F443984

General Info

Members Datasets Scaffolds Average Seq Length
438 241 876 217

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10244416|Ga0163163_102444162
Length 263
Sequence MNCPQLASDLGQCGAANMANRGDAALCSHPCGAIIAGCSLMPEFTLVIGDKNYSSWSLRPWMLMRHLRLEFREVQLRLDTPEFKDEVAQYGPSGRVPVLKHGDVTVWDSLSICEYVAEISGGGWPKDRAARAVARSICAEMHSGFTNLRMEWPMNARARNRHTLMTPGLEADIDRIDEIWMDCRRHFGASDGPWLFGEYTVADAMYAPVVLRFNTYRAQVSDTSRWYIATALEDAALQEWVRAAQEEPWTNEDENVGLVRQKD

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
232 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
233 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
236 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0
Rhizoplane 5.02
Rhizosphere 84.25
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10244416 3300014325 Unclassified 1845
2 JGI25406J46586_10010662 3300003203 Bacteria 4067
3 rootH1_10183835 3300003323 Bacteria 2698
4 JGI25405J52794_10031754 3300003911 Bacteria 1098
5 Ga0058863_11600313 3300004799 Bacteria 784
6 Ga0058861_12026667 3300004800 Bacteria 818
7 Ga0065707_10083134 3300005295 Bacteria 10277
8 Ga0070683_100030228 3300005329 Bacteria 4913
9 Ga0070683_100097403 3300005329 Bacteria 2767
10 Ga0070690_100014425 3300005330 Bacteria 4689
11 Ga0070690_100019068 3300005330 Bacteria 4156
12 Ga0070677_10029608 3300005333 Bacteria 2077
13 Ga0068869_100208458 3300005334 Bacteria 1544
14 Ga0068869_100341338 3300005334 Bacteria 1219
15 Ga0070680_100002053 3300005336 Bacteria 14852
16 Ga0070680_100004832 3300005336 Bacteria 10144
17 Ga0070680_100043709 3300005336 Bacteria 3639
18 Ga0070682_100331952 3300005337 Bacteria 1127
19 Ga0070675_100023308 3300005354 Bacteria 4948
20 Ga0070675_100082036 3300005354 Bacteria 2690
21 Ga0070671_100006515 3300005355 Bacteria 9333
22 Ga0070674_100222753 3300005356 Bacteria 1468
23 Ga0070674_100662639 3300005356 Bacteria 888
24 Ga0070673_100057041 3300005364 Bacteria 3085
25 Ga0070673_100104459 3300005364 Bacteria 2339
26 Ga0070667_100000395 3300005367 Bacteria 47219
27 Ga0070667_100005556 3300005367 Bacteria 10521
28 Ga0070667_100069434 3300005367 Bacteria 2998
29 Ga0070709_10012878 3300005434 Bacteria 4687
30 Ga0070709_10014157 3300005434 Bacteria 4505
31 Ga0070709_10275101 3300005434 Bacteria 1221
32 Ga0070714_100006033 3300005435 Bacteria 9302
33 Ga0070713_100006106 3300005436 Bacteria 8309
34 Ga0070713_100059934 3300005436 Bacteria 3181
35 Ga0070713_100160664 3300005436 Bacteria 2005
36 Ga0070710_10011970 3300005437 Bacteria 4299
37 Ga0070710_10133763 3300005437 Bacteria 1514
38 Ga0070710_10165274 3300005437 Bacteria 1375
39 Ga0070701_10100097 3300005438 Bacteria 1604
40 Ga0070711_100015495 3300005439 Bacteria 4827
41 Ga0070711_100119064 3300005439 Bacteria 1950
42 Ga0070711_100138804 3300005439 Bacteria 1820
43 Ga0070705_100005687 3300005440 Bacteria 6091
44 Ga0070705_100014827 3300005440 Bacteria 4019
45 Ga0070700_100034174 3300005441 Bacteria 3069
46 Ga0070694_100062252 3300005444 Bacteria 2549
47 Ga0070694_100098860 3300005444 Bacteria 2061
48 Ga0070678_100001136 3300005456 Bacteria 14048
49 Ga0070681_10002694 3300005458 Bacteria 16335
50 Ga0070681_10002897 3300005458 Bacteria 15863
51 Ga0070681_10011856 3300005458 Bacteria 8642
52 Ga0070681_10021550 3300005458 Bacteria 6459
53 Ga0070681_10029764 3300005458 Bacteria 5482
54 Ga0070681_10032836 3300005458 Bacteria 5211
55 Ga0070681_10079390 3300005458 Bacteria 3238
56 Ga0068867_100092933 3300005459 Bacteria 2292
57 Ga0070685_10110216 3300005466 Bacteria 1694
58 Ga0070706_100683820 3300005467 Bacteria 952
59 Ga0070679_100004061 3300005530 Bacteria 13485
60 Ga0070679_100024463 3300005530 Bacteria 5917
61 Ga0070679_100066125 3300005530 Bacteria 3603
62 Ga0070679_100158451 3300005530 Bacteria 2238
63 Ga0070679_100420349 3300005530 Bacteria 1282
64 Ga0070679_100449570 3300005530 Bacteria 1233
65 Ga0070684_100243066 3300005535 Bacteria 1645
66 Ga0070684_100448550 3300005535 Bacteria 1192
67 Ga0070684_100545093 3300005535 Bacteria 1076
68 Ga0070697_100794597 3300005536 Bacteria 837
69 Ga0070672_100108703 3300005543 Bacteria 2258
70 Ga0070686_100038916 3300005544 Bacteria 2960
71 Ga0070686_100133778 3300005544 Bacteria 1718
72 Ga0070695_100209121 3300005545 Bacteria 1399
73 Ga0070696_100265671 3300005546 Bacteria 1303
74 Ga0070665_100005098 3300005548 Bacteria 13627
75 Ga0070665_100080677 3300005548 Bacteria 3259
76 Ga0068855_100001126 3300005563 Bacteria 33184
77 Ga0068855_100008548 3300005563 Bacteria 12374
78 Ga0068855_100084644 3300005563 Bacteria 3671
79 Ga0068855_100201256 3300005563 Bacteria 2242
80 Ga0068855_100291641 3300005563 Bacteria 1808
81 Ga0070664_100119356 3300005564 Bacteria 2308
82 Ga0068857_100132936 3300005577 Bacteria 2245
83 Ga0068854_100173977 3300005578 Bacteria 1677
84 Ga0068856_100073409 3300005614 Bacteria 3388
85 Ga0068856_100151114 3300005614 Bacteria 2331
86 Ga0070702_100004717 3300005615 Bacteria 6258
87 Ga0070702_100486299 3300005615 Bacteria 903
88 Ga0068859_100000351 3300005617 Bacteria 45794
89 Ga0068859_100004602 3300005617 Bacteria 14073
90 Ga0068859_100049396 3300005617 Bacteria 4225
91 Ga0068859_100059364 3300005617 Bacteria 3854
92 Ga0068864_100025680 3300005618 Bacteria 4964
93 Ga0068861_100004886 3300005719 Bacteria 9022
94 Ga0068861_100047061 3300005719 Bacteria 3255
95 Ga0068861_100414039 3300005719 Bacteria 1199
96 Ga0068861_100645454 3300005719 Bacteria 977
97 Ga0068851_10043790 3300005834 Bacteria 2257
98 Ga0068863_100001670 3300005841 Bacteria 21939
99 Ga0068863_100012408 3300005841 Bacteria 8228
100 Ga0068863_100025514 3300005841 Bacteria 5635
101 Ga0068858_100007217 3300005842 Bacteria 10773
102 Ga0068858_100010999 3300005842 Bacteria 8553
103 Ga0068858_100013724 3300005842 Bacteria 7647
104 Ga0068858_100152010 3300005842 Bacteria 2177
105 Ga0068860_100087753 3300005843 Bacteria 2961
106 Ga0068862_100011634 3300005844 Bacteria 7260
107 Ga0068862_100035031 3300005844 Bacteria 4249
108 Ga0068862_100082577 3300005844 Bacteria 2789
109 Ga0068862_100250736 3300005844 Bacteria 1613
110 Ga0081455_10000039 3300005937 Bacteria 135506
111 Ga0081455_10004020 3300005937 Bacteria 16678
112 Ga0081455_10213174 3300005937 Bacteria 1437
113 Ga0081455_10282570 3300005937 Unclassified 1198
114 Ga0081455_10380275 3300005937 Bacteria 986
115 Ga0081539_10000006 3300005985 Bacteria 534555
116 Ga0070717_10005855 3300006028 Bacteria 9005
117 Ga0070717_10440617 3300006028 Bacteria 1173
118 Ga0070715_10000168 3300006163 Bacteria 15210
119 Ga0070716_100008972 3300006173 Bacteria 4973
120 Ga0070716_100019176 3300006173 Bacteria 3572
121 Ga0070712_100001910 3300006175 Bacteria 12744
122 Ga0097621_100016769 3300006237 Bacteria 5548
123 Ga0097621_100164943 3300006237 Bacteria 1907
124 Ga0097621_100188767 3300006237 Bacteria 1784
125 Ga0097621_100500778 3300006237 Bacteria 1100
126 Ga0075429_100003238 3300006880 Bacteria 13853
127 Ga0075436_100052226 3300006914 Bacteria 2821
128 Ga0097620_100000351 3300006931 Bacteria 45794
129 Ga0097620_100004602 3300006931 Bacteria 14073
130 Ga0097620_100049396 3300006931 Bacteria 4225
131 Ga0097620_100059366 3300006931 Bacteria 3854
132 Ga0075435_100024098 3300007076 Bacteria 4717
133 Ga0099794_10036637 3300007265 Bacteria 2320
134 Ga0099795_10033749 3300007788 Bacteria 1779
135 Ga0105250_10046438 3300009092 Bacteria 1741
136 Ga0105240_10000995 3300009093 Bacteria 50634
137 Ga0105240_10009806 3300009093 Bacteria 13518
138 Ga0105240_10014312 3300009093 Bacteria 10834
139 Ga0105240_10030890 3300009093 Bacteria 6958
140 Ga0105240_10130817 3300009093 Bacteria 3011
141 Ga0105240_10183520 3300009093 Bacteria 2467
142 Ga0105240_10361717 3300009093 Bacteria 1643
143 Ga0105240_10434790 3300009093 Bacteria 1472
144 Ga0105247_10001687 3300009101 Bacteria 15585
145 Ga0105247_10004246 3300009101 Bacteria 9187
146 Ga0105247_10005437 3300009101 Bacteria 8023
147 Ga0105247_10007631 3300009101 Bacteria 6624
148 Ga0105241_10006624 3300009174 Bacteria 8537
149 Ga0105241_10356042 3300009174 Bacteria 1272
150 Ga0105241_10532850 3300009174 Bacteria 1052
151 Ga0105241_10807632 3300009174 Bacteria 865
152 Ga0105242_10000384 3300009176 Bacteria 35144
153 Ga0105248_10021309 3300009177 Bacteria 7183
154 Ga0105248_10238334 3300009177 Bacteria 2048
155 Ga0105237_10027347 3300009545 Bacteria 5823
156 Ga0105237_10235637 3300009545 Bacteria 1831
157 Ga0105237_10379141 3300009545 Bacteria 1419
158 Ga0105237_10564122 3300009545 Bacteria 1145
159 Ga0105238_10011421 3300009551 Bacteria 8945
160 Ga0105238_10057095 3300009551 Bacteria 3915
161 Ga0105238_10187199 3300009551 Bacteria 2046
162 Ga0105238_10551565 3300009551 Bacteria 1157
163 Ga0105249_10078893 3300009553 Bacteria 3056
164 Ga0105249_10083240 3300009553 Bacteria 2978
165 Ga0105249_10097139 3300009553 Bacteria 2765
166 Ga0105249_10261799 3300009553 Bacteria 1719
167 Ga0099796_10000823 3300010159 Bacteria 5653
168 Ga0105239_10016409 3300010375 Bacteria 8190
169 Ga0105239_10096460 3300010375 Bacteria 3267
170 Ga0105239_10360260 3300010375 Bacteria 1642
171 Ga0105239_10375860 3300010375 Bacteria 1606
172 Ga0105246_10035157 3300011119 Bacteria 3347
173 Ga0157370_10005646 3300013104 Bacteria 13990
174 Ga0157370_10519753 3300013104 Bacteria 1093
175 Ga0157369_10004805 3300013105 Bacteria 15873
176 Ga0157369_10019590 3300013105 Bacteria 7571
177 Ga0157369_10083831 3300013105 Bacteria 3408
178 Ga0157369_10113410 3300013105 Bacteria 2880
179 Ga0157378_10002033 3300013297 Bacteria 18118
180 Ga0163162_10047117 3300013306 Bacteria 4321
181 Ga0163162_10136246 3300013306 Bacteria 2566
182 Ga0163162_10260780 3300013306 Bacteria 1865
183 Ga0157372_10203192 3300013307 Bacteria 2295
184 Ga0157372_10755165 3300013307 Bacteria 1131
185 Ga0157372_11033706 3300013307 Bacteria 951
186 Ga0163163_10016703 3300014325 Bacteria 6826
187 Ga0163163_10067808 3300014325 Bacteria 3549
188 Ga0163163_10418523 3300014325 Bacteria 1399
189 Ga0163163_10790491 3300014325 Bacteria 1012
190 Ga0157380_10116983 3300014326 Bacteria 2251
191 Ga0157379_10041819 3300014968 Bacteria 4091
192 Ga0157379_10050280 3300014968 Bacteria 3721
193 Ga0157379_10098563 3300014968 Bacteria 2624
194 Ga0157379_10106796 3300014968 Bacteria 2513
195 Ga0157379_10136773 3300014968 Bacteria 2208
196 Ga0157379_10267238 3300014968 Bacteria 1555
197 Ga0206356_10628785 3300020070 Bacteria 1290
198 Ga0206353_11217795 3300020082 Bacteria 1563
199 Ga0213871_10022316 3300021441 Bacteria 1586
200 Ga0207696_1052277 3300025711 Bacteria 1165
201 Ga0207682_10008779 3300025893 Bacteria 3997
202 Ga0207692_10047622 3300025898 Bacteria 2153
203 Ga0207692_10127907 3300025898 Bacteria 1431
204 Ga0207642_10057982 3300025899 Bacteria 1784
205 Ga0207710_10000181 3300025900 Bacteria 63816
206 Ga0207710_10152271 3300025900 Bacteria 1122
207 Ga0207680_10009065 3300025903 Bacteria 4918
208 Ga0207680_10035796 3300025903 Bacteria 2854
209 Ga0207680_10279166 3300025903 Bacteria 1160
210 Ga0207647_10037693 3300025904 Bacteria 3063
211 Ga0207685_10027089 3300025905 Bacteria 2001
212 Ga0207699_10003768 3300025906 Bacteria 7239
213 Ga0207699_10036788 3300025906 Bacteria 2793
214 Ga0207684_10577556 3300025910 Bacteria 961
215 Ga0207707_10003382 3300025912 Bacteria 14157
216 Ga0207707_10003871 3300025912 Bacteria 13279
217 Ga0207707_10018215 3300025912 Bacteria 6121
218 Ga0207707_10041614 3300025912 Bacteria 4011
219 Ga0207707_10046009 3300025912 Bacteria 3800
220 Ga0207695_10011497 3300025913 Bacteria 10714
221 Ga0207695_10020399 3300025913 Bacteria 7593
222 Ga0207695_10027837 3300025913 Bacteria 6284
223 Ga0207695_10035795 3300025913 Bacteria 5377
224 Ga0207695_10115655 3300025913 Bacteria 2656
225 Ga0207695_10137560 3300025913 Bacteria 2394
226 Ga0207695_10485653 3300025913 Bacteria 1117
227 Ga0207671_10202264 3300025914 Bacteria 1551
228 Ga0207671_10322301 3300025914 Bacteria 1223
229 Ga0207693_10000385 3300025915 Bacteria 40463
230 Ga0207693_10088825 3300025915 Bacteria 2422
231 Ga0207663_10065854 3300025916 Bacteria 2317
232 Ga0207663_10088280 3300025916 Bacteria 2050
233 Ga0207660_10027312 3300025917 Bacteria 3893
234 Ga0207660_10223355 3300025917 Bacteria 1479
235 Ga0207652_10025697 3300025921 Bacteria 4898
236 Ga0207652_10071294 3300025921 Bacteria 3019
237 Ga0207652_10131166 3300025921 Bacteria 2235
238 Ga0207652_10353647 3300025921 Bacteria 1326
239 Ga0207694_10121097 3300025924 Bacteria 2089
240 Ga0207659_10074627 3300025926 Bacteria 2486
241 Ga0207700_10000880 3300025928 Bacteria 17286
242 Ga0207700_10042352 3300025928 Bacteria 3338
243 Ga0207700_10053375 3300025928 Bacteria 3028
244 Ga0207700_10251506 3300025928 Bacteria 1510
245 Ga0207664_10009097 3300025929 Bacteria 6957
246 Ga0207664_10101118 3300025929 Bacteria 2381
247 Ga0207644_10004210 3300025931 Bacteria 9338
248 Ga0207644_10011875 3300025931 Bacteria 5772
249 Ga0207704_10454166 3300025938 Bacteria 1023
250 Ga0207665_10004787 3300025939 Bacteria 9009
251 Ga0207691_10063927 3300025940 Bacteria 3335
252 Ga0207711_10073298 3300025941 Bacteria 2976
253 Ga0207679_10103026 3300025945 Bacteria 2236
254 Ga0207667_10008172 3300025949 Bacteria 12451
255 Ga0207667_10039990 3300025949 Bacteria 4993
256 Ga0207667_10104441 3300025949 Bacteria 2922
257 Ga0207667_10360615 3300025949 Bacteria 1482
258 Ga0207712_10046187 3300025961 Bacteria 3018
259 Ga0207712_10064079 3300025961 Bacteria 2619
260 Ga0207712_10176320 3300025961 Bacteria 1675
261 Ga0207658_10000097 3300025986 Bacteria 97223
262 Ga0207658_10014533 3300025986 Bacteria 5390
263 Ga0207677_10324647 3300026023 Bacteria 1280
264 Ga0207703_10001369 3300026035 Bacteria 22262
265 Ga0207703_10002198 3300026035 Bacteria 17122
266 Ga0207703_10059638 3300026035 Bacteria 3117
267 Ga0207678_10065682 3300026067 Bacteria 3115
268 Ga0207708_10090591 3300026075 Bacteria 2357
269 Ga0207702_10065463 3300026078 Bacteria 3113
270 Ga0207702_10098494 3300026078 Bacteria 2576
271 Ga0207702_10246877 3300026078 Bacteria 1675
272 Ga0207641_10020132 3300026088 Bacteria 5477
273 Ga0207641_10023505 3300026088 Bacteria 5077
274 Ga0207648_10089910 3300026089 Bacteria 2683
275 Ga0207674_10285102 3300026116 Bacteria 1600
276 Ga0207675_100006119 3300026118 Bacteria 11437
277 Ga0207675_100066684 3300026118 Bacteria 3364
278 Ga0207675_100400566 3300026118 Bacteria 1352
279 Ga0207675_101184308 3300026118 Bacteria 784
280 Ga0207683_10005289 3300026121 Bacteria 11074
281 Ga0207683_10008991 3300026121 Bacteria 8512
282 Ga0209588_1027573 3300027671 Bacteria 1808
283 Ga0268266_10009454 3300028379 Bacteria 8579
284 Ga0268266_10092652 3300028379 Bacteria 2651
285 Ga0268266_10133342 3300028379 Bacteria 2223
286 Ga0268266_10146123 3300028379 Bacteria 2126
287 Ga0268265_10004387 3300028380 Bacteria 9802
288 Ga0268265_10279457 3300028380 Bacteria 1493
289 Ga0268264_10000293 3300028381 Bacteria 83870
290 Ga0268264_10014111 3300028381 Bacteria 6569
291 Ga0268264_10042236 3300028381 Bacteria 3774
292 Ga0265334_10033985 3300028573 Bacteria 2025
293 Ga0307511_10000310 3300030521 Bacteria 51837
294 Ga0307511_10063063 3300030521 Bacteria 2805
295 Ga0265340_10113609 3300031247 Bacteria 1250
296 Ga0265331_10002531 3300031250 Bacteria 12310
297 Ga0307513_10053116 3300031456 Bacteria 4358
298 Ga0307513_10427076 3300031456 Bacteria 1054
299 Ga0307509_10000017 3300031507 Bacteria 265012
300 Ga0307509_10201750 3300031507 Bacteria 1825
301 Ga0307509_10219013 3300031507 Bacteria 1719
302 Ga0307408_100010680 3300031548 Bacteria 6056
303 Ga0307408_100691332 3300031548 Bacteria 916
304 Ga0307508_10054893 3300031616 Bacteria 3530
305 Ga0307508_10372499 3300031616 Bacteria 1019
306 Ga0307405_10196302 3300031731 Bacteria 1462
307 Ga0307413_10007569 3300031824 Bacteria 5055
308 Ga0307413_10011987 3300031824 Bacteria 4293
309 Ga0307413_10231641 3300031824 Bacteria 1357
310 Ga0307410_10009939 3300031852 Bacteria 5365
311 Ga0307410_10308663 3300031852 Bacteria 1251
312 Ga0307406_10013918 3300031901 Bacteria 4619
313 Ga0307407_10001931 3300031903 Bacteria 7851
314 Ga0307407_10012927 3300031903 Bacteria 4033
315 Ga0307412_10083698 3300031911 Bacteria 2213
316 Ga0307409_100000521 3300031995 Bacteria 16624
317 Ga0307411_10001502 3300032005 Bacteria 9600
318 Ga0316585_10107431 3300032137 Bacteria 917
319 Ga0373923_0074101 3300035111 Bacteria 1467
320 Ga0373923_0143278 3300035111 Bacteria 1081
321 Ga0373936_0008005 3300035113 Bacteria 3972
322 Ga0373936_0057091 3300035113 Bacteria 1587
323 Ga0373939_0235025 3300035114 Bacteria 707
324 Ga0373954_0328952 3300035118 Bacteria 754
325 Ga0373943_0055157 3300035170 Bacteria 1968
326 Ga0373955_0283200 3300035172 Bacteria 997
327 Ga0373927_0006569 3300035695 Bacteria 7921
328 Ga0373933_0082018 3300035724 Bacteria 1979
329 Ga0373947_0125368 3300035725 Bacteria 1635
330 Ga0373937_0141835 3300036401 Bacteria 2248
331 Ga0373937_0210970 3300036401 Bacteria 1827
332 Ga0316582_0215043 3300036647 Bacteria 1314
333 Ga0373925_0813120 3300037068 Bacteria 770
334 Ga0395898_0001671 3300037466 Bacteria 29733
335 Ga0395898_0031186 3300037466 Bacteria 5329
336 Ga0436365_1056628 3300039437 Bacteria 778
337 Ga0436365_1537890 3300039437 Bacteria 994
338 Ga0436360_0081891 3300039438 Bacteria 6948
339 Ga0436361_0305851 3300039447 Bacteria 4697
340 Ga0436363_0920383 3300039450 Bacteria 1057
341 Ga0436363_1711783 3300039450 Bacteria 2552
342 Ga0436362_0091593 3300039453 Bacteria 1568
343 Ga0451800_1035928 3300041459 Bacteria 805
344 Ga0451804_0099064 3300041463 Bacteria 975
345 Ga0451833_0332336 3300041491 Bacteria 2143
346 Ga0451853_2577382 3300041512 Bacteria 1070
347 Ga0466972_0038245 3300044658 Bacteria 2344
348 Ga0466972_0103582 3300044658 Bacteria 1346
349 Ga0466966_0000115 3300044684 Bacteria 49898
350 Ga0466961_0000137 3300044693 Bacteria 49031
351 Ga0466964_0000061 3300044706 Bacteria 23354
352 Ga0466971_0000102 3300044719 Bacteria 31582
353 Ga0466970_0000553 3300044765 Bacteria 18250
354 Ga0466957_0006358 3300044842 Bacteria 6666
355 Ga0466960_0034441 3300044901 Bacteria 2360
356 Ga0466960_0181648 3300044901 Bacteria 1141
357 Ga0466959_0002823 3300045049 Bacteria 11188
358 Ga0466959_0029335 3300045049 Bacteria 4076
359 Ga0466959_0137313 3300045049 Bacteria 1730
360 Ga0466958_0014377 3300045836 Bacteria 4521
361 Ga0466958_0033075 3300045836 Bacteria 3080
362 Ga0495590_0071557 3300046457 Bacteria 1217
363 Ga0495580_0004499 3300046472 Bacteria 11707
364 Ga0495580_0179696 3300046472 Bacteria 1461
365 Ga0495583_0308267 3300046506 Unclassified 628
366 Ga0495616_0324673 3300046513 Bacteria 645
367 Ga0495618_0140494 3300046514 Bacteria 1545
368 Ga0495628_0177605 3300046516 Bacteria 1612
369 Ga0495632_0064747 3300046519 Unclassified 1767
370 Ga0495643_0154857 3300046522 Bacteria 1132
371 Ga0495652_0551186 3300046529 Bacteria 793
372 Ga0495587_0109672 3300046536 Bacteria 1586
373 Ga0495622_0198281 3300046557 Bacteria 895
374 Ga0495668_0040324 3300046616 Bacteria 2604
375 Ga0495625_0105748 3300046660 Bacteria 1927
376 Ga0495625_0150280 3300046660 Bacteria 1566
377 Ga0495604_0269169 3300047317 Bacteria 1155
378 Ga0495674_0388709 3300047319 Bacteria 1128
379 Ga0495687_049827 3300047443 Bacteria 1788
380 Ga0495602_0066282 3300048088 Bacteria 3112
381 Ga0496100_0035967 3300048903 Bacteria 3119
382 Ga0496101_0002467 3300048904 Bacteria 11361
383 Ga0496102_0045260 3300048905 Bacteria 3996
384 Ga0496102_0185950 3300048905 Bacteria 1958
385 Ga0496103_0036380 3300048906 Bacteria 3015
386 Ga0496103_0130264 3300048906 Bacteria 1606
387 Ga0496103_0182310 3300048906 Bacteria 1349
388 Ga0496104_0023890 3300048907 Bacteria 5623
389 Ga0496104_0041137 3300048907 Bacteria 4332
390 Ga0496105_0040100 3300048908 Bacteria 3860
391 Ga0496106_0016736 3300048909 Bacteria 5425
392 Ga0496107_0097031 3300048910 Bacteria 2157
393 Ga0496107_0285571 3300048910 Bacteria 1228
394 Ga0496108_0004651 3300048911 Bacteria 11067
395 Ga0496109_0012647 3300048912 Bacteria 7290
396 Ga0496110_0016238 3300048913 Bacteria 6211
397 Ga0496111_0001145 3300048914 Bacteria 14715
398 Ga0496112_0009020 3300048915 Bacteria 8956
399 Ga0496112_0206218 3300048915 Bacteria 1924
400 Ga0496115_0043041 3300048918 Bacteria 3599
401 Ga0496118_0031399 3300048921 Bacteria 4404
402 Ga0496121_0005697 3300048924 Bacteria 15831
403 Ga0496125_0000690 3300048928 Bacteria 55954
404 Ga0496125_0011719 3300048928 Bacteria 8743
405 Ga0496126_0006629 3300048929 Bacteria 12889
406 Ga0496126_0027107 3300048929 Bacteria 5480
407 Ga0496126_0361599 3300048929 Bacteria 1185
408 Ga0496126_0428324 3300048929 Bacteria 1068
409 Ga0501042_0004594 3300049578 Bacteria 8813
410 Ga0501047_0158357 3300049581 Bacteria 2137
411 nmdc:mga09592_15456_c1 3300050508 Bacteria 6237
412 nmdc:mga0rr50_22490_c1 3300050513 Bacteria 4328
413 nmdc:mga08x19_44251_c1 3300050514 Bacteria 2842
414 nmdc:mga08x19_705801_c1 3300050514 Bacteria 716
415 Ga0500635_0012387 3300053080 Bacteria 2448
416 Ga0500644_0005519 3300053088 Bacteria 3198
417 Ga0500583_0040054 3300053092 Bacteria 2121
418 Ga0500583_0059759 3300053092 Bacteria 1796
419 Ga0500583_0097632 3300053092 Bacteria 1435
420 Ga0500583_0277741 3300053092 Bacteria 823
421 Ga0500566_0004911 3300053094 Bacteria 7966
422 Ga0500556_0000806 3300053104 Bacteria 18285
423 Ga0500569_005380 3300053109 Bacteria 2749
424 Ga0500591_022334 3300053115 Bacteria 3072
425 Ga0500595_045587 3300053119 Bacteria 1384
426 Ga0500597_052204 3300053120 Bacteria 1744
427 Ga0500614_002641 3300053123 Bacteria 3970
428 Ga0500564_082176 3300053138 Bacteria 1443
429 Ga0500568_0097769 3300053139 Bacteria 1103
430 Ga0500585_044344 3300053144 Bacteria 1577
431 Ga0500603_001758 3300053150 Bacteria 4870
432 Ga0500603_022144 3300053150 Bacteria 1571
433 Ga0500616_0000064 3300053153 Bacteria 243072
434 Ga0500616_0007166 3300053153 Bacteria 7131
435 Ga0500622_0079128 3300053156 Bacteria 1648
436 Ga0500624_024458 3300053157 Bacteria 998
437 Ga0500637_0279399 3300053178 Bacteria 920
438 Ga0466962_0000766 3300061719 Bacteria 14407
439 Ga0163163_10244416
440 JGI25406J46586_10010662
441 rootH1_10183835
442 JGI25405J52794_10031754
443 Ga0058863_11600313
444 Ga0058861_12026667
445 Ga0065707_10083134
446 Ga0070683_100030228
447 Ga0070683_100097403
448 Ga0070690_100014425
449 Ga0070690_100019068
450 Ga0070677_10029608
451 Ga0068869_100208458
452 Ga0068869_100341338
453 Ga0070680_100002053
454 Ga0070680_100004832
455 Ga0070680_100043709
456 Ga0070682_100331952
457 Ga0070675_100023308
458 Ga0070675_100082036
459 Ga0070671_100006515
460 Ga0070674_100222753
461 Ga0070674_100662639
462 Ga0070673_100057041
463 Ga0070673_100104459
464 Ga0070667_100000395
465 Ga0070667_100005556
466 Ga0070667_100069434
467 Ga0070709_10012878
468 Ga0070709_10014157
469 Ga0070709_10275101
470 Ga0070714_100006033
471 Ga0070713_100006106
472 Ga0070713_100059934
473 Ga0070713_100160664
474 Ga0070710_10011970
475 Ga0070710_10133763
476 Ga0070710_10165274
477 Ga0070701_10100097
478 Ga0070711_100015495
479 Ga0070711_100119064
480 Ga0070711_100138804
481 Ga0070705_100005687
482 Ga0070705_100014827
483 Ga0070700_100034174
484 Ga0070694_100062252
485 Ga0070694_100098860
486 Ga0070678_100001136
487 Ga0070681_10002694
488 Ga0070681_10002897
489 Ga0070681_10011856
490 Ga0070681_10021550
491 Ga0070681_10029764
492 Ga0070681_10032836
493 Ga0070681_10079390
494 Ga0068867_100092933
495 Ga0070685_10110216
496 Ga0070706_100683820
497 Ga0070679_100004061
498 Ga0070679_100024463
499 Ga0070679_100066125
500 Ga0070679_100158451
501 Ga0070679_100420349
502 Ga0070679_100449570
503 Ga0070684_100243066
504 Ga0070684_100448550
505 Ga0070684_100545093
506 Ga0070697_100794597
507 Ga0070672_100108703
508 Ga0070686_100038916
509 Ga0070686_100133778
510 Ga0070695_100209121
511 Ga0070696_100265671
512 Ga0070665_100005098
513 Ga0070665_100080677
514 Ga0068855_100001126
515 Ga0068855_100008548
516 Ga0068855_100084644
517 Ga0068855_100201256
518 Ga0068855_100291641
519 Ga0070664_100119356
520 Ga0068857_100132936
521 Ga0068854_100173977
522 Ga0068856_100073409
523 Ga0068856_100151114
524 Ga0070702_100004717
525 Ga0070702_100486299
526 Ga0068859_100000351
527 Ga0068859_100004602
528 Ga0068859_100049396
529 Ga0068859_100059364
530 Ga0068864_100025680
531 Ga0068861_100004886
532 Ga0068861_100047061
533 Ga0068861_100414039
534 Ga0068861_100645454
535 Ga0068851_10043790
536 Ga0068863_100001670
537 Ga0068863_100012408
538 Ga0068863_100025514
539 Ga0068858_100007217
540 Ga0068858_100010999
541 Ga0068858_100013724
542 Ga0068858_100152010
543 Ga0068860_100087753
544 Ga0068862_100011634
545 Ga0068862_100035031
546 Ga0068862_100082577
547 Ga0068862_100250736
548 Ga0081455_10000039
549 Ga0081455_10004020
550 Ga0081455_10213174
551 Ga0081455_10282570
552 Ga0081455_10380275
553 Ga0081539_10000006
554 Ga0070717_10005855
555 Ga0070717_10440617
556 Ga0070715_10000168
557 Ga0070716_100008972
558 Ga0070716_100019176
559 Ga0070712_100001910
560 Ga0097621_100016769
561 Ga0097621_100164943
562 Ga0097621_100188767
563 Ga0097621_100500778
564 Ga0075429_100003238
565 Ga0075436_100052226
566 Ga0097620_100000351
567 Ga0097620_100004602
568 Ga0097620_100049396
569 Ga0097620_100059366
570 Ga0075435_100024098
571 Ga0099794_10036637
572 Ga0099795_10033749
573 Ga0105250_10046438
574 Ga0105240_10000995
575 Ga0105240_10009806
576 Ga0105240_10014312
577 Ga0105240_10030890
578 Ga0105240_10130817
579 Ga0105240_10183520
580 Ga0105240_10361717
581 Ga0105240_10434790
582 Ga0105247_10001687
583 Ga0105247_10004246
584 Ga0105247_10005437
585 Ga0105247_10007631
586 Ga0105241_10006624
587 Ga0105241_10356042
588 Ga0105241_10532850
589 Ga0105241_10807632
590 Ga0105242_10000384
591 Ga0105248_10021309
592 Ga0105248_10238334
593 Ga0105237_10027347
594 Ga0105237_10235637
595 Ga0105237_10379141
596 Ga0105237_10564122
597 Ga0105238_10011421
598 Ga0105238_10057095
599 Ga0105238_10187199
600 Ga0105238_10551565
601 Ga0105249_10078893
602 Ga0105249_10083240
603 Ga0105249_10097139
604 Ga0105249_10261799
605 Ga0099796_10000823
606 Ga0105239_10016409
607 Ga0105239_10096460
608 Ga0105239_10360260
609 Ga0105239_10375860
610 Ga0105246_10035157
611 Ga0157370_10005646
612 Ga0157370_10519753
613 Ga0157369_10004805
614 Ga0157369_10019590
615 Ga0157369_10083831
616 Ga0157369_10113410
617 Ga0157378_10002033
618 Ga0163162_10047117
619 Ga0163162_10136246
620 Ga0163162_10260780
621 Ga0157372_10203192
622 Ga0157372_10755165
623 Ga0157372_11033706
624 Ga0163163_10016703
625 Ga0163163_10067808
626 Ga0163163_10418523
627 Ga0163163_10790491
628 Ga0157380_10116983
629 Ga0157379_10041819
630 Ga0157379_10050280
631 Ga0157379_10098563
632 Ga0157379_10106796
633 Ga0157379_10136773
634 Ga0157379_10267238
635 Ga0206356_10628785
636 Ga0206353_11217795
637 Ga0213871_10022316
638 Ga0207696_1052277
639 Ga0207682_10008779
640 Ga0207692_10047622
641 Ga0207692_10127907
642 Ga0207642_10057982
643 Ga0207710_10000181
644 Ga0207710_10152271
645 Ga0207680_10009065
646 Ga0207680_10035796
647 Ga0207680_10279166
648 Ga0207647_10037693
649 Ga0207685_10027089
650 Ga0207699_10003768
651 Ga0207699_10036788
652 Ga0207684_10577556
653 Ga0207707_10003382
654 Ga0207707_10003871
655 Ga0207707_10018215
656 Ga0207707_10041614
657 Ga0207707_10046009
658 Ga0207695_10011497
659 Ga0207695_10020399
660 Ga0207695_10027837
661 Ga0207695_10035795
662 Ga0207695_10115655
663 Ga0207695_10137560
664 Ga0207695_10485653
665 Ga0207671_10202264
666 Ga0207671_10322301
667 Ga0207693_10000385
668 Ga0207693_10088825
669 Ga0207663_10065854
670 Ga0207663_10088280
671 Ga0207660_10027312
672 Ga0207660_10223355
673 Ga0207652_10025697
674 Ga0207652_10071294
675 Ga0207652_10131166
676 Ga0207652_10353647
677 Ga0207694_10121097
678 Ga0207659_10074627
679 Ga0207700_10000880
680 Ga0207700_10042352
681 Ga0207700_10053375
682 Ga0207700_10251506
683 Ga0207664_10009097
684 Ga0207664_10101118
685 Ga0207644_10004210
686 Ga0207644_10011875
687 Ga0207704_10454166
688 Ga0207665_10004787
689 Ga0207691_10063927
690 Ga0207711_10073298
691 Ga0207679_10103026
692 Ga0207667_10008172
693 Ga0207667_10039990
694 Ga0207667_10104441
695 Ga0207667_10360615
696 Ga0207712_10046187
697 Ga0207712_10064079
698 Ga0207712_10176320
699 Ga0207658_10000097
700 Ga0207658_10014533
701 Ga0207677_10324647
702 Ga0207703_10001369
703 Ga0207703_10002198
704 Ga0207703_10059638
705 Ga0207678_10065682
706 Ga0207708_10090591
707 Ga0207702_10065463
708 Ga0207702_10098494
709 Ga0207702_10246877
710 Ga0207641_10020132
711 Ga0207641_10023505
712 Ga0207648_10089910
713 Ga0207674_10285102
714 Ga0207675_100006119
715 Ga0207675_100066684
716 Ga0207675_100400566
717 Ga0207675_101184308
718 Ga0207683_10005289
719 Ga0207683_10008991
720 Ga0209588_1027573
721 Ga0268266_10009454
722 Ga0268266_10092652
723 Ga0268266_10133342
724 Ga0268266_10146123
725 Ga0268265_10004387
726 Ga0268265_10279457
727 Ga0268264_10000293
728 Ga0268264_10014111
729 Ga0268264_10042236
730 Ga0265334_10033985
731 Ga0307511_10000310
732 Ga0307511_10063063
733 Ga0265340_10113609
734 Ga0265331_10002531
735 Ga0307513_10053116
736 Ga0307513_10427076
737 Ga0307509_10000017
738 Ga0307509_10201750
739 Ga0307509_10219013
740 Ga0307408_100010680
741 Ga0307408_100691332
742 Ga0307508_10054893
743 Ga0307508_10372499
744 Ga0307405_10196302
745 Ga0307413_10007569
746 Ga0307413_10011987
747 Ga0307413_10231641
748 Ga0307410_10009939
749 Ga0307410_10308663
750 Ga0307406_10013918
751 Ga0307407_10001931
752 Ga0307407_10012927
753 Ga0307412_10083698
754 Ga0307409_100000521
755 Ga0307411_10001502
756 Ga0316585_10107431
757 Ga0373923_0074101
758 Ga0373923_0143278
759 Ga0373936_0008005
760 Ga0373936_0057091
761 Ga0373939_0235025
762 Ga0373954_0328952
763 Ga0373943_0055157
764 Ga0373955_0283200
765 Ga0373927_0006569
766 Ga0373933_0082018
767 Ga0373947_0125368
768 Ga0373937_0141835
769 Ga0373937_0210970
770 Ga0316582_0215043
771 Ga0373925_0813120
772 Ga0395898_0001671
773 Ga0395898_0031186
774 Ga0436365_1056628
775 Ga0436365_1537890
776 Ga0436360_0081891
777 Ga0436361_0305851
778 Ga0436363_0920383
779 Ga0436363_1711783
780 Ga0436362_0091593
781 Ga0451800_1035928
782 Ga0451804_0099064
783 Ga0451833_0332336
784 Ga0451853_2577382
785 Ga0466972_0038245
786 Ga0466972_0103582
787 Ga0466966_0000115
788 Ga0466961_0000137
789 Ga0466964_0000061
790 Ga0466971_0000102
791 Ga0466970_0000553
792 Ga0466957_0006358
793 Ga0466960_0034441
794 Ga0466960_0181648
795 Ga0466959_0002823
796 Ga0466959_0029335
797 Ga0466959_0137313
798 Ga0466958_0014377
799 Ga0466958_0033075
800 Ga0495590_0071557
801 Ga0495580_0004499
802 Ga0495580_0179696
803 Ga0495583_0308267
804 Ga0495616_0324673
805 Ga0495618_0140494
806 Ga0495628_0177605
807 Ga0495632_0064747
808 Ga0495643_0154857
809 Ga0495652_0551186
810 Ga0495587_0109672
811 Ga0495622_0198281
812 Ga0495668_0040324
813 Ga0495625_0105748
814 Ga0495625_0150280
815 Ga0495604_0269169
816 Ga0495674_0388709
817 Ga0495687_049827
818 Ga0495602_0066282
819 Ga0496100_0035967
820 Ga0496101_0002467
821 Ga0496102_0045260
822 Ga0496102_0185950
823 Ga0496103_0036380
824 Ga0496103_0130264
825 Ga0496103_0182310
826 Ga0496104_0023890
827 Ga0496104_0041137
828 Ga0496105_0040100
829 Ga0496106_0016736
830 Ga0496107_0097031
831 Ga0496107_0285571
832 Ga0496108_0004651
833 Ga0496109_0012647
834 Ga0496110_0016238
835 Ga0496111_0001145
836 Ga0496112_0009020
837 Ga0496112_0206218
838 Ga0496115_0043041
839 Ga0496118_0031399
840 Ga0496121_0005697
841 Ga0496125_0000690
842 Ga0496125_0011719
843 Ga0496126_0006629
844 Ga0496126_0027107
845 Ga0496126_0361599
846 Ga0496126_0428324
847 Ga0501042_0004594
848 Ga0501047_0158357
849 nmdc:mga09592_15456_c1
850 nmdc:mga0rr50_22490_c1
851 nmdc:mga08x19_44251_c1
852 nmdc:mga08x19_705801_c1
853 Ga0500635_0012387
854 Ga0500644_0005519
855 Ga0500583_0040054
856 Ga0500583_0059759
857 Ga0500583_0097632
858 Ga0500583_0277741
859 Ga0500566_0004911
860 Ga0500556_0000806
861 Ga0500569_005380
862 Ga0500591_022334
863 Ga0500595_045587
864 Ga0500597_052204
865 Ga0500614_002641
866 Ga0500564_082176
867 Ga0500568_0097769
868 Ga0500585_044344
869 Ga0500603_001758
870 Ga0500603_022144
871 Ga0500616_0000064
872 Ga0500616_0007166
873 Ga0500622_0079128
874 Ga0500624_024458
875 Ga0500637_0279399
876 Ga0466962_0000766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

50

118

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

50

124

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

53

119

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

166

243

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8742 2 205
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8623 1 205
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8614 2 205
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8611 1 205
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8582 1 205
ID Description Score Start End Superfamily
3bbyA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9131 2 78 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.885 2 77 3.40.30.10
3lykA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.877 4 80 3.40.30.10
1v2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8741 21 78 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8683 18 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3N5LBV4-F1-model_v4 Glutathione S-transferase family protein 0.9881 2 206 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A841HPX9-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9867 3 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A4U1ADD8-F1-model_v4 Glutathione S-transferase family protein 0.9857 4 216 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A1G7W449-F1-model_v4 Glutathione S-transferase 0.9847 4 204 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A4R8HXT3-F1-model_v4 Glutathione S-transferase 0.9841 1 214 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map