 | Bacteria | 1375 |
| 27 | Ga0070680_100014541 | 3300005336 | Bacteria | 6158 |
| 28 | Ga0070680_100203080 | 3300005336 | Bacteria | 1672 |
| 29 | Ga0068868_100000016 | 3300005338 | Bacteria | 102357 |
| 30 | Ga0070660_100001721 | 3300005339 | Bacteria | 14994 |
| 31 | Ga0070660_100012845 | 3300005339 | Bacteria | 5989 |
| 32 | Ga0070660_100024601 | 3300005339 | Bacteria | 4467 |
| 33 | Ga0070660_100035885 | 3300005339 | Bacteria | 3753 |
| 34 | Ga0070660_100298154 | 3300005339 | Bacteria | 1321 |
| 35 | Ga0070660_100342420 | 3300005339 | Bacteria | 1230 |
| 36 | Ga0070661_100009749 | 3300005344 | Bacteria | 6658 |
| 37 | Ga0070661_100060699 | 3300005344 | Bacteria | 2774 |
| 38 | Ga0070661_100122473 | 3300005344 | Bacteria | 1949 |
| 39 | Ga0070661_100525945 | 3300005344 | Bacteria | 949 |
| 40 | Ga0070692_10036566 | 3300005345 | Bacteria | 2492 |
| 41 | Ga0070668_100000027 | 3300005347 | Bacteria | 89913 |
| 42 | Ga0070669_100000047 | 3300005353 | Bacteria | 118892 |
| 43 | Ga0070669_100022152 | 3300005353 | Bacteria | 4544 |
| 44 | Ga0070669_100176901 | 3300005353 | Bacteria | 1667 |
| 45 | Ga0070671_100000517 | 3300005355 | Bacteria | 27085 |
| 46 | Ga0070671_100045799 | 3300005355 | Bacteria | 3637 |
| 47 | Ga0070674_100010143 | 3300005356 | Bacteria | 5677 |
| 48 | Ga0070673_100000017 | 3300005364 | Bacteria | 112829 |
| 49 | Ga0070659_100010665 | 3300005366 | Bacteria | 6767 |
| 50 | Ga0070659_100092203 | 3300005366 | Bacteria | 2429 |
| 51 | Ga0070659_100115805 | 3300005366 | Bacteria | 2166 |
| 52 | Ga0070659_100129198 | 3300005366 | Bacteria | 2051 |
| 53 | Ga0070659_100234503 | 3300005366 | Bacteria | 1517 |
| 54 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 55 | Ga0070667_100000143 | 3300005367 | Bacteria | 90358 |
| 56 | Ga0070667_100005804 | 3300005367 | Bacteria | 10302 |
| 57 | Ga0070667_100009122 | 3300005367 | Bacteria | 8209 |
| 58 | Ga0070709_10186278 | 3300005434 | Bacteria | 1461 |
| 59 | Ga0070714_100013377 | 3300005435 | Bacteria | 6577 |
| 60 | Ga0070713_100848387 | 3300005436 | Bacteria | 877 |
| 61 | Ga0070700_100542189 | 3300005441 | Bacteria | 902 |
| 62 | Ga0070708_100136957 | 3300005445 | Bacteria | 2269 |
| 63 | Ga0070663_100000796 | 3300005455 | Bacteria | 17138 |
| 64 | Ga0070663_100119062 | 3300005455 | Bacteria | 1992 |
| 65 | Ga0070663_100152128 | 3300005455 | Bacteria | 1775 |
| 66 | Ga0070662_100005284 | 3300005457 | Bacteria | 8242 |
| 67 | Ga0070662_100020051 | 3300005457 | Bacteria | 4550 |
| 68 | Ga0070662_100095599 | 3300005457 | Bacteria | 2240 |
| 69 | Ga0070662_100109768 | 3300005457 | Bacteria | 2100 |
| 70 | Ga0070662_100275838 | 3300005457 | Bacteria | 1359 |
| 71 | Ga0070662_100378112 | 3300005457 | Bacteria | 1165 |
| 72 | Ga0070681_10183513 | 3300005458 | Bacteria | 2013 |
| 73 | Ga0068867_100000013 | 3300005459 | Bacteria | 112835 |
| 74 | Ga0070707_100600538 | 3300005468 | Bacteria | 1063 |
| 75 | Ga0070679_100232149 | 3300005530 | Bacteria | 1804 |
| 76 | Ga0070684_100158341 | 3300005535 | Bacteria | 2053 |
| 77 | Ga0070684_100958964 | 3300005535 | Bacteria | 802 |
| 78 | Ga0068853_100018243 | 3300005539 | Bacteria | 5805 |
| 79 | Ga0068853_100233091 | 3300005539 | Bacteria | 1685 |
| 80 | Ga0070693_100031868 | 3300005547 | Bacteria | 2894 |
| 81 | Ga0068855_100062852 | 3300005563 | Bacteria | 4334 |
| 82 | Ga0068855_100112911 | 3300005563 | Bacteria | 3118 |
| 83 | Ga0068855_100113543 | 3300005563 | Bacteria | 3107 |
| 84 | Ga0068855_100399949 | 3300005563 | Bacteria | 1505 |
| 85 | Ga0070664_100022817 | 3300005564 | Bacteria | 5162 |
| 86 | Ga0070664_100457181 | 3300005564 | Bacteria | 1173 |
| 87 | Ga0068857_100043590 | 3300005577 | Bacteria | 3979 |
| 88 | Ga0068857_100340249 | 3300005577 | Bacteria | 1388 |
| 89 | Ga0068854_100004495 | 3300005578 | Bacteria | 8794 |
| 90 | Ga0068854_100255631 | 3300005578 | Bacteria | 1401 |
| 91 | Ga0068854_100378527 | 3300005578 | Bacteria | 1166 |
| 92 | Ga0068852_100073474 | 3300005616 | Bacteria | 3008 |
| 93 | Ga0068852_100146209 | 3300005616 | Bacteria | 2193 |
| 94 | Ga0068852_100164455 | 3300005616 | Bacteria | 2075 |
| 95 | Ga0068852_100318949 | 3300005616 | Bacteria | 1509 |
| 96 | Ga0068859_100068195 | 3300005617 | Bacteria | 3592 |
| 97 | Ga0068859_100172865 | 3300005617 | Bacteria | 2242 |
| 98 | Ga0068859_100779677 | 3300005617 | Bacteria | 1044 |
| 99 | Ga0068864_100000036 | 3300005618 | Bacteria | 189811 |
| 100 | Ga0068864_100000100 | 3300005618 | Bacteria | 85101 |
| 101 | Ga0068864_100004795 | 3300005618 | Bacteria | 11081 |
| 102 | Ga0068861_100014302 | 3300005719 | Bacteria | 5566 |
| 103 | Ga0068861_100021348 | 3300005719 | Bacteria | 4654 |
| 104 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 105 | Ga0068863_100001489 | 3300005841 | Bacteria | 23203 |
| 106 | Ga0068863_100002193 | 3300005841 | Bacteria | 19382 |
| 107 | Ga0068863_100078729 | 3300005841 | Bacteria | 3122 |
| 108 | Ga0068858_100000103 | 3300005842 | Bacteria | 88754 |
| 109 | Ga0068858_101052441 | 3300005842 | Bacteria | 798 |
| 110 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 111 | Ga0068860_100000181 | 3300005843 | Bacteria | 101627 |
| 112 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 113 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 114 | Ga0068862_100030592 | 3300005844 | Bacteria | 4538 |
| 115 | Ga0075366_10361102 | 3300006195 | Bacteria | 892 |
| 116 | Ga0097621_100042519 | 3300006237 | Bacteria | 3660 |
| 117 | Ga0068871_100046305 | 3300006358 | Bacteria | 3503 |
| 118 | Ga0068865_100000007 | 3300006881 | Bacteria | 185316 |
| 119 | Ga0097620_100068194 | 3300006931 | Bacteria | 3592 |
| 120 | Ga0097620_100172856 | 3300006931 | Bacteria | 2242 |
| 121 | Ga0097620_100779619 | 3300006931 | Bacteria | 1044 |
| 122 | Ga0105251_10000159 | 3300009011 | Bacteria | 68974 |
| 123 | Ga0105245_10001117 | 3300009098 | Bacteria | 24272 |
| 124 | Ga0105247_10002348 | 3300009101 | Bacteria | 12907 |
| 125 | Ga0105243_10000118 | 3300009148 | Bacteria | 91438 |
| 126 | Ga0105241_10097165 | 3300009174 | Bacteria | 2334 |
| 127 | Ga0105242_10000196 | 3300009176 | Bacteria | 46996 |
| 128 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 129 | Ga0105248_10000091 | 3300009177 | Bacteria | 101191 |
| 130 | Ga0105248_10000117 | 3300009177 | Bacteria | 90169 |
| 131 | Ga0105248_10014281 | 3300009177 | Bacteria | 8743 |
| 132 | Ga0105248_10096390 | 3300009177 | Bacteria | 3332 |
| 133 | Ga0105237_10180910 | 3300009545 | Bacteria | 2109 |
| 134 | Ga0105238_10046443 | 3300009551 | Bacteria | 4383 |
| 135 | Ga0105238_10179420 | 3300009551 | Bacteria | 2095 |
| 136 | Ga0105238_10331424 | 3300009551 | Bacteria | 1509 |
| 137 | Ga0105249_10000110 | 3300009553 | Bacteria | 111292 |
| 138 | Ga0105249_10030391 | 3300009553 | Bacteria | 4883 |
| 139 | Ga0105249_10128148 | 3300009553 | Bacteria | 2419 |
| 140 | Ga0105249_10374129 | 3300009553 | Bacteria | 1449 |
| 141 | Ga0105239_10081502 | 3300010375 | Bacteria | 3562 |
| 142 | Ga0105239_10728809 | 3300010375 | Bacteria | 1134 |
| 143 | Ga0105246_10000313 | 3300011119 | Bacteria | 25771 |
| 144 | Ga0105246_10001202 | 3300011119 | Bacteria | 15122 |
| 145 | Ga0105246_10331057 | 3300011119 | Bacteria | 1241 |
| 146 | Ga0157373_10028832 | 3300013100 | Bacteria | 4003 |
| 147 | Ga0157371_10168989 | 3300013102 | Bacteria | 1562 |
| 148 | Ga0157371_10173437 | 3300013102 | Bacteria | 1541 |
| 149 | Ga0157370_10175975 | 3300013104 | Bacteria | 1989 |
| 150 | Ga0157369_10094918 | 3300013105 | Bacteria | 3183 |
| 151 | Ga0157369_10166611 | 3300013105 | Bacteria | 2323 |
| 152 | Ga0157374_10000189 | 3300013296 | Bacteria | 57356 |
| 153 | Ga0157374_10249045 | 3300013296 | Bacteria | 1748 |
| 154 | Ga0157378_10000264 | 3300013297 | Bacteria | 51230 |
| 155 | Ga0157378_10377826 | 3300013297 | Bacteria | 1391 |
| 156 | Ga0163162_10785672 | 3300013306 | Bacteria | 1070 |
| 157 | Ga0157372_10106932 | 3300013307 | Bacteria | 3201 |
| 158 | Ga0157372_10314220 | 3300013307 | Bacteria | 1824 |
| 159 | Ga0157372_10604998 | 3300013307 | Bacteria | 1278 |
| 160 | Ga0157372_10659734 | 3300013307 | Bacteria | 1218 |
| 161 | Ga0157375_10000436 | 3300013308 | Bacteria | 37738 |
| 162 | Ga0163163_10122145 | 3300014325 | Bacteria | 2639 |
| 163 | Ga0157380_10261660 | 3300014326 | Unclassified | 1572 |
| 164 | Ga0157377_10006746 | 3300014745 | Bacteria | 5499 |
| 165 | Ga0157379_10200180 | 3300014968 | Bacteria | 1806 |
| 166 | Ga0157376_10000081 | 3300014969 | Bacteria | 72584 |
| 167 | Ga0163161_10000889 | 3300017792 | Bacteria | 23198 |
| 168 | Ga0206354_11297273 | 3300020081 | Bacteria | 3163 |
| 169 | Ga0206353_10734548 | 3300020082 | Bacteria | 11682 |
| 170 | Ga0209455_1000852 | 3300025272 | Bacteria | 16300 |
| 171 | Ga0207697_10069606 | 3300025315 | Bacteria | 1473 |
| 172 | Ga0207713_1013727 | 3300025735 | Bacteria | 4253 |
| 173 | Ga0207710_10180110 | 3300025900 | Bacteria | 1036 |
| 174 | Ga0207680_10116567 | 3300025903 | Bacteria | 1741 |
| 175 | Ga0207647_10002587 | 3300025904 | Bacteria | 13693 |
| 176 | Ga0207647_10012237 | 3300025904 | Bacteria | 5980 |
| 177 | Ga0207647_10025797 | 3300025904 | Bacteria | 3854 |
| 178 | Ga0207645_10009653 | 3300025907 | Bacteria | 6666 |
| 179 | Ga0207645_10088379 | 3300025907 | Bacteria | 1992 |
| 180 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 181 | Ga0207705_10000078 | 3300025909 | Bacteria | 120247 |
| 182 | Ga0207705_10006309 | 3300025909 | Bacteria | 8800 |
| 183 | Ga0207705_10008392 | 3300025909 | Bacteria | 7543 |
| 184 | Ga0207705_10020175 | 3300025909 | Bacteria | 4768 |
| 185 | Ga0207705_10404269 | 3300025909 | Bacteria | 1056 |
| 186 | Ga0207705_10404387 | 3300025909 | Bacteria | 1056 |
| 187 | Ga0207707_10027736 | 3300025912 | Bacteria | 4952 |
| 188 | Ga0207707_10506466 | 3300025912 | Bacteria | 1029 |
| 189 | Ga0207695_10089973 | 3300025913 | Bacteria | 3086 |
| 190 | Ga0207671_10001230 | 3300025914 | Bacteria | 30301 |
| 191 | Ga0207671_10227210 | 3300025914 | Bacteria | 1463 |
| 192 | Ga0207660_10630285 | 3300025917 | Bacteria | 874 |
| 193 | Ga0207657_10001650 | 3300025919 | Bacteria | 24065 |
| 194 | Ga0207657_10002766 | 3300025919 | Bacteria | 18890 |
| 195 | Ga0207657_10012537 | 3300025919 | Bacteria | 8360 |
| 196 | Ga0207657_10034852 | 3300025919 | Bacteria | 4519 |
| 197 | Ga0207657_10040899 | 3300025919 | Bacteria | 4104 |
| 198 | Ga0207657_10149472 | 3300025919 | Bacteria | 1903 |
| 199 | Ga0207657_10161823 | 3300025919 | Bacteria | 1817 |
| 200 | Ga0207657_10464528 | 3300025919 | Bacteria | 993 |
| 201 | Ga0207649_10225286 | 3300025920 | Bacteria | 1338 |
| 202 | Ga0207652_10018425 | 3300025921 | Bacteria | 5726 |
| 203 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 204 | Ga0207681_10013312 | 3300025923 | Bacteria | 5088 |
| 205 | Ga0207694_10036314 | 3300025924 | Bacteria | 3782 |
| 206 | Ga0207694_10391566 | 3300025924 | Bacteria | 1155 |
| 207 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 208 | Ga0207650_10000243 | 3300025925 | Bacteria | 59507 |
| 209 | Ga0207650_10327292 | 3300025925 | Bacteria | 1256 |
| 210 | Ga0207687_10001736 | 3300025927 | Bacteria | 15019 |
| 211 | Ga0207700_10723459 | 3300025928 | Bacteria | 889 |
| 212 | Ga0207664_10045186 | 3300025929 | Bacteria | 3453 |
| 213 | Ga0207644_10000066 | 3300025931 | Bacteria | 76450 |
| 214 | Ga0207644_10013756 | 3300025931 | Bacteria | 5404 |
| 215 | Ga0207690_10077557 | 3300025932 | Bacteria | 2310 |
| 216 | Ga0207690_10099351 | 3300025932 | Bacteria | 2075 |
| 217 | Ga0207706_10006555 | 3300025933 | Bacteria | 10783 |
| 218 | Ga0207706_10006922 | 3300025933 | Bacteria | 10484 |
| 219 | Ga0207706_10018370 | 3300025933 | Bacteria | 6292 |
| 220 | Ga0207706_10030960 | 3300025933 | Bacteria | 4770 |
| 221 | Ga0207706_10035652 | 3300025933 | Bacteria | 4421 |
| 222 | Ga0207706_10148586 | 3300025933 | Bacteria | 2061 |
| 223 | Ga0207706_10289940 | 3300025933 | Bacteria | 1427 |
| 224 | Ga0207686_10000260 | 3300025934 | Bacteria | 39872 |
| 225 | Ga0207709_10000156 | 3300025935 | Bacteria | 93099 |
| 226 | Ga0207709_10499993 | 3300025935 | Bacteria | 948 |
| 227 | Ga0207669_10037263 | 3300025937 | Bacteria | 2788 |
| 228 | Ga0207704_10000017 | 3300025938 | Bacteria | 154190 |
| 229 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 230 | Ga0207711_10002409 | 3300025941 | Bacteria | 16703 |
| 231 | Ga0207711_10008194 | 3300025941 | Bacteria | 8748 |
| 232 | Ga0207661_10263746 | 3300025944 | Bacteria | 1535 |
| 233 | Ga0207667_10034052 | 3300025949 | Bacteria | 5473 |
| 234 | Ga0207667_10047029 | 3300025949 | Bacteria | 4568 |
| 235 | Ga0207667_10119340 | 3300025949 | Bacteria | 2718 |
| 236 | Ga0207667_10140301 | 3300025949 | Bacteria | 2488 |
| 237 | Ga0207667_10157047 | 3300025949 | Bacteria | 2340 |
| 238 | Ga0207651_10000011 | 3300025960 | Bacteria | 191950 |
| 239 | Ga0207712_10000701 | 3300025961 | Bacteria | 25878 |
| 240 | Ga0207712_10068069 | 3300025961 | Bacteria | 2549 |
| 241 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 242 | Ga0207640_10000067 | 3300025981 | Bacteria | 85026 |
| 243 | Ga0207640_10088966 | 3300025981 | Bacteria | 2133 |
| 244 | Ga0207640_10327107 | 3300025981 | Bacteria | 1223 |
| 245 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 246 | Ga0207658_10000164 | 3300025986 | Bacteria | 70677 |
| 247 | Ga0207658_10001400 | 3300025986 | Bacteria | 18802 |
| 248 | Ga0207658_10004090 | 3300025986 | Bacteria | 10173 |
| 249 | Ga0207677_10000173 | 3300026023 | Bacteria | 50916 |
| 250 | Ga0207703_10000538 | 3300026035 | Bacteria | 38989 |
| 251 | Ga0207639_10014604 | 3300026041 | Bacteria | 5530 |
| 252 | Ga0207639_10151574 | 3300026041 | Bacteria | 1942 |
| 253 | Ga0207639_10238419 | 3300026041 | Bacteria | 1580 |
| 254 | Ga0207639_10257639 | 3300026041 | Bacteria | 1524 |
| 255 | Ga0207639_10614630 | 3300026041 | Bacteria | 1003 |
| 256 | Ga0207678_10006666 | 3300026067 | Bacteria | 10234 |
| 257 | Ga0207678_10079011 | 3300026067 | Bacteria | 2817 |
| 258 | Ga0207678_10094849 | 3300026067 | Bacteria | 2550 |
| 259 | Ga0207678_10426658 | 3300026067 | Bacteria | 1150 |
| 260 | Ga0207678_10433926 | 3300026067 | Bacteria | 1140 |
| 261 | Ga0207708_10155182 | 3300026075 | Bacteria | 1805 |
| 262 | Ga0207702_10000974 | 3300026078 | Bacteria | 29347 |
| 263 | Ga0207702_10028743 | 3300026078 | Bacteria | 4623 |
| 264 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 265 | Ga0207641_10000228 | 3300026088 | Bacteria | 72357 |
| 266 | Ga0207641_10000755 | 3300026088 | Bacteria | 34850 |
| 267 | Ga0207641_10051482 | 3300026088 | Bacteria | 3487 |
| 268 | Ga0207648_10000045 | 3300026089 | Bacteria | 111963 |
| 269 | Ga0207648_10052058 | 3300026089 | Bacteria | 3580 |
| 270 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 271 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 272 | Ga0207676_10003587 | 3300026095 | Bacteria | 10968 |
| 273 | Ga0207674_10002120 | 3300026116 | Bacteria | 25085 |
| 274 | Ga0207674_10066719 | 3300026116 | Bacteria | 3623 |
| 275 | Ga0207674_10280267 | 3300026116 | Bacteria | 1615 |
| 276 | Ga0207675_100006708 | 3300026118 | Bacteria | 10884 |
| 277 | Ga0207698_10006861 | 3300026142 | Bacteria | 7123 |
| 278 | Ga0207698_10037377 | 3300026142 | Bacteria | 3575 |
| 279 | Ga0207698_10158495 | 3300026142 | Bacteria | 1976 |
| 280 | Ga0207698_10268060 | 3300026142 | Bacteria | 1572 |
| 281 | Ga0209974_10038274 | 3300027876 | Bacteria | 1594 |
| 282 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 283 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 284 | Ga0268265_10004259 | 3300028380 | Bacteria | 9991 |
| 285 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 286 | Ga0268264_10000144 | 3300028381 | Bacteria | 168841 |
| 287 | Ga0307513_10330813 | 3300031456 | Bacteria | 1278 |
| 288 | Ga0307408_100033258 | 3300031548 | Bacteria | 3601 |
| 289 | Ga0307408_100060343 | 3300031548 | Bacteria | 2764 |
| 290 | Ga0307408_100362387 | 3300031548 | Bacteria | 1233 |
| 291 | Ga0316579_10020451 | 3300031691 | Bacteria | 2937 |
| 292 | Ga0307405_10062717 | 3300031731 | Bacteria | 2355 |
| 293 | Ga0307405_10125871 | 3300031731 | Bacteria | 1762 |
| 294 | Ga0307405_10512514 | 3300031731 | Bacteria | 964 |
| 295 | Ga0307413_10009976 | 3300031824 | Bacteria | 4577 |
| 296 | Ga0307413_10058443 | 3300031824 | Bacteria | 2364 |
| 297 | Ga0307413_10079455 | 3300031824 | Bacteria | 2097 |
| 298 | Ga0307413_10190840 | 3300031824 | Bacteria | 1471 |
| 299 | Ga0307410_10093418 | 3300031852 | Bacteria | 2140 |
| 300 | Ga0307410_10306529 | 3300031852 | Bacteria | 1255 |
| 301 | Ga0307406_10029506 | 3300031901 | Bacteria | 3322 |
| 302 | Ga0307406_10042156 | 3300031901 | Bacteria | 2848 |
| 303 | Ga0307406_10143624 | 3300031901 | Bacteria | 1693 |
| 304 | Ga0307407_10013484 | 3300031903 | Bacteria | 3969 |
| 305 | Ga0307407_10053879 | 3300031903 | Bacteria | 2316 |
| 306 | Ga0307407_10431042 | 3300031903 | Bacteria | 952 |
| 307 | Ga0307412_10161243 | 3300031911 | Bacteria | 1666 |
| 308 | Ga0307409_100031534 | 3300031995 | Bacteria | 3827 |
| 309 | Ga0307409_100040513 | 3300031995 | Bacteria | 3469 |
| 310 | Ga0307416_100005058 | 3300032002 | Bacteria | 8040 |
| 311 | Ga0307416_100057036 | 3300032002 | Bacteria | 3156 |
| 312 | Ga0307416_100798298 | 3300032002 | Bacteria | 1039 |
| 313 | Ga0307414_10024901 | 3300032004 | Bacteria | 3823 |
| 314 | Ga0307414_10126535 | 3300032004 | Bacteria | 1975 |
| 315 | Ga0307414_10292389 | 3300032004 | Bacteria | 1374 |
| 316 | Ga0307411_10241131 | 3300032005 | Bacteria | 1415 |
| 317 | Ga0307411_10243437 | 3300032005 | Bacteria | 1409 |
| 318 | Ga0307411_10416309 | 3300032005 | Bacteria | 1115 |
| 319 | Ga0307415_100012336 | 3300032126 | Bacteria | 4938 |
| 320 | Ga0307415_100106044 | 3300032126 | Bacteria | 2074 |
| 321 | Ga0307415_100158480 | 3300032126 | Bacteria | 1751 |
| 322 | Ga0307415_100199060 | 3300032126 | Bacteria | 1588 |
| 323 | Ga0316583_10122427 | 3300032133 | Bacteria | 906 |
| 324 | Ga0373943_0263751 | 3300035170 | Bacteria | 970 |
| 325 | Ga0373931_0088346 | 3300035691 | Bacteria | 1722 |
| 326 | Ga0373927_0401446 | 3300035695 | Bacteria | 904 |
| 327 | Ga0316582_0002286 | 3300036647 | Bacteria | 8940 |
| 328 | Ga0316584_0021485 | 3300036712 | Bacteria | 4692 |
| 329 | Ga0395899_0000140 | 3300037312 | Bacteria | 109989 |
| 330 | Ga0395900_0000075 | 3300037418 | Bacteria | 183525 |
| 331 | Ga0395900_0127129 | 3300037418 | Bacteria | 2614 |
| 332 | Ga0395900_0250373 | 3300037418 | Bacteria | 1773 |
| 333 | Ga0395898_0000055 | 3300037466 | Bacteria | 278557 |
| 334 | Ga0395898_0590052 | 3300037466 | Bacteria | 1054 |
| 335 | Ga0395905_0000067 | 3300037471 | Bacteria | 181887 |
| 336 | Ga0395905_0061106 | 3300037471 | Bacteria | 3524 |
| 337 | Ga0395905_0066681 | 3300037471 | Bacteria | 3371 |
| 338 | Ga0395905_0109845 | 3300037471 | Bacteria | 2589 |
| 339 | Ga0316581_0067078 | 3300037588 | Bacteria | 1102 |
| 340 | Ga0436364_1451790 | 3300037853 | Bacteria | 1745 |
| 341 | Ga0395901_0000874 | 3300038443 | Bacteria | 33249 |
| 342 | Ga0395901_0017781 | 3300038443 | Bacteria | 7257 |
| 343 | Ga0395901_0242802 | 3300038443 | Bacteria | 1878 |
| 344 | Ga0237819_00574 | 3300038705 | Bacteria | 12342 |
| 345 | Ga0451798_1156044 | 3300041458 | Bacteria | 1584 |
| 346 | Ga0451806_238307 | 3300041462 | Bacteria | 2723 |
| 347 | Ga0451807_1818061 | 3300041486 | Bacteria | 2350 |
| 348 | Ga0451849_0048903 | 3300041505 | Bacteria | 915 |
| 349 | Ga0451843_1270735 | 3300041509 | Bacteria | 1296 |
| 350 | Ga0451843_1272912 | 3300041509 | Bacteria | 919 |
| 351 | Ga0439448_0005409 | 3300042005 | Bacteria | 3642 |
| 352 | Ga0439448_0005846 | 3300042005 | Bacteria | 3516 |
| 353 | Ga0439449_0182011 | 3300042007 | Bacteria | 786 |
| 354 | Ga0439450_101917 | 3300042008 | Bacteria | 729 |
| 355 | Ga0439455_0000825 | 3300042012 | Bacteria | 4727 |
| 356 | Ga0439455_0002152 | 3300042012 | Bacteria | 3523 |
| 357 | Ga0439455_0025538 | 3300042012 | Bacteria | 1436 |
| 358 | Ga0439458_0004928 | 3300042157 | Bacteria | 3029 |
| 359 | Ga0439458_0009578 | 3300042157 | Bacteria | 2158 |
| 360 | Ga0466973_0153270 | 3300044659 | Bacteria | 1817 |
| 361 | Ga0466964_0123065 | 3300044706 | Bacteria | 1172 |
| 362 | Ga0466968_0005545 | 3300044735 | Bacteria | 4725 |
| 363 | Ga0466967_0028379 | 3300045976 | Bacteria | 4671 |
| 364 | Ga0495638_0053645 | 3300046460 | Bacteria | 2509 |
| 365 | Ga0495638_0285980 | 3300046460 | Bacteria | 894 |
| 366 | Ga0495607_0081994 | 3300046501 | Bacteria | 1771 |
| 367 | Ga0495583_0001045 | 3300046506 | Bacteria | 31275 |
| 368 | Ga0495606_0001951 | 3300046507 | Bacteria | 25484 |
| 369 | Ga0495610_0000061 | 3300046512 | Bacteria | 130986 |
| 370 | Ga0495620_0015611 | 3300046515 | Bacteria | 3829 |
| 371 | Ga0495632_0115290 | 3300046519 | Bacteria | 1259 |
| 372 | Ga0495643_0060686 | 3300046522 | Bacteria | 2007 |
| 373 | Ga0495609_0075629 | 3300046538 | Bacteria | 1476 |
| 374 | Ga0495633_0242385 | 3300046558 | Bacteria | 823 |
| 375 | Ga0495661_0096728 | 3300046665 | Bacteria | 1669 |
| 376 | Ga0495670_0150470 | 3300046691 | Bacteria | 1220 |
| 377 | Ga0495676_0317671 | 3300047321 | Bacteria | 1047 |
| 378 | Ga0495673_0176176 | 3300047469 | Bacteria | 812 |
| 379 | Ga0495686_0000182 | 3300047472 | Bacteria | 119682 |
| 380 | Ga0495602_0007292 | 3300048088 | Bacteria | 11575 |
| 381 | Ga0496103_0030428 | 3300048906 | Bacteria | 3285 |
| 382 | Ga0496103_0346101 | 3300048906 | Bacteria | 956 |
| 383 | Ga0496104_0014234 | 3300048907 | Bacteria | 7179 |
| 384 | Ga0496105_0000481 | 3300048908 | Bacteria | 26219 |
| 385 | Ga0496107_0584905 | 3300048910 | Bacteria | 826 |
| 386 | Ga0496111_0233183 | 3300048914 | Bacteria | 1367 |
| 387 | Ga0496117_0004134 | 3300048920 | Bacteria | 16237 |
| 388 | Ga0496118_0011321 | 3300048921 | Bacteria | 8719 |
| 389 | Ga0496118_0069894 | 3300048921 | Bacteria | 2539 |
| 390 | Ga0496119_0045682 | 3300048922 | Bacteria | 2743 |
| 391 | Ga0496121_0138766 | 3300048924 | Bacteria | 1807 |
| 392 | Ga0496122_0000579 | 3300048925 | Bacteria | 75073 |
| 393 | Ga0496123_0001402 | 3300048926 | Bacteria | 33737 |
| 394 | Ga0496124_0008457 | 3300048927 | Bacteria | 10757 |
| 395 | Ga0496125_0004105 | 3300048928 | Bacteria | 17024 |
| 396 | Ga0496125_0021250 | 3300048928 | Bacteria | 6061 |
| 397 | Ga0496126_0139607 | 3300048929 | Bacteria | 2087 |
| 398 | Ga0496126_0292433 | 3300048929 | Bacteria | 1347 |
| 399 | Ga0496126_0628722 | 3300048929 | Bacteria | 843 |
| 400 | Ga0501031_0438703 | 3300049568 | Bacteria | 844 |
| 401 | Ga0501033_0305257 | 3300049570 | Bacteria | 1120 |
| 402 | Ga0501034_0364413 | 3300049571 | Bacteria | 1372 |
| 403 | Ga0501043_0134872 | 3300049579 | Bacteria | 1934 |
| 404 | Ga0501046_0408016 | 3300049580 | Bacteria | 981 |
| 405 | Ga0501047_0000644 | 3300049581 | Bacteria | 36698 |
| 406 | Ga0501047_0049234 | 3300049581 | Bacteria | 4069 |
| 407 | Ga0501047_0170168 | 3300049581 | Bacteria | 2048 |
| 408 | Ga0501048_0210948 | 3300049582 | Bacteria | 1377 |
| 409 | Ga0501239_017457 | 3300049672 | Bacteria | 855 |
| 410 | Ga0501249_000549 | 3300049679 | Bacteria | 9020 |
| 411 | Ga0501257_000029 | 3300049686 | Bacteria | 42945 |
| 412 | Ga0501270_017660 | 3300049767 | Bacteria | 1047 |
| 413 | Ga0501273_020887 | 3300049770 | Bacteria | 886 |
| 414 | Ga0501280_003066 | 3300049776 | Bacteria | 2631 |
| 415 | Ga0501044_0116912 | 3300049823 | Bacteria | 2671 |
| 416 | Ga0501044_0129248 | 3300049823 | Bacteria | 2521 |
| 417 | Ga0501044_0382053 | 3300049823 | Bacteria | 1323 |
| 418 | Ga0500643_000121 | 3300053087 | Bacteria | 81461 |
| 419 | Ga0500643_004524 | 3300053087 | Bacteria | 6250 |
| 420 | Ga0500651_0002188 | 3300053093 | Bacteria | 10235 |
| 421 | Ga0500641_0012360 | 3300053096 | Bacteria | 3116 |
| 422 | Ga0500555_000460 | 3300053103 | Bacteria | 16899 |
| 423 | Ga0500618_005557 | 3300053125 | Bacteria | 3815 |
| 424 | Ga0500642_0001441 | 3300053130 | Bacteria | 6825 |
| 425 | Ga0500655_000061 | 3300053133 | Bacteria | 29562 |
| 426 | Ga0500568_0034107 | 3300053139 | Bacteria | 2084 |
| 427 | Ga0500616_0027249 | 3300053153 | Bacteria | 3156 |
| 428 | Ga0500622_0003437 | 3300053156 | Bacteria | 10591 |
| 429 | Ga0500570_000268 | 3300053724 | Bacteria | 17871 |
| 430 | Ga0500645_008660 | 3300053730 | Bacteria | 3455 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100298154 | Ga0070660_1002981543 | 186 |
| 2 | 3300044706 | Ga0466964_0123065 | Ga0466964_0123065_592_1158 | 186 |
| 3 | 3300002067 | JGI24735J21928_10052464 | JGI24735J21928_100524642 | 187 |
| 4 | 3300005344 | Ga0070661_100060699 | Ga0070661_1000606993 | 187 |
| 5 | 3300005457 | Ga0070662_100378112 | Ga0070662_1003781122 | 187 |
| 6 | 3300005563 | Ga0068855_100399949 | Ga0068855_1003999493 | 187 |
| 7 | 3300005577 | Ga0068857_100043590 | Ga0068857_1000435902 | 187 |
| 8 | 3300013105 | Ga0157369_10094918 | Ga0157369_100949185 | 187 |
| 9 | 3300025912 | Ga0207707_10506466 | Ga0207707_105064662 | 187 |
| 10 | 3300025933 | Ga0207706_10035652 | Ga0207706_100356522 | 187 |
| 11 | 3300026116 | Ga0207674_10002120 | Ga0207674_1000212011 | 187 |
| 12 | 3300009551 | Ga0105238_10331424 | Ga0105238_103314242 | 188 |
| 13 | 3300013307 | Ga0157372_10659734 | Ga0157372_106597342 | 188 |
| 14 | 3300025924 | Ga0207694_10391566 | Ga0207694_103915663 | 188 |
| 15 | 3300025949 | Ga0207667_10157047 | Ga0207667_101570472 | 188 |
| 16 | 3300042012 | Ga0439455_0025538 | Ga0439455_0025538_380_1009 | 193 |
| 17 | 3300005336 | Ga0070680_100203080 | Ga0070680_1002030803 | 194 |
| 18 | 3300005344 | Ga0070661_100122473 | Ga0070661_1001224732 | 194 |
| 19 | 3300005366 | Ga0070659_100115805 | Ga0070659_1001158054 | 194 |
| 20 | 3300049570 | Ga0501033_0305257 | Ga0501033_0305257_38_622 | 194 |
| 21 | 3300046558 | Ga0495633_0242385 | Ga0495633_0242385_46_633 | 195 |
| 22 | 3300005434 | Ga0070709_10186278 | Ga0070709_101862783 | 201 |
| 23 | 3300005436 | Ga0070713_100848387 | Ga0070713_1008483871 | 201 |
| 24 | 3300025928 | Ga0207700_10723459 | Ga0207700_107234591 | 201 |
| 25 | 3300048924 | Ga0496121_0138766 | Ga0496121_0138766_443_1105 | 201 |
| 26 | 3300005457 | Ga0070662_100275838 | Ga0070662_1002758382 | 202 |
| 27 | 3300025933 | Ga0207706_10289940 | Ga0207706_102899402 | 202 |
| 28 | 3300031548 | Ga0307408_100362387 | Ga0307408_1003623871 | 202 |
| 29 | 3300031901 | Ga0307406_10029506 | Ga0307406_100295063 | 202 |
| 30 | 3300031903 | Ga0307407_10053879 | Ga0307407_100538793 | 202 |
| 31 | 3300031903 | Ga0307407_10431042 | Ga0307407_104310421 | 202 |
| 32 | 3300031995 | Ga0307409_100040513 | Ga0307409_1000405134 | 202 |
| 33 | 3300037466 | Ga0395898_0590052 | Ga0395898_0590052_132_797 | 202 |
| 34 | 3300042007 | Ga0439449_0182011 | Ga0439449_0182011_38_703 | 202 |
| 35 | 3300049672 | Ga0501239_017457 | Ga0501239_017457_15_680 | 202 |
| 36 | 3300049767 | Ga0501270_017660 | Ga0501270_017660_45_710 | 202 |
| 37 | 3300049770 | Ga0501273_020887 | Ga0501273_020887_50_715 | 202 |
| 38 | 3300005366 | Ga0070659_100234503 | Ga0070659_1002345032 | 203 |
| 39 | 3300005578 | Ga0068854_100378527 | Ga0068854_1003785272 | 203 |
| 40 | 3300013297 | Ga0157378_10377826 | Ga0157378_103778262 | 203 |
| 41 | 3300014326 | Ga0157380_10261660 | Ga0157380_102616602 | 203 |
| 42 | 3300025919 | Ga0207657_10161823 | Ga0207657_101618232 | 203 |
| 43 | 3300025981 | Ga0207640_10327107 | Ga0207640_103271072 | 203 |
| 44 | 3300026089 | Ga0207648_10052058 | Ga0207648_100520585 | 203 |
| 45 | 3300031731 | Ga0307405_10512514 | Ga0307405_105125141 | 203 |
| 46 | 3300032002 | Ga0307416_100005058 | Ga0307416_1000050589 | 203 |
| 47 | 3300032126 | Ga0307415_100012336 | Ga0307415_1000123364 | 203 |
| 48 | 3300037312 | Ga0395899_0000140 | Ga0395899_0000140_10143_10808 | 203 |
| 49 | 3300037418 | Ga0395900_0000075 | Ga0395900_0000075_87001_87666 | 203 |
| 50 | 3300037466 | Ga0395898_0000055 | Ga0395898_0000055_99172_99837 | 203 |
| 51 | 3300037471 | Ga0395905_0000067 | Ga0395905_0000067_178721_179386 | 203 |
| 52 | 3300037471 | Ga0395905_0109845 | Ga0395905_0109845_1347_2012 | 203 |
| 53 | 3300038443 | Ga0395901_0000874 | Ga0395901_0000874_22753_23418 | 203 |
| 54 | 3300038443 | Ga0395901_0017781 | Ga0395901_0017781_3488_4153 | 203 |
| 55 | 3300031456 | Ga0307513_10330813 | Ga0307513_103308133 | 204 |
| 56 | 3300048910 | Ga0496107_0584905 | Ga0496107_0584905_98_766 | 204 |
| 57 | 3300038443 | Ga0395901_0242802 | Ga0395901_0242802_236_892 | 205 |
| 58 | 3300005353 | Ga0070669_100176901 | Ga0070669_1001769013 | 206 |
| 59 | 3300005457 | Ga0070662_100109768 | Ga0070662_1001097682 | 206 |
| 60 | 3300025933 | Ga0207706_10148586 | Ga0207706_101485863 | 206 |
| 61 | 3300042008 | Ga0439450_101917 | Ga0439450_101917_16_639 | 207 |
| 62 | 3300005335 | Ga0070666_10208694 | Ga0070666_102086942 | 210 |
| 63 | 3300005367 | Ga0070667_100000143 | Ga0070667_10000014325 | 210 |
| 64 | 3300005841 | Ga0068863_100001489 | Ga0068863_1000014896 | 210 |
| 65 | 3300005843 | Ga0068860_100000181 | Ga0068860_10000018136 | 210 |
| 66 | 3300009553 | Ga0105249_10374129 | Ga0105249_103741292 | 210 |
| 67 | 3300025986 | Ga0207658_10000164 | Ga0207658_1000016463 | 210 |
| 68 | 3300026088 | Ga0207641_10000755 | Ga0207641_1000075515 | 210 |
| 69 | 3300028381 | Ga0268264_10000144 | Ga0268264_10000144101 | 210 |
| 70 | 3300041505 | Ga0451849_0048903 | Ga0451849_0048903_220_870 | 210 |
| 71 | 3300005331 | Ga0070670_100043672 | Ga0070670_1000436722 | 211 |
| 72 | 3300009177 | Ga0105248_10000117 | Ga0105248_1000011777 | 211 |
| 73 | 3300025925 | Ga0207650_10327292 | Ga0207650_103272922 | 211 |
| 74 | 3300035691 | Ga0373931_0088346 | Ga0373931_0088346_124_789 | 211 |
| 75 | 3300046538 | Ga0495609_0075629 | Ga0495609_0075629_541_1224 | 211 |
| 76 | iso_pu_bacteria | 2643221588 | 2643950427 | 214 |
| 77 | iso_pu_bacteria | 2848297114 | 2848297633 | 214 |
| 78 | iso_pu_bacteria | 3000865235 | 3000866649 | 214 |
| 79 | iso_pu_bacteria | 2643221605 | 2644040832 | 215 |
| 80 | iso_pu_bacteria | 2919709256 | 2919711354 | 215 |
| 81 | 3300017792 | Ga0163161_10000889 | Ga0163161_1000088915 | 216 |
| 82 | 3300031691 | Ga0316579_10020451 | Ga0316579_100204514 | 216 |
| 83 | 3300031731 | Ga0307405_10125871 | Ga0307405_101258713 | 216 |
| 84 | 3300032133 | Ga0316583_10122427 | Ga0316583_101224272 | 216 |
| 85 | 3300036647 | Ga0316582_0002286 | Ga0316582_0002286_3097_3750 | 216 |
| 86 | 3300036712 | Ga0316584_0021485 | Ga0316584_0021485_964_1617 | 216 |
| 87 | 3300037588 | Ga0316581_0067078 | Ga0316581_0067078_318_971 | 216 |
| 88 | 3300046460 | Ga0495638_0285980 | Ga0495638_0285980_126_776 | 216 |
| 89 | 3300046501 | Ga0495607_0081994 | Ga0495607_0081994_465_1115 | 216 |
| 90 | 3300046512 | Ga0495610_0000061 | Ga0495610_0000061_45243_45893 | 216 |
| 91 | 3300046515 | Ga0495620_0015611 | Ga0495620_0015611_755_1405 | 216 |
| 92 | 3300048907 | Ga0496104_0014234 | Ga0496104_0014234_4357_5007 | 216 |
| 93 | 3300048908 | Ga0496105_0000481 | Ga0496105_0000481_24819_25469 | 216 |
| 94 | 3300049581 | Ga0501047_0170168 | Ga0501047_0170168_984_1634 | 216 |
| 95 | 3300005327 | Ga0070658_10429868 | Ga0070658_104298682 | 217 |
| 96 | 3300005329 | Ga0070683_100008964 | Ga0070683_1000089644 | 217 |
| 97 | 3300005339 | Ga0070660_100024601 | Ga0070660_1000246016 | 217 |
| 98 | 3300005455 | Ga0070663_100119062 | Ga0070663_1001190623 | 217 |
| 99 | 3300005457 | Ga0070662_100005284 | Ga0070662_1000052847 | 217 |
| 100 | 3300005535 | Ga0070684_100158341 | Ga0070684_1001583413 | 217 |
| 101 | 3300005535 | Ga0070684_100958964 | Ga0070684_1009589641 | 217 |
| 102 | 3300005563 | Ga0068855_100062852 | Ga0068855_1000628526 | 217 |
| 103 | 3300005564 | Ga0070664_100022817 | Ga0070664_1000228176 | 217 |
| 104 | 3300005564 | Ga0070664_100457181 | Ga0070664_1004571812 | 217 |
| 105 | 3300005578 | Ga0068854_100255631 | Ga0068854_1002556312 | 217 |
| 106 | 3300011119 | Ga0105246_10001202 | Ga0105246_1000120214 | 217 |
| 107 | 3300013102 | Ga0157371_10168989 | Ga0157371_101689893 | 217 |
| 108 | 3300013307 | Ga0157372_10604998 | Ga0157372_106049982 | 217 |
| 109 | 3300025909 | Ga0207705_10008392 | Ga0207705_100083923 | 217 |
| 110 | 3300025909 | Ga0207705_10404269 | Ga0207705_104042692 | 217 |
| 111 | 3300025909 | Ga0207705_10404387 | Ga0207705_104043872 | 217 |
| 112 | 3300025917 | Ga0207660_10630285 | Ga0207660_106302852 | 217 |
| 113 | 3300025919 | Ga0207657_10034852 | Ga0207657_100348526 | 217 |
| 114 | 3300025919 | Ga0207657_10464528 | Ga0207657_104645282 | 217 |
| 115 | 3300025920 | Ga0207649_10225286 | Ga0207649_102252862 | 217 |
| 116 | 3300025933 | Ga0207706_10006555 | Ga0207706_100065558 | 217 |
| 117 | 3300025944 | Ga0207661_10263746 | Ga0207661_102637462 | 217 |
| 118 | 3300025949 | Ga0207667_10034052 | Ga0207667_100340523 | 217 |
| 119 | 3300026041 | Ga0207639_10614630 | Ga0207639_106146302 | 217 |
| 120 | 3300026067 | Ga0207678_10079011 | Ga0207678_100790114 | 217 |
| 121 | 3300026067 | Ga0207678_10094849 | Ga0207678_100948493 | 217 |
| 122 | 3300026067 | Ga0207678_10426658 | Ga0207678_104266582 | 217 |
| 123 | 3300041509 | Ga0451843_1270735 | Ga0451843_1270735_260_916 | 217 |
| 124 | 3300041509 | Ga0451843_1272912 | Ga0451843_1272912_63_719 | 217 |
| 125 | 3300049568 | Ga0501031_0438703 | Ga0501031_0438703_30_686 | 217 |
| 126 | 3300049571 | Ga0501034_0364413 | Ga0501034_0364413_688_1344 | 217 |
| 127 | 3300049581 | Ga0501047_0049234 | Ga0501047_0049234_1641_2297 | 217 |
| 128 | 3300049823 | Ga0501044_0129248 | Ga0501044_0129248_1291_1947 | 217 |
| 129 | 3300005530 | Ga0070679_100232149 | Ga0070679_1002321492 | 218 |
| 130 | 3300026116 | Ga0207674_10280267 | Ga0207674_102802673 | 218 |
| 131 | 3300031824 | Ga0307413_10190840 | Ga0307413_101908402 | 218 |
| 132 | 3300031852 | Ga0307410_10306529 | Ga0307410_103065292 | 218 |
| 133 | 3300032005 | Ga0307411_10241131 | Ga0307411_102411313 | 218 |
| 134 | 3300032126 | Ga0307415_100199060 | Ga0307415_1001990602 | 218 |
| 135 | 3300046522 | Ga0495643_0060686 | Ga0495643_0060686_599_1261 | 218 |
| 136 | 3300053139 | Ga0500568_0034107 | Ga0500568_0034107_983_1645 | 218 |
| 137 | 3300053153 | Ga0500616_0027249 | Ga0500616_0027249_951_1613 | 218 |
| 138 | 3300001979 | JGI24740J21852_10008003 | JGI24740J21852_100080034 | 219 |
| 139 | 3300001989 | JGI24739J22299_10079499 | JGI24739J22299_100794992 | 219 |
| 140 | 3300001990 | JGI24737J22298_10036420 | JGI24737J22298_100364203 | 219 |
| 141 | 3300002067 | JGI24735J21928_10006017 | JGI24735J21928_100060173 | 219 |
| 142 | 3300002067 | JGI24735J21928_10015098 | JGI24735J21928_100150982 | 219 |
| 143 | 3300002075 | JGI24738J21930_10000862 | JGI24738J21930_1000086214 | 219 |
| 144 | 3300002075 | JGI24738J21930_10008667 | JGI24738J21930_100086672 | 219 |
| 145 | 3300002075 | JGI24738J21930_10015637 | JGI24738J21930_100156372 | 219 |
| 146 | 3300002076 | JGI24749J21850_1000352 | JGI24749J21850_100035210 | 219 |
| 147 | 3300002459 | JGI24751J29686_10000208 | JGI24751J29686_1000020812 | 219 |
| 148 | 3300003316 | rootH1_10096314 | rootH1_100963141 | 219 |
| 149 | 3300005295 | Ga0065707_10242376 | Ga0065707_102423762 | 219 |
| 150 | 3300005327 | Ga0070658_10000106 | Ga0070658_1000010628 | 219 |
| 151 | 3300005327 | Ga0070658_10009822 | Ga0070658_100098224 | 219 |
| 152 | 3300005327 | Ga0070658_10228111 | Ga0070658_102281112 | 219 |
| 153 | 3300005328 | Ga0070676_10000539 | Ga0070676_100005395 | 219 |
| 154 | 3300005331 | Ga0070670_100000024 | Ga0070670_10000002452 | 219 |
| 155 | 3300005331 | Ga0070670_100000027 | Ga0070670_1000000276 | 219 |
| 156 | 3300005331 | Ga0070670_100179018 | Ga0070670_1001790182 | 219 |
| 157 | 3300005334 | Ga0068869_100000897 | Ga0068869_1000008972 | 219 |
| 158 | 3300005336 | Ga0070680_100014541 | Ga0070680_1000145413 | 219 |
| 159 | 3300005338 | Ga0068868_100000016 | Ga0068868_10000001662 | 219 |
| 160 | 3300005339 | Ga0070660_100001721 | Ga0070660_10000172125 | 219 |
| 161 | 3300005339 | Ga0070660_100012845 | Ga0070660_1000128456 | 219 |
| 162 | 3300005339 | Ga0070660_100035885 | Ga0070660_1000358855 | 219 |
| 163 | 3300005339 | Ga0070660_100342420 | Ga0070660_1003424202 | 219 |
| 164 | 3300005344 | Ga0070661_100009749 | Ga0070661_1000097499 | 219 |
| 165 | 3300005344 | Ga0070661_100525945 | Ga0070661_1005259452 | 219 |
| 166 | 3300005345 | Ga0070692_10036566 | Ga0070692_100365664 | 219 |
| 167 | 3300005347 | Ga0070668_100000027 | Ga0070668_10000002776 | 219 |
| 168 | 3300005353 | Ga0070669_100000047 | Ga0070669_10000004758 | 219 |
| 169 | 3300005353 | Ga0070669_100022152 | Ga0070669_1000221523 | 219 |
| 170 | 3300005355 | Ga0070671_100000517 | Ga0070671_10000051719 | 219 |
| 171 | 3300005355 | Ga0070671_100045799 | Ga0070671_1000457996 | 219 |
| 172 | 3300005356 | Ga0070674_100010143 | Ga0070674_1000101434 | 219 |
| 173 | 3300005364 | Ga0070673_100000017 | Ga0070673_10000001794 | 219 |
| 174 | 3300005366 | Ga0070659_100010665 | Ga0070659_1000106655 | 219 |
| 175 | 3300005366 | Ga0070659_100092203 | Ga0070659_1000922032 | 219 |
| 176 | 3300005366 | Ga0070659_100129198 | Ga0070659_1001291982 | 219 |
| 177 | 3300005367 | Ga0070667_100000017 | Ga0070667_100000017167 | 219 |
| 178 | 3300005367 | Ga0070667_100005804 | Ga0070667_10000580411 | 219 |
| 179 | 3300005367 | Ga0070667_100009122 | Ga0070667_1000091225 | 219 |
| 180 | 3300005435 | Ga0070714_100013377 | Ga0070714_1000133779 | 219 |
| 181 | 3300005441 | Ga0070700_100542189 | Ga0070700_1005421892 | 219 |
| 182 | 3300005445 | Ga0070708_100136957 | Ga0070708_1001369573 | 219 |
| 183 | 3300005455 | Ga0070663_100000796 | Ga0070663_1000007969 | 219 |
| 184 | 3300005455 | Ga0070663_100152128 | Ga0070663_1001521282 | 219 |
| 185 | 3300005457 | Ga0070662_100020051 | Ga0070662_1000200513 | 219 |
| 186 | 3300005457 | Ga0070662_100095599 | Ga0070662_1000955992 | 219 |
| 187 | 3300005458 | Ga0070681_10183513 | Ga0070681_101835132 | 219 |
| 188 | 3300005459 | Ga0068867_100000013 | Ga0068867_10000001394 | 219 |
| 189 | 3300005468 | Ga0070707_100600538 | Ga0070707_1006005382 | 219 |
| 190 | 3300005539 | Ga0068853_100018243 | Ga0068853_1000182433 | 219 |
| 191 | 3300005539 | Ga0068853_100233091 | Ga0068853_1002330912 | 219 |
| 192 | 3300005547 | Ga0070693_100031868 | Ga0070693_1000318682 | 219 |
| 193 | 3300005563 | Ga0068855_100112911 | Ga0068855_1001129113 | 219 |
| 194 | 3300005563 | Ga0068855_100113543 | Ga0068855_1001135433 | 219 |
| 195 | 3300005577 | Ga0068857_100340249 | Ga0068857_1003402491 | 219 |
| 196 | 3300005578 | Ga0068854_100004495 | Ga0068854_1000044959 | 219 |
| 197 | 3300005616 | Ga0068852_100073474 | Ga0068852_1000734743 | 219 |
| 198 | 3300005616 | Ga0068852_100146209 | Ga0068852_1001462092 | 219 |
| 199 | 3300005616 | Ga0068852_100164455 | Ga0068852_1001644553 | 219 |
| 200 | 3300005616 | Ga0068852_100318949 | Ga0068852_1003189491 | 219 |
| 201 | 3300005617 | Ga0068859_100068195 | Ga0068859_1000681953 | 219 |
| 202 | 3300005617 | Ga0068859_100172865 | Ga0068859_1001728653 | 219 |
| 203 | 3300005617 | Ga0068859_100779677 | Ga0068859_1007796772 | 219 |
| 204 | 3300005618 | Ga0068864_100000036 | Ga0068864_10000003653 | 219 |
| 205 | 3300005618 | Ga0068864_100000100 | Ga0068864_10000010097 | 219 |
| 206 | 3300005618 | Ga0068864_100004795 | Ga0068864_1000047959 | 219 |
| 207 | 3300005719 | Ga0068861_100014302 | Ga0068861_1000143026 | 219 |
| 208 | 3300005719 | Ga0068861_100021348 | Ga0068861_1000213486 | 219 |
| 209 | 3300005841 | Ga0068863_100000025 | Ga0068863_100000025207 | 219 |
| 210 | 3300005841 | Ga0068863_100002193 | Ga0068863_10000219310 | 219 |
| 211 | 3300005841 | Ga0068863_100078729 | Ga0068863_1000787292 | 219 |
| 212 | 3300005842 | Ga0068858_100000103 | Ga0068858_10000010314 | 219 |
| 213 | 3300005842 | Ga0068858_101052441 | Ga0068858_1010524411 | 219 |
| 214 | 3300005843 | Ga0068860_100000056 | Ga0068860_10000005677 | 219 |
| 215 | 3300005844 | Ga0068862_100000027 | Ga0068862_1000000276 | 219 |
| 216 | 3300005844 | Ga0068862_100000033 | Ga0068862_10000003351 | 219 |
| 217 | 3300005844 | Ga0068862_100030592 | Ga0068862_1000305926 | 219 |
| 218 | 3300006195 | Ga0075366_10361102 | Ga0075366_103611022 | 219 |
| 219 | 3300006237 | Ga0097621_100042519 | Ga0097621_1000425194 | 219 |
| 220 | 3300006358 | Ga0068871_100046305 | Ga0068871_1000463054 | 219 |
| 221 | 3300006881 | Ga0068865_100000007 | Ga0068865_100000007126 | 219 |
| 222 | 3300006931 | Ga0097620_100068194 | Ga0097620_1000681945 | 219 |
| 223 | 3300006931 | Ga0097620_100172856 | Ga0097620_1001728563 | 219 |
| 224 | 3300006931 | Ga0097620_100779619 | Ga0097620_1007796192 | 219 |
| 225 | 3300009011 | Ga0105251_10000159 | Ga0105251_1000015973 | 219 |
| 226 | 3300009098 | Ga0105245_10001117 | Ga0105245_1000111712 | 219 |
| 227 | 3300009101 | Ga0105247_10002348 | Ga0105247_100023489 | 219 |
| 228 | 3300009148 | Ga0105243_10000118 | Ga0105243_1000011811 | 219 |
| 229 | 3300009174 | Ga0105241_10097165 | Ga0105241_100971653 | 219 |
| 230 | 3300009176 | Ga0105242_10000196 | Ga0105242_1000019629 | 219 |
| 231 | 3300009177 | Ga0105248_10000026 | Ga0105248_10000026222 | 219 |
| 232 | 3300009177 | Ga0105248_10000091 | Ga0105248_1000009153 | 219 |
| 233 | 3300009177 | Ga0105248_10014281 | Ga0105248_100142812 | 219 |
| 234 | 3300009177 | Ga0105248_10096390 | Ga0105248_100963903 | 219 |
| 235 | 3300009545 | Ga0105237_10180910 | Ga0105237_101809102 | 219 |
| 236 | 3300009551 | Ga0105238_10046443 | Ga0105238_100464432 | 219 |
| 237 | 3300009551 | Ga0105238_10179420 | Ga0105238_101794203 | 219 |
| 238 | 3300009553 | Ga0105249_10000110 | Ga0105249_1000011019 | 219 |
| 239 | 3300009553 | Ga0105249_10030391 | Ga0105249_100303916 | 219 |
| 240 | 3300009553 | Ga0105249_10128148 | Ga0105249_101281482 | 219 |
| 241 | 3300010375 | Ga0105239_10081502 | Ga0105239_100815022 | 219 |
| 242 | 3300010375 | Ga0105239_10728809 | Ga0105239_107288091 | 219 |
| 243 | 3300011119 | Ga0105246_10000313 | Ga0105246_1000031317 | 219 |
| 244 | 3300011119 | Ga0105246_10331057 | Ga0105246_103310572 | 219 |
| 245 | 3300013100 | Ga0157373_10028832 | Ga0157373_100288323 | 219 |
| 246 | 3300013102 | Ga0157371_10173437 | Ga0157371_101734373 | 219 |
| 247 | 3300013104 | Ga0157370_10175975 | Ga0157370_101759752 | 219 |
| 248 | 3300013105 | Ga0157369_10166611 | Ga0157369_101666113 | 219 |
| 249 | 3300013296 | Ga0157374_10000189 | Ga0157374_1000018954 | 219 |
| 250 | 3300013296 | Ga0157374_10249045 | Ga0157374_102490452 | 219 |
| 251 | 3300013297 | Ga0157378_10000264 | Ga0157378_1000026455 | 219 |
| 252 | 3300013306 | Ga0163162_10785672 | Ga0163162_107856722 | 219 |
| 253 | 3300013307 | Ga0157372_10106932 | Ga0157372_101069323 | 219 |
| 254 | 3300013307 | Ga0157372_10314220 | Ga0157372_103142201 | 219 |
| 255 | 3300013308 | Ga0157375_10000436 | Ga0157375_1000043611 | 219 |
| 256 | 3300014325 | Ga0163163_10122145 | Ga0163163_101221454 | 219 |
| 257 | 3300014745 | Ga0157377_10006746 | Ga0157377_100067464 | 219 |
| 258 | 3300014968 | Ga0157379_10200180 | Ga0157379_102001802 | 219 |
| 259 | 3300014969 | Ga0157376_10000081 | Ga0157376_1000008129 | 219 |
| 260 | 3300020081 | Ga0206354_11297273 | Ga0206354_112972732 | 219 |
| 261 | 3300020082 | Ga0206353_10734548 | Ga0206353_107345484 | 219 |
| 262 | 3300025272 | Ga0209455_1000852 | Ga0209455_100085219 | 219 |
| 263 | 3300025315 | Ga0207697_10069606 | Ga0207697_100696063 | 219 |
| 264 | 3300025735 | Ga0207713_1013727 | Ga0207713_10137274 | 219 |
| 265 | 3300025900 | Ga0207710_10180110 | Ga0207710_101801103 | 219 |
| 266 | 3300025903 | Ga0207680_10116567 | Ga0207680_101165673 | 219 |
| 267 | 3300025904 | Ga0207647_10002587 | Ga0207647_1000258720 | 219 |
| 268 | 3300025904 | Ga0207647_10012237 | Ga0207647_100122374 | 219 |
| 269 | 3300025904 | Ga0207647_10025797 | Ga0207647_100257973 | 219 |
| 270 | 3300025907 | Ga0207645_10009653 | Ga0207645_100096537 | 219 |
| 271 | 3300025907 | Ga0207645_10088379 | Ga0207645_100883792 | 219 |
| 272 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002413 | 219 |
| 273 | 3300025909 | Ga0207705_10000078 | Ga0207705_10000078104 | 219 |
| 274 | 3300025909 | Ga0207705_10006309 | Ga0207705_100063098 | 219 |
| 275 | 3300025909 | Ga0207705_10020175 | Ga0207705_100201758 | 219 |
| 276 | 3300025912 | Ga0207707_10027736 | Ga0207707_100277361 | 219 |
| 277 | 3300025913 | Ga0207695_10089973 | Ga0207695_100899735 | 219 |
| 278 | 3300025914 | Ga0207671_10001230 | Ga0207671_1000123030 | 219 |
| 279 | 3300025914 | Ga0207671_10227210 | Ga0207671_102272102 | 219 |
| 280 | 3300025919 | Ga0207657_10001650 | Ga0207657_100016506 | 219 |
| 281 | 3300025919 | Ga0207657_10002766 | Ga0207657_1000276624 | 219 |
| 282 | 3300025919 | Ga0207657_10012537 | Ga0207657_100125379 | 219 |
| 283 | 3300025919 | Ga0207657_10040899 | Ga0207657_100408992 | 219 |
| 284 | 3300025919 | Ga0207657_10149472 | Ga0207657_101494722 | 219 |
| 285 | 3300025921 | Ga0207652_10018425 | Ga0207652_100184253 | 219 |
| 286 | 3300025923 | Ga0207681_10000014 | Ga0207681_10000014140 | 219 |
| 287 | 3300025923 | Ga0207681_10013312 | Ga0207681_100133125 | 219 |
| 288 | 3300025924 | Ga0207694_10036314 | Ga0207694_100363143 | 219 |
| 289 | 3300025925 | Ga0207650_10000015 | Ga0207650_10000015154 | 219 |
| 290 | 3300025925 | Ga0207650_10000243 | Ga0207650_1000024328 | 219 |
| 291 | 3300025927 | Ga0207687_10001736 | Ga0207687_1000173611 | 219 |
| 292 | 3300025929 | Ga0207664_10045186 | Ga0207664_100451866 | 219 |
| 293 | 3300025931 | Ga0207644_10000066 | Ga0207644_1000006643 | 219 |
| 294 | 3300025931 | Ga0207644_10013756 | Ga0207644_100137563 | 219 |
| 295 | 3300025932 | Ga0207690_10077557 | Ga0207690_100775574 | 219 |
| 296 | 3300025932 | Ga0207690_10099351 | Ga0207690_100993513 | 219 |
| 297 | 3300025933 | Ga0207706_10006922 | Ga0207706_100069224 | 219 |
| 298 | 3300025933 | Ga0207706_10018370 | Ga0207706_1001837012 | 219 |
| 299 | 3300025933 | Ga0207706_10030960 | Ga0207706_100309601 | 219 |
| 300 | 3300025934 | Ga0207686_10000260 | Ga0207686_1000026028 | 219 |
| 301 | 3300025935 | Ga0207709_10000156 | Ga0207709_1000015626 | 219 |
| 302 | 3300025935 | Ga0207709_10499993 | Ga0207709_104999932 | 219 |
| 303 | 3300025937 | Ga0207669_10037263 | Ga0207669_100372633 | 219 |
| 304 | 3300025938 | Ga0207704_10000017 | Ga0207704_1000001764 | 219 |
| 305 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004237 | 219 |
| 306 | 3300025941 | Ga0207711_10002409 | Ga0207711_100024093 | 219 |
| 307 | 3300025941 | Ga0207711_10008194 | Ga0207711_100081942 | 219 |
| 308 | 3300025949 | Ga0207667_10047029 | Ga0207667_100470294 | 219 |
| 309 | 3300025949 | Ga0207667_10119340 | Ga0207667_101193403 | 219 |
| 310 | 3300025949 | Ga0207667_10140301 | Ga0207667_101403013 | 219 |
| 311 | 3300025960 | Ga0207651_10000011 | Ga0207651_1000001166 | 219 |
| 312 | 3300025961 | Ga0207712_10000701 | Ga0207712_1000070119 | 219 |
| 313 | 3300025961 | Ga0207712_10068069 | Ga0207712_100680692 | 219 |
| 314 | 3300025972 | Ga0207668_10000012 | Ga0207668_1000001275 | 219 |
| 315 | 3300025981 | Ga0207640_10000067 | Ga0207640_1000006763 | 219 |
| 316 | 3300025981 | Ga0207640_10088966 | Ga0207640_100889662 | 219 |
| 317 | 3300025986 | Ga0207658_10000011 | Ga0207658_1000001176 | 219 |
| 318 | 3300025986 | Ga0207658_10001400 | Ga0207658_1000140018 | 219 |
| 319 | 3300025986 | Ga0207658_10004090 | Ga0207658_100040903 | 219 |
| 320 | 3300026023 | Ga0207677_10000173 | Ga0207677_1000017333 | 219 |
| 321 | 3300026035 | Ga0207703_10000538 | Ga0207703_1000053828 | 219 |
| 322 | 3300026041 | Ga0207639_10014604 | Ga0207639_100146045 | 219 |
| 323 | 3300026041 | Ga0207639_10151574 | Ga0207639_101515742 | 219 |
| 324 | 3300026041 | Ga0207639_10238419 | Ga0207639_102384192 | 219 |
| 325 | 3300026041 | Ga0207639_10257639 | Ga0207639_102576393 | 219 |
| 326 | 3300026067 | Ga0207678_10006666 | Ga0207678_100066669 | 219 |
| 327 | 3300026067 | Ga0207678_10433926 | Ga0207678_104339262 | 219 |
| 328 | 3300026075 | Ga0207708_10155182 | Ga0207708_101551823 | 219 |
| 329 | 3300026078 | Ga0207702_10000974 | Ga0207702_100009747 | 219 |
| 330 | 3300026078 | Ga0207702_10028743 | Ga0207702_100287433 | 219 |
| 331 | 3300026088 | Ga0207641_10000018 | Ga0207641_10000018117 | 219 |
| 332 | 3300026088 | Ga0207641_10000228 | Ga0207641_1000022831 | 219 |
| 333 | 3300026088 | Ga0207641_10051482 | Ga0207641_100514824 | 219 |
| 334 | 3300026089 | Ga0207648_10000045 | Ga0207648_1000004528 | 219 |
| 335 | 3300026095 | Ga0207676_10000021 | Ga0207676_10000021248 | 219 |
| 336 | 3300026095 | Ga0207676_10000027 | Ga0207676_1000002762 | 219 |
| 337 | 3300026095 | Ga0207676_10003587 | Ga0207676_100035878 | 219 |
| 338 | 3300026116 | Ga0207674_10066719 | Ga0207674_100667191 | 219 |
| 339 | 3300026118 | Ga0207675_100006708 | Ga0207675_10000670810 | 219 |
| 340 | 3300026142 | Ga0207698_10006861 | Ga0207698_100068616 | 219 |
| 341 | 3300026142 | Ga0207698_10037377 | Ga0207698_100373774 | 219 |
| 342 | 3300026142 | Ga0207698_10158495 | Ga0207698_101584953 | 219 |
| 343 | 3300026142 | Ga0207698_10268060 | Ga0207698_102680602 | 219 |
| 344 | 3300027876 | Ga0209974_10038274 | Ga0209974_100382742 | 219 |
| 345 | 3300028380 | Ga0268265_10000013 | Ga0268265_10000013220 | 219 |
| 346 | 3300028380 | Ga0268265_10000042 | Ga0268265_100000424 | 219 |
| 347 | 3300028380 | Ga0268265_10004259 | Ga0268265_100042598 | 219 |
| 348 | 3300028381 | Ga0268264_10000089 | Ga0268264_10000089174 | 219 |
| 349 | 3300031548 | Ga0307408_100033258 | Ga0307408_1000332584 | 219 |
| 350 | 3300031548 | Ga0307408_100060343 | Ga0307408_1000603433 | 219 |
| 351 | 3300031731 | Ga0307405_10062717 | Ga0307405_100627172 | 219 |
| 352 | 3300031824 | Ga0307413_10009976 | Ga0307413_100099765 | 219 |
| 353 | 3300031824 | Ga0307413_10058443 | Ga0307413_100584433 | 219 |
| 354 | 3300031824 | Ga0307413_10079455 | Ga0307413_100794554 | 219 |
| 355 | 3300031852 | Ga0307410_10093418 | Ga0307410_100934183 | 219 |
| 356 | 3300031901 | Ga0307406_10042156 | Ga0307406_100421563 | 219 |
| 357 | 3300031901 | Ga0307406_10143624 | Ga0307406_101436242 | 219 |
| 358 | 3300031903 | Ga0307407_10013484 | Ga0307407_100134846 | 219 |
| 359 | 3300031911 | Ga0307412_10161243 | Ga0307412_101612433 | 219 |
| 360 | 3300031995 | Ga0307409_100031534 | Ga0307409_1000315343 | 219 |
| 361 | 3300032002 | Ga0307416_100057036 | Ga0307416_1000570364 | 219 |
| 362 | 3300032002 | Ga0307416_100798298 | Ga0307416_1007982982 | 219 |
| 363 | 3300032004 | Ga0307414_10024901 | Ga0307414_100249013 | 219 |
| 364 | 3300032004 | Ga0307414_10126535 | Ga0307414_101265353 | 219 |
| 365 | 3300032004 | Ga0307414_10292389 | Ga0307414_102923892 | 219 |
| 366 | 3300032005 | Ga0307411_10243437 | Ga0307411_102434371 | 219 |
| 367 | 3300032005 | Ga0307411_10416309 | Ga0307411_104163092 | 219 |
| 368 | 3300032126 | Ga0307415_100106044 | Ga0307415_1001060443 | 219 |
| 369 | 3300032126 | Ga0307415_100158480 | Ga0307415_1001584803 | 219 |
| 370 | 3300035170 | Ga0373943_0263751 | Ga0373943_0263751_105_776 | 219 |
| 371 | 3300035695 | Ga0373927_0401446 | Ga0373927_0401446_130_801 | 219 |
| 372 | 3300037418 | Ga0395900_0127129 | Ga0395900_0127129_1452_2111 | 219 |
| 373 | 3300037418 | Ga0395900_0250373 | Ga0395900_0250373_1015_1674 | 219 |
| 374 | 3300037471 | Ga0395905_0061106 | Ga0395905_0061106_92_751 | 219 |
| 375 | 3300037471 | Ga0395905_0066681 | Ga0395905_0066681_1817_2476 | 219 |
| 376 | 3300037853 | Ga0436364_1451790 | Ga0436364_1451790_607_1269 | 219 |
| 377 | 3300038705 | Ga0237819_00574 | Ga0237819_00574_10185_10844 | 219 |
| 378 | 3300041458 | Ga0451798_1156044 | Ga0451798_1156044_584_1243 | 219 |
| 379 | 3300041462 | Ga0451806_238307 | Ga0451806_238307_729_1388 | 219 |
| 380 | 3300041486 | Ga0451807_1818061 | Ga0451807_1818061_1297_1956 | 219 |
| 381 | 3300042005 | Ga0439448_0005409 | Ga0439448_0005409_165_824 | 219 |
| 382 | 3300042005 | Ga0439448_0005846 | Ga0439448_0005846_1011_1670 | 219 |
| 383 | 3300042012 | Ga0439455_0000825 | Ga0439455_0000825_2331_2990 | 219 |
| 384 | 3300042012 | Ga0439455_0002152 | Ga0439455_0002152_1912_2571 | 219 |
| 385 | 3300042157 | Ga0439458_0004928 | Ga0439458_0004928_1286_1945 | 219 |
| 386 | 3300042157 | Ga0439458_0009578 | Ga0439458_0009578_430_1089 | 219 |
| 387 | 3300044659 | Ga0466973_0153270 | Ga0466973_0153270_724_1416 | 219 |
| 388 | 3300044735 | Ga0466968_0005545 | Ga0466968_0005545_2351_3013 | 219 |
| 389 | 3300045976 | Ga0466967_0028379 | Ga0466967_0028379_282_950 | 219 |
| 390 | 3300046460 | Ga0495638_0053645 | Ga0495638_0053645_844_1503 | 219 |
| 391 | 3300046506 | Ga0495583_0001045 | Ga0495583_0001045_28173_28832 | 219 |
| 392 | 3300046507 | Ga0495606_0001951 | Ga0495606_0001951_19236_19898 | 219 |
| 393 | 3300046519 | Ga0495632_0115290 | Ga0495632_0115290_158_823 | 219 |
| 394 | 3300046665 | Ga0495661_0096728 | Ga0495661_0096728_658_1317 | 219 |
| 395 | 3300046691 | Ga0495670_0150470 | Ga0495670_0150470_41_706 | 219 |
| 396 | 3300047321 | Ga0495676_0317671 | Ga0495676_0317671_352_1035 | 219 |
| 397 | 3300047469 | Ga0495673_0176176 | Ga0495673_0176176_29_694 | 219 |
| 398 | 3300047472 | Ga0495686_0000182 | Ga0495686_0000182_115459_116124 | 219 |
| 399 | 3300048088 | Ga0495602_0007292 | Ga0495602_0007292_9758_10426 | 219 |
| 400 | 3300048906 | Ga0496103_0030428 | Ga0496103_0030428_1054_1716 | 219 |
| 401 | 3300048906 | Ga0496103_0346101 | Ga0496103_0346101_149_808 | 219 |
| 402 | 3300048914 | Ga0496111_0233183 | Ga0496111_0233183_610_1269 | 219 |
| 403 | 3300048920 | Ga0496117_0004134 | Ga0496117_0004134_968_1630 | 219 |
| 404 | 3300048921 | Ga0496118_0011321 | Ga0496118_0011321_2815_3477 | 219 |
| 405 | 3300048921 | Ga0496118_0069894 | Ga0496118_0069894_1401_2060 | 219 |
| 406 | 3300048922 | Ga0496119_0045682 | Ga0496119_0045682_1356_2015 | 219 |
| 407 | 3300048925 | Ga0496122_0000579 | Ga0496122_0000579_52543_53202 | 219 |
| 408 | 3300048926 | Ga0496123_0001402 | Ga0496123_0001402_26690_27349 | 219 |
| 409 | 3300048927 | Ga0496124_0008457 | Ga0496124_0008457_9065_9724 | 219 |
| 410 | 3300048928 | Ga0496125_0004105 | Ga0496125_0004105_15419_16078 | 219 |
| 411 | 3300048928 | Ga0496125_0021250 | Ga0496125_0021250_3556_4242 | 219 |
| 412 | 3300048929 | Ga0496126_0139607 | Ga0496126_0139607_271_933 | 219 |
| 413 | 3300048929 | Ga0496126_0292433 | Ga0496126_0292433_94_759 | 219 |
| 414 | 3300048929 | Ga0496126_0628722 | Ga0496126_0628722_79_765 | 219 |
| 415 | 3300049579 | Ga0501043_0134872 | Ga0501043_0134872_324_989 | 219 |
| 416 | 3300049580 | Ga0501046_0408016 | Ga0501046_0408016_141_833 | 219 |
| 417 | 3300049581 | Ga0501047_0000644 | Ga0501047_0000644_21698_22390 | 219 |
| 418 | 3300049582 | Ga0501048_0210948 | Ga0501048_0210948_159_851 | 219 |
| 419 | 3300049679 | Ga0501249_000549 | Ga0501249_000549_231_908 | 219 |
| 420 | 3300049686 | Ga0501257_000029 | Ga0501257_000029_5700_6362 | 219 |
| 421 | 3300049776 | Ga0501280_003066 | Ga0501280_003066_1935_2597 | 219 |
| 422 | 3300049823 | Ga0501044_0116912 | Ga0501044_0116912_1139_1804 | 219 |
| 423 | 3300049823 | Ga0501044_0382053 | Ga0501044_0382053_456_1148 | 219 |
| 424 | 3300053087 | Ga0500643_000121 | Ga0500643_000121_72656_73318 | 219 |
| 425 | 3300053087 | Ga0500643_004524 | Ga0500643_004524_2574_3266 | 219 |
| 426 | 3300053093 | Ga0500651_0002188 | Ga0500651_0002188_1290_1961 | 219 |
| 427 | 3300053096 | Ga0500641_0012360 | Ga0500641_0012360_2117_2788 | 219 |
| 428 | 3300053103 | Ga0500555_000460 | Ga0500555_000460_1124_1783 | 219 |
| 429 | 3300053125 | Ga0500618_005557 | Ga0500618_005557_2494_3165 | 219 |
| 430 | 3300053130 | Ga0500642_0001441 | Ga0500642_0001441_5501_6172 | 219 |
| 431 | 3300053133 | Ga0500655_000061 | Ga0500655_000061_5183_5854 | 219 |
| 432 | 3300053156 | Ga0500622_0003437 | Ga0500622_0003437_5768_6439 | 219 |
| 433 | 3300053724 | Ga0500570_000268 | Ga0500570_000268_4439_5110 | 219 |
| 434 | 3300053730 | Ga0500645_008660 | Ga0500645_008660_2343_3014 | 219 |
| 435 | iso_pu_bacteria | 2582581305 | 2585263907 | 219 |
| 436 | iso_pu_bacteria | 2643221541 | 2643730696 | 219 |
| 437 | iso_pu_bacteria | 2643221606 | 2644044650 | 219 |
| 438 | iso_pu_bacteria | 2643221671 | 2644391425 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d6j-assembly1.cif.gz_A | crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis | 0.9251 | 1 | 210 |
| 3d6j-assembly1.cif.gz_A | crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis | 0.9167 | 1 | 210 |
| 2ah5-assembly1.cif.gz_A | hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae | 0.9082 | 2 | 213 |
| 3mc1-assembly1.cif.gz_A | crystal structure of a predicted phosphatase from clostridium acetobutylicum | 0.8963 | 1 | 217 |
| 2hdo-assembly1.cif.gz_A | crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution | 0.8922 | 1 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9396 | 88 | 200 | 3.40.50.1000 |
| 4ex7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.938 | 2 | 215 | 3.40.50.1000 |
| af_Q652P6_229_339_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9347 | 99 | 209 | 3.40.50.1000 |
| 3d6jA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9329 | 87 | 210 | 3.40.50.1000 |
| 3e58A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9252 | 88 | 213 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352GRB0-F1-model_v4 | Haloacid dehalogenase | 0.9854 | 27 | 217 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A6H2DRP8-F1-model_v4 | HAD-IA family hydrolase | 0.9842 | 1 | 215 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A2D6FWS7-F1-model_v4 | Haloacid dehalogenase | 0.984 | 2 | 217 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A2D7AB06-F1-model_v4 | Haloacid dehalogenase | 0.9828 | 1 | 215 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A0N0KA37-F1-model_v4 | Haloacid dehalogenase | 0.9823 | 2 | 217 |
GO:0005829
GO:0006281 GO:0008967 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar