F443849

General Info

Members Datasets Scaffolds Average Seq Length
437 268 437 230

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000018|Ga0495668_0000018_372102_372800
Length 226
Sequence MIDFYTAATPNGHKISIALEELELKYTMKVLELGANEQKLDWFGRIPAIVDRANGDFAVFESGAILIYLAEKTGRLMPSDAKGRSLVLQWLMFQMGGIGPMMGQVNVFYRYFPEKLQPAIDRYQGEVRRLFRVLDSRLAHKEFLAGEYSIADIANWAWVRTHRWSGVETEGLPNLQRWIEQIRGRPAVQRGILLPPSNVLDRSDSTEKAEQFAEEARKMLETGQSR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
145 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
268 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.48
Nodule 0.46
Rhizoplane 1.6
Rhizosphere 78.26
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2064111 2162886007 Bacteria 1581
2 JGI25158J39367_1000382 3300002739 Bacteria 9385
3 JGI25163J39215_1000535 3300002771 Bacteria 11159
4 JGI25164J39214_1000268 3300002772 Bacteria 38678
5 JGI25152J39213_1000081 3300002773 Bacteria 65382
6 JGI25150J39212_1000295 3300002774 Bacteria 25413
7 JGI25150J39212_1014105 3300002774 Bacteria 1366
8 JGI25159J45721_1002590 3300002987 Bacteria 6782
9 JGI25159J45721_1017918 3300002987 Bacteria 1445
10 JGI25165J46597_1000483 3300003214 Bacteria 38678
11 JGI25160J50197_1029563 3300003354 Bacteria 1445
12 JGI25161J50226_1000125 3300003374 Bacteria 56088
13 Ga0007416J51690_1036789 3300003577 Bacteria 1222
14 Ga0055529_1000032 3300003763 Bacteria 255895
15 Ga0055526_1000070 3300003771 Bacteria 96845
16 Ga0055526_1000875 3300003771 Bacteria 22443
17 Ga0055537_1001114 3300003773 Bacteria 11614
18 Ga0055537_1004443 3300003773 Bacteria 4012
19 Ga0055524_1000003 3300003775 Bacteria 399748
20 Ga0055524_1000617 3300003775 Bacteria 25512
21 Ga0055524_1002007 3300003775 Bacteria 10867
22 Ga0055524_1005412 3300003775 Bacteria 5705
23 Ga0055534_1001390 3300003784 Bacteria 9662
24 Ga0055534_1004479 3300003784 Bacteria 4036
25 Ga0055528_1032221 3300003790 Bacteria 1344
26 Ga0055530_10001200 3300003791 Bacteria 20028
27 Ga0055530_10003493 3300003791 Bacteria 8896
28 Ga0055530_10003494 3300003791 Bacteria 8894
29 Ga0055531_10004191 3300003794 Bacteria 8894
30 Ga0055543_1000063 3300004625 Bacteria 98011
31 Ga0065165_1002003 3300005262 Bacteria 19080
32 Ga0070670_100625892 3300005331 Bacteria 964
33 Ga0070680_100021681 3300005336 Bacteria 5108
34 Ga0070691_10193834 3300005341 Bacteria 1064
35 Ga0070668_100021155 3300005347 Bacteria 4918
36 Ga0070668_100591051 3300005347 Bacteria 970
37 Ga0070669_100016901 3300005353 Bacteria 5208
38 Ga0070669_100037211 3300005353 Bacteria 3530
39 Ga0070674_100005873 3300005356 Bacteria 7137
40 Ga0070714_100060101 3300005435 Bacteria 3261
41 Ga0070700_100035219 3300005441 Bacteria 3028
42 Ga0070681_10234534 3300005458 Bacteria 1749
43 Ga0068867_100001863 3300005459 Bacteria 14657
44 Ga0068867_100326340 3300005459 Bacteria 1273
45 Ga0070698_100161994 3300005471 Bacteria 2180
46 Ga0070679_100349581 3300005530 Bacteria 1426
47 Ga0070672_100010112 3300005543 Bacteria 6533
48 Ga0070696_100184556 3300005546 Bacteria 1549
49 Ga0068854_100421954 3300005578 Bacteria 1108
50 Ga0070702_100174493 3300005615 Bacteria 1401
51 Ga0068852_100029942 3300005616 Bacteria 4476
52 Ga0068859_100712416 3300005617 Bacteria 1094
53 Ga0068861_100112464 3300005719 Bacteria 2183
54 Ga0068858_100032943 3300005842 Bacteria 4812
55 Ga0068858_100230708 3300005842 Bacteria 1755
56 Ga0068862_100051166 3300005844 Bacteria 3532
57 Ga0075362_10027036 3300006177 Bacteria 2455
58 Ga0075428_100001879 3300006844 Bacteria 22539
59 Ga0075428_100333347 3300006844 Bacteria 1630
60 Ga0075428_100611072 3300006844 Bacteria 1164
61 Ga0075430_100007938 3300006846 Bacteria 8970
62 Ga0075430_100082542 3300006846 Bacteria 2693
63 Ga0075430_100130072 3300006846 Bacteria 2098
64 Ga0075431_100033520 3300006847 Bacteria 5292
65 Ga0075429_100011126 3300006880 Bacteria 7788
66 Ga0075429_100115315 3300006880 Bacteria 2348
67 Ga0068865_100037853 3300006881 Bacteria 3261
68 Ga0097620_100712453 3300006931 Bacteria 1094
69 Ga0099826_10000002 3300006948 Bacteria 1125830
70 Ga0105244_10007343 3300009036 Bacteria 7010
71 Ga0105240_10063651 3300009093 Bacteria 4586
72 Ga0111539_10002969 3300009094 Bacteria 22502
73 Ga0111539_10043738 3300009094 Bacteria 5368
74 Ga0111539_11287431 3300009094 Bacteria 848
75 Ga0105243_10001214 3300009148 Bacteria 23206
76 Ga0105243_10154370 3300009148 Bacteria 1972
77 Ga0105248_10000005 3300009177 Bacteria 673111
78 Ga0105249_10233620 3300009553 Bacteria 1814
79 Ga0105249_10966706 3300009553 Bacteria 920
80 Ga0157371_10001475 3300013102 Bacteria 24398
81 Ga0157370_10134596 3300013104 Bacteria 2304
82 Ga0157375_10112794 3300013308 Bacteria 2819
83 Ga0157380_10114296 3300014326 Bacteria 2275
84 Ga0157380_10177893 3300014326 Bacteria 1866
85 Ga0182008_10000739 3300014497 Bacteria 23122
86 Ga0182008_10002505 3300014497 Bacteria 11461
87 Ga0157379_10447541 3300014968 Bacteria 1192
88 Ga0213872_10000072 3300021361 Bacteria 91345
89 Ga0213872_10003437 3300021361 Bacteria 8801
90 Ga0213872_10047554 3300021361 Bacteria 1950
91 Ga0209760_100174 3300025207 Bacteria 35273
92 Ga0209436_100056 3300025208 Bacteria 61172
93 Ga0209436_101153 3300025208 Bacteria 9756
94 Ga0207427_100001 3300025231 Bacteria 1410763
95 Ga0209437_100003 3300025233 Bacteria 1517827
96 Ga0207425_1000001 3300025245 Bacteria 2525432
97 Ga0207425_1000039 3300025245 Bacteria 219078
98 Ga0209129_1000001 3300025258 Bacteria 1452436
99 Ga0209129_1002688 3300025258 Bacteria 8366
100 Ga0209233_1000007 3300025261 Bacteria 1411234
101 Ga0209565_1001733 3300025263 Bacteria 8920
102 Ga0209565_1003077 3300025263 Bacteria 5602
103 Ga0209565_1010940 3300025263 Bacteria 2231
104 Ga0209565_1031147 3300025263 Bacteria 1037
105 Ga0209455_1000043 3300025272 Bacteria 413928
106 Ga0209673_1010925 3300025273 Bacteria 3787
107 Ga0209130_1000128 3300025284 Bacteria 123595
108 Ga0209130_1024060 3300025284 Bacteria 1335
109 Ga0209675_1000620 3300025291 Bacteria 25347
110 Ga0209675_1011576 3300025291 Bacteria 2917
111 Ga0209564_1000011 3300025295 Bacteria 822327
112 Ga0209564_1000109 3300025295 Bacteria 212912
113 Ga0209564_1021787 3300025295 Bacteria 2291
114 Ga0209564_1035418 3300025295 Bacteria 1445
115 Ga0209564_1045556 3300025295 Bacteria 1127
116 Ga0209758_1000020 3300025297 Bacteria 734220
117 Ga0209050_1000074 3300025298 Bacteria 289334
118 Ga0209050_1000628 3300025298 Bacteria 55015
119 Ga0209050_1002555 3300025298 Bacteria 15204
120 Ga0209256_1000007 3300025299 Bacteria 1136599
121 Ga0209256_1000028 3300025299 Bacteria 420213
122 Ga0209256_1000621 3300025299 Bacteria 48888
123 Ga0209256_1004772 3300025299 Bacteria 8253
124 Ga0207426_1002060 3300025302 Bacteria 13973
125 Ga0209257_1000003 3300025304 Bacteria 1702593
126 Ga0209257_1005394 3300025304 Bacteria 9005
127 Ga0207655_1007755 3300025728 Bacteria 6921
128 Ga0207655_1008947 3300025728 Bacteria 6282
129 Ga0207645_10000615 3300025907 Bacteria 29534
130 Ga0207654_10386315 3300025911 Bacteria 971
131 Ga0207707_10374478 3300025912 Bacteria 1225
132 Ga0207695_10040099 3300025913 Bacteria 5026
133 Ga0207660_10085425 3300025917 Bacteria 2328
134 Ga0207681_10048854 3300025923 Bacteria 2857
135 Ga0207681_10564108 3300025923 Bacteria 938
136 Ga0207664_10006655 3300025929 Bacteria 7965
137 Ga0207644_10111341 3300025931 Bacteria 2071
138 Ga0207706_10000581 3300025933 Bacteria 38892
139 Ga0207706_10875999 3300025933 Bacteria 759
140 Ga0207709_10000861 3300025935 Bacteria 23179
141 Ga0207669_10046579 3300025937 Bacteria 2563
142 Ga0207691_10008097 3300025940 Bacteria 10094
143 Ga0207711_10000002 3300025941 Bacteria 1228676
144 Ga0207668_10073664 3300025972 Bacteria 2448
145 Ga0207703_10449713 3300026035 Bacteria 1203
146 Ga0207648_10001086 3300026089 Bacteria 30484
147 Ga0207675_100000780 3300026118 Bacteria 31801
148 Ga0207698_10099771 3300026142 Bacteria 2403
149 Ga0209984_1003512 3300027424 Bacteria 1799
150 Ga0209982_1001223 3300027552 Bacteria 3460
151 Ga0209982_1029527 3300027552 Bacteria 860
152 Ga0209970_1000371 3300027614 Bacteria 7551
153 Ga0209970_1003615 3300027614 Bacteria 2590
154 Ga0209282_1000001 3300027666 Bacteria 2450367
155 Ga0209971_1000617 3300027682 Bacteria 9232
156 Ga0209998_10005470 3300027717 Bacteria 2659
157 Ga0209974_10004258 3300027876 Bacteria 5105
158 Ga0209974_10013287 3300027876 Bacteria 2743
159 Ga0268265_10019056 3300028380 Bacteria 4764
160 Ga0316177_1080323 3300030731 Bacteria 3429
161 Ga0316181_1123198 3300030744 Bacteria 1473
162 Ga0316182_1087967 3300030745 Bacteria 1216
163 Ga0265332_10000006 3300031238 Bacteria 327963
164 Ga0265332_10003123 3300031238 Bacteria 8070
165 Ga0265340_10001040 3300031247 Bacteria 15829
166 Ga0265339_10001439 3300031249 Bacteria 17656
167 Ga0265316_10006025 3300031344 Bacteria 11652
168 Ga0307408_100000126 3300031548 Bacteria 84345
169 Ga0307408_100002939 3300031548 Bacteria 11806
170 Ga0307408_100020844 3300031548 Bacteria 4428
171 Ga0265313_10066116 3300031595 Bacteria 1677
172 Ga0316575_10031565 3300031665 Bacteria 2074
173 Ga0316575_10033955 3300031665 Bacteria 2003
174 Ga0265314_10003174 3300031711 Bacteria 16100
175 Ga0265314_10013519 3300031711 Bacteria 6590
176 Ga0265342_10038510 3300031712 Bacteria 2911
177 Ga0316576_10129055 3300031727 Bacteria 1901
178 Ga0316578_10027599 3300031728 Bacteria 3209
179 Ga0316577_10127121 3300031733 Bacteria 1433
180 Ga0307518_10173305 3300031838 Bacteria 1468
181 Ga0307407_10393584 3300031903 Bacteria 992
182 Ga0307416_100045218 3300032002 Bacteria 3465
183 Ga0307414_10200143 3300032004 Bacteria 1624
184 Ga0307411_10239726 3300032005 Bacteria 1419
185 Ga0316580_10026420 3300032139 Bacteria 1795
186 Ga0373934_0007797 3300035086 Bacteria 3980
187 Ga0373923_0188329 3300035111 Bacteria 950
188 Ga0373953_0018003 3300035117 Bacteria 2606
189 Ga0373954_0028856 3300035118 Bacteria 2552
190 Ga0373956_0048829 3300035119 Bacteria 1896
191 Ga0373957_0027903 3300035120 Bacteria 2053
192 Ga0373955_0105164 3300035172 Bacteria 1625
193 Ga0316574_0103560 3300035398 Bacteria 1822
194 Ga0316574_0108235 3300035398 Bacteria 1781
195 Ga0316574_0223206 3300035398 Bacteria 1207
196 Ga0373924_0006228 3300035410 Bacteria 4267
197 Ga0373937_0073250 3300036401 Bacteria 3159
198 Ga0316582_0029200 3300036647 Bacteria 3348
199 Ga0316584_0027873 3300036712 Bacteria 4159
200 Ga0316584_0033489 3300036712 Bacteria 3807
201 Ga0395899_0000127 3300037312 Bacteria 119435
202 Ga0436361_0262860 3300039447 Bacteria 38390
203 Ga0436361_0517260 3300039447 Bacteria 1147
204 Ga0436361_0897037 3300039447 Bacteria 2219
205 Ga0436361_0941555 3300039447 Bacteria 1065
206 Ga0436361_1023025 3300039447 Bacteria 5945
207 Ga0436361_1029820 3300039447 Bacteria 8802
208 Ga0436361_1185928 3300039447 Bacteria 172199
209 Ga0439456_003692 3300042013 Bacteria 3113
210 Ga0450903_000862 3300042138 Bacteria 5874
211 Ga0439435_0008069 3300042436 Bacteria 2434
212 Ga0439444_0010565 3300042437 Bacteria 1477
213 Ga0439460_0026502 3300042461 Bacteria 1621
214 Ga0451577_0016771 3300042876 Bacteria 6773
215 Ga0451577_0424204 3300042876 Bacteria 1208
216 Ga0453683_0322363 3300044673 Bacteria 990
217 Ga0453684_0115348 3300044712 Bacteria 3255
218 Ga0451576_0018096 3300045051 Bacteria 7733
219 Ga0451576_0596845 3300045051 Bacteria 1160
220 Ga0495617_000003 3300046452 Bacteria 541914
221 Ga0495617_003569 3300046452 Bacteria 5821
222 Ga0495627_033206 3300046453 Bacteria 1619
223 Ga0495592_0020410 3300046454 Bacteria 5039
224 Ga0495603_0045679 3300046455 Bacteria 2611
225 Ga0495629_0108164 3300046459 Bacteria 1939
226 Ga0495638_0005021 3300046460 Bacteria 9935
227 Ga0495651_0009538 3300046462 Bacteria 7456
228 Ga0495653_0000024 3300046463 Bacteria 160810
229 Ga0495650_0000019 3300046471 Bacteria 533849
230 Ga0495650_0000390 3300046471 Bacteria 75055
231 Ga0495650_0001932 3300046471 Bacteria 18350
232 Ga0495650_0012609 3300046471 Bacteria 4534
233 Ga0495664_0030415 3300046477 Bacteria 3163
234 Ga0495584_0000021 3300046491 Bacteria 130377
235 Ga0495584_0000271 3300046491 Bacteria 36789
236 Ga0495584_0000298 3300046491 Bacteria 34980
237 Ga0495584_0001434 3300046491 Bacteria 14351
238 Ga0495585_0000005 3300046492 Bacteria 328103
239 Ga0495585_0000465 3300046492 Bacteria 38766
240 Ga0495585_0005055 3300046492 Bacteria 8409
241 Ga0495585_0005962 3300046492 Bacteria 7625
242 Ga0495585_0100260 3300046492 Bacteria 1549
243 Ga0495596_0007204 3300046500 Bacteria 5032
244 Ga0495607_0003191 3300046501 Bacteria 12670
245 Ga0495607_0015094 3300046501 Bacteria 5016
246 Ga0495607_0074223 3300046501 Bacteria 1888
247 Ga0495607_0112484 3300046501 Bacteria 1441
248 Ga0495583_0000040 3300046506 Bacteria 236558
249 Ga0495583_0000140 3300046506 Bacteria 123415
250 Ga0495583_0000189 3300046506 Bacteria 103518
251 Ga0495583_0038147 3300046506 Bacteria 2272
252 Ga0495606_0000095 3300046507 Bacteria 151634
253 Ga0495606_0000614 3300046507 Bacteria 56117
254 Ga0495606_0000884 3300046507 Bacteria 44821
255 Ga0495606_0000943 3300046507 Bacteria 42806
256 Ga0495606_0001972 3300046507 Bacteria 25327
257 Ga0495606_0005199 3300046507 Bacteria 12566
258 Ga0495606_0010266 3300046507 Bacteria 7799
259 Ga0495608_0088278 3300046511 Bacteria 2007
260 Ga0495610_0000003 3300046512 Bacteria 1203910
261 Ga0495610_0005631 3300046512 Bacteria 8837
262 Ga0495610_0011572 3300046512 Bacteria 5382
263 Ga0495610_0017231 3300046512 Bacteria 4124
264 Ga0495616_0000408 3300046513 Bacteria 33210
265 Ga0495616_0001960 3300046513 Bacteria 13854
266 Ga0495616_0068955 3300046513 Bacteria 1716
267 Ga0495618_0065670 3300046514 Bacteria 2306
268 Ga0495620_0101238 3300046515 Bacteria 1148
269 Ga0495628_0103225 3300046516 Bacteria 2198
270 Ga0495630_0656718 3300046517 Bacteria 803
271 Ga0495637_0002179 3300046520 Bacteria 10955
272 Ga0495637_0023128 3300046520 Bacteria 2828
273 Ga0495643_0008971 3300046522 Bacteria 6282
274 Ga0495643_0063709 3300046522 Bacteria 1949
275 Ga0495644_0000252 3300046523 Bacteria 24796
276 Ga0495644_0000711 3300046523 Bacteria 13789
277 Ga0495644_0015195 3300046523 Bacteria 2948
278 Ga0495648_0000076 3300046524 Bacteria 129413
279 Ga0495648_0000257 3300046524 Bacteria 60516
280 Ga0495648_0003815 3300046524 Bacteria 13092
281 Ga0495648_0008978 3300046524 Bacteria 7807
282 Ga0495648_0095746 3300046524 Bacteria 1651
283 Ga0495666_0030288 3300046526 Bacteria 2657
284 Ga0495642_0030500 3300046528 Bacteria 2157
285 Ga0495652_0039757 3300046529 Bacteria 4066
286 Ga0495654_0000176 3300046530 Bacteria 62766
287 Ga0495665_0038121 3300046531 Bacteria 2563
288 Ga0495640_0041441 3300046533 Bacteria 3217
289 Ga0495586_0052641 3300046535 Bacteria 2204
290 Ga0495609_0002090 3300046538 Bacteria 12552
291 Ga0495609_0157162 3300046538 Bacteria 965
292 Ga0495621_0074537 3300046539 Bacteria 1256
293 Ga0495597_0005109 3300046542 Bacteria 7003
294 Ga0495597_0013868 3300046542 Bacteria 3852
295 Ga0495597_0062651 3300046542 Bacteria 1617
296 Ga0495645_0008575 3300046543 Bacteria 7139
297 Ga0495622_0000001 3300046557 Bacteria 365248
298 Ga0495633_0000117 3300046558 Bacteria 108053
299 Ga0495633_0001137 3300046558 Bacteria 21361
300 Ga0495633_0003243 3300046558 Bacteria 10971
301 Ga0495633_0006731 3300046558 Bacteria 6764
302 Ga0495633_0008124 3300046558 Bacteria 5950
303 Ga0495633_0022937 3300046558 Bacteria 3096
304 Ga0495633_0028431 3300046558 Bacteria 2725
305 Ga0495633_0145696 3300046558 Bacteria 1094
306 Ga0495656_0001386 3300046615 Bacteria 7920
307 Ga0495656_0075203 3300046615 Bacteria 1510
308 Ga0495656_0185464 3300046615 Bacteria 1025
309 Ga0495668_0000018 3300046616 Bacteria 417480
310 Ga0495668_0000214 3300046616 Bacteria 84120
311 Ga0495668_0005641 3300046616 Bacteria 8399
312 Ga0495668_0009615 3300046616 Bacteria 5917
313 Ga0495634_0085295 3300046642 Bacteria 2058
314 Ga0495611_0006968 3300046648 Bacteria 4802
315 Ga0495611_0010199 3300046648 Bacteria 3975
316 Ga0495611_0011895 3300046648 Bacteria 3694
317 Ga0495611_0017048 3300046648 Bacteria 3105
318 Ga0495625_0002132 3300046660 Bacteria 22069
319 Ga0495625_0006149 3300046660 Bacteria 10750
320 Ga0495625_0014540 3300046660 Bacteria 6273
321 Ga0495625_0017192 3300046660 Bacteria 5664
322 Ga0495625_0128045 3300046660 Bacteria 1722
323 Ga0495625_0151329 3300046660 Bacteria 1560
324 Ga0495635_0035451 3300046663 Bacteria 3458
325 Ga0495635_0089675 3300046663 Bacteria 2104
326 Ga0495659_0000536 3300046664 Bacteria 14019
327 Ga0495659_0009136 3300046664 Bacteria 3160
328 Ga0495661_0037246 3300046665 Bacteria 3038
329 Ga0495661_0060039 3300046665 Bacteria 2260
330 Ga0495588_0006074 3300046674 Bacteria 5420
331 Ga0495588_0267621 3300046674 Bacteria 900
332 Ga0495588_0328339 3300046674 Bacteria 804
333 Ga0495657_0090173 3300046675 Bacteria 1968
334 Ga0495599_0034365 3300046678 Bacteria 3185
335 Ga0495623_0058673 3300046679 Bacteria 2419
336 Ga0495646_0010035 3300046680 Bacteria 6021
337 Ga0495670_0000516 3300046691 Bacteria 18215
338 Ga0495670_0003076 3300046691 Bacteria 8224
339 Ga0495670_0076351 3300046691 Bacteria 1702
340 Ga0495671_0000010 3300046692 Bacteria 368641
341 Ga0495671_0000080 3300046692 Bacteria 92649
342 Ga0495671_0001870 3300046692 Bacteria 13529
343 Ga0495671_0020780 3300046692 Bacteria 3456
344 Ga0495671_0071260 3300046692 Bacteria 1707
345 Ga0495649_0001946 3300046694 Bacteria 15020
346 Ga0495649_0007618 3300046694 Bacteria 6580
347 Ga0495589_0206496 3300046794 Bacteria 926
348 Ga0495600_0049815 3300046809 Bacteria 2732
349 Ga0495600_0270866 3300046809 Bacteria 1077
350 Ga0495660_0000053 3300046810 Bacteria 137479
351 Ga0495660_0006746 3300046810 Bacteria 6775
352 Ga0495660_0048213 3300046810 Bacteria 2330
353 Ga0495660_0103290 3300046810 Bacteria 1464
354 Ga0495660_0113905 3300046810 Bacteria 1376
355 Ga0495581_0057142 3300047315 Bacteria 2252
356 Ga0495604_0032778 3300047317 Bacteria 4115
357 Ga0495636_0001107 3300047318 Bacteria 10130
358 Ga0495636_0006158 3300047318 Bacteria 4712
359 Ga0495636_0060391 3300047318 Bacteria 1601
360 Ga0495674_0001458 3300047319 Bacteria 23159
361 Ga0495674_0031312 3300047319 Bacteria 4833
362 Ga0495672_0000121 3300047320 Bacteria 121680
363 Ga0495672_0049274 3300047320 Bacteria 2493
364 Ga0495680_0011531 3300047322 Bacteria 7817
365 Ga0495683_0002722 3300047323 Bacteria 10533
366 Ga0495687_000368 3300047443 Bacteria 56292
367 Ga0495677_0011576 3300047445 Bacteria 3225
368 Ga0495677_0012428 3300047445 Bacteria 3105
369 Ga0495679_022268 3300047446 Bacteria 2171
370 Ga0495685_000021 3300047447 Bacteria 72522
371 Ga0495685_019344 3300047447 Bacteria 2340
372 Ga0495685_043906 3300047447 Bacteria 1525
373 Ga0495673_0000016 3300047469 Bacteria 580643
374 Ga0495673_0007853 3300047469 Bacteria 6067
375 Ga0495681_0003771 3300047470 Bacteria 10505
376 Ga0495681_0032270 3300047470 Bacteria 2639
377 Ga0495684_0079746 3300047471 Bacteria 2485
378 Ga0495686_0007284 3300047472 Bacteria 8318
379 Ga0495686_0058497 3300047472 Bacteria 2402
380 Ga0495686_0198131 3300047472 Bacteria 1154
381 Ga0495602_0094269 3300048088 Bacteria 2474
382 Ga0495614_0264446 3300048089 Bacteria 789
383 Ga0495615_0000350 3300048090 Bacteria 7363
384 Ga0495626_0001161 3300048091 Bacteria 21945
385 Ga0495626_0001542 3300048091 Bacteria 18096
386 Ga0496102_0000113 3300048905 Bacteria 114531
387 Ga0496102_0098430 3300048905 Bacteria 2714
388 Ga0496102_0099883 3300048905 Bacteria 2694
389 Ga0496103_0019894 3300048906 Bacteria 4031
390 Ga0496104_0555204 3300048907 Bacteria 1059
391 Ga0496107_0065972 3300048910 Bacteria 2624
392 Ga0496114_0044109 3300048917 Bacteria 3699
393 Ga0496116_0000618 3300048919 Bacteria 46831
394 Ga0496117_0000871 3300048920 Bacteria 46535
395 Ga0496118_0018946 3300048921 Bacteria 6171
396 Ga0496120_0092901 3300048923 Bacteria 1608
397 Ga0496121_0001131 3300048924 Bacteria 46845
398 Ga0496122_0002983 3300048925 Bacteria 23035
399 Ga0496122_0087460 3300048925 Bacteria 2141
400 Ga0496122_0116979 3300048925 Bacteria 1732
401 Ga0496123_0002828 3300048926 Bacteria 20535
402 Ga0496123_0004069 3300048926 Bacteria 15748
403 Ga0496124_0035431 3300048927 Bacteria 4367
404 Ga0496124_0205298 3300048927 Bacteria 1495
405 Ga0496126_0004246 3300048929 Bacteria 17249
406 Ga0495678_003378 3300049459 Bacteria 9934
407 Ga0495678_022484 3300049459 Bacteria 2756
408 Ga0495682_0000333 3300049460 Bacteria 35005
409 Ga0495682_0001680 3300049460 Bacteria 11284
410 Ga0495682_0095350 3300049460 Bacteria 1068
411 Ga0501031_0001088 3300049568 Bacteria 16530
412 Ga0501034_0158476 3300049571 Bacteria 2236
413 Ga0501040_0170630 3300049576 Bacteria 1540
414 Ga0501071_0131614 3300049587 Bacteria 1859
415 Ga0501071_0365437 3300049587 Bacteria 1099
416 Ga0501073_0194263 3300049589 Bacteria 1404
417 Ga0501074_0179005 3300049590 Bacteria 1513
418 Ga0501238_004162 3300049671 Bacteria 1799
419 Ga0501083_0128391 3300049744 Bacteria 1661
420 Ga0501269_000517 3300049766 Bacteria 7773
421 Ga0501045_0225480 3300049824 Bacteria 1395
422 nmdc:mga03683_28649_c1 3300050489 Bacteria 2216
423 nmdc:mga03683_62278_c1 3300050489 Bacteria 1580
424 nmdc:mga03n38_145703_c1 3300050490 Bacteria 1187
425 nmdc:mga05p37_277876_c1 3300050507 Bacteria 1998
426 nmdc:mga09592_222781_c1 3300050508 Bacteria 1634
427 nmdc:mga09592_245505_c1 3300050508 Bacteria 1552
428 nmdc:mga0qj67_105992_c1 3300050509 Bacteria 2268
429 nmdc:mga0qj67_4664_c1 3300050509 Bacteria 9946
430 nmdc:mga06r32_33944_c1 3300050510 Bacteria 4808
431 nmdc:mga08y16_981979_c1 3300050511 Bacteria 825
432 Ga0495601_0049307 3300053077 Bacteria 2654
433 Ga0495612_0027109 3300053078 Bacteria 2303
434 Ga0495619_0016929 3300053085 Bacteria 4617
435 Ga0500586_000138 3300053145 Bacteria 13300
436 Ga0500586_001188 3300053145 Bacteria 5422
437 Ga0500619_033482 3300053154 Bacteria 1582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100591051 Ga0070668_1005910511 218
2 3300005353 Ga0070669_100037211 Ga0070669_1000372114 218
3 3300002771 JGI25163J39215_1000535 JGI25163J39215_10005357 219
4 3300002772 JGI25164J39214_1000268 JGI25164J39214_100026828 219
5 3300003214 JGI25165J46597_1000483 JGI25165J46597_100048328 219
6 3300009148 Ga0105243_10001214 Ga0105243_1000121412 219
7 3300013102 Ga0157371_10001475 Ga0157371_1000147514 219
8 3300014497 Ga0182008_10000739 Ga0182008_1000073912 219
9 3300014497 Ga0182008_10002505 Ga0182008_100025053 219
10 3300025207 Ga0209760_100174 Ga0209760_10017414 219
11 3300025231 Ga0207427_100001 Ga0207427_100001989 219
12 3300025233 Ga0209437_100003 Ga0209437_100003383 219
13 3300025261 Ga0209233_1000007 Ga0209233_1000007989 219
14 3300025935 Ga0207709_10000861 Ga0207709_1000086111 219
15 3300031903 Ga0307407_10393584 Ga0307407_103935842 219
16 3300032004 Ga0307414_10200143 Ga0307414_102001431 219
17 3300032005 Ga0307411_10239726 Ga0307411_102397262 219
18 3300035398 Ga0316574_0103560 Ga0316574_0103560_863_1522 219
19 3300035398 Ga0316574_0223206 Ga0316574_0223206_42_701 219
20 3300042013 Ga0439456_003692 Ga0439456_003692_491_1150 219
21 3300042138 Ga0450903_000862 Ga0450903_000862_2994_3653 219
22 3300042461 Ga0439460_0026502 Ga0439460_0026502_230_889 219
23 3300046455 Ga0495603_0045679 Ga0495603_0045679_771_1430 219
24 3300046491 Ga0495584_0001434 Ga0495584_0001434_10835_11494 219
25 3300046520 Ga0495637_0023128 Ga0495637_0023128_2079_2738 219
26 3300046692 Ga0495671_0020780 Ga0495671_0020780_1136_1795 219
27 3300046692 Ga0495671_0071260 Ga0495671_0071260_1025_1684 219
28 3300047470 Ga0495681_0003771 Ga0495681_0003771_7778_8437 219
29 3300048091 Ga0495626_0001161 Ga0495626_0001161_9139_9798 219
30 3300048919 Ga0496116_0000618 Ga0496116_0000618_11438_12097 219
31 3300048920 Ga0496117_0000871 Ga0496117_0000871_11450_12109 219
32 3300048921 Ga0496118_0018946 Ga0496118_0018946_4371_5030 219
33 3300048924 Ga0496121_0001131 Ga0496121_0001131_11447_12106 219
34 3300048925 Ga0496122_0002983 Ga0496122_0002983_11463_12122 219
35 3300048926 Ga0496123_0004069 Ga0496123_0004069_3649_4308 219
36 3300039447 Ga0436361_0517260 Ga0436361_0517260_172_834 220
37 3300039447 Ga0436361_0941555 Ga0436361_0941555_135_797 220
38 3300047472 Ga0495686_0007284 Ga0495686_0007284_5465_6163 220
39 3300013104 Ga0157370_10134596 Ga0157370_101345963 221
40 3300046507 Ga0495606_0000884 Ga0495606_0000884_19896_20561 221
41 3300046522 Ga0495643_0008971 Ga0495643_0008971_1867_2532 221
42 3300046692 Ga0495671_0001870 Ga0495671_0001870_10982_11710 221
43 3300046694 Ga0495649_0001946 Ga0495649_0001946_10738_11403 221
44 3300046694 Ga0495649_0007618 Ga0495649_0007618_3222_3950 221
45 3300046810 Ga0495660_0113905 Ga0495660_0113905_332_997 221
46 3300047470 Ga0495681_0032270 Ga0495681_0032270_1232_1960 221
47 3300003771 Ga0055526_1000070 Ga0055526_100007051 222
48 3300005331 Ga0070670_100625892 Ga0070670_1006258922 222
49 3300005471 Ga0070698_100161994 Ga0070698_1001619941 222
50 3300005546 Ga0070696_100184556 Ga0070696_1001845562 222
51 3300005617 Ga0068859_100712416 Ga0068859_1007124162 222
52 3300005842 Ga0068858_100032943 Ga0068858_1000329436 222
53 3300005842 Ga0068858_100230708 Ga0068858_1002307082 222
54 3300006931 Ga0097620_100712453 Ga0097620_1007124532 222
55 3300009036 Ga0105244_10007343 Ga0105244_100073432 222
56 3300009553 Ga0105249_10966706 Ga0105249_109667061 222
57 3300014968 Ga0157379_10447541 Ga0157379_104475412 222
58 3300025295 Ga0209564_1000011 Ga0209564_1000011151 222
59 3300025728 Ga0207655_1007755 Ga0207655_10077554 222
60 3300026035 Ga0207703_10449713 Ga0207703_104497132 222
61 3300031238 Ga0265332_10003123 Ga0265332_100031234 222
62 3300031249 Ga0265339_10001439 Ga0265339_1000143916 222
63 3300031595 Ga0265313_10066116 Ga0265313_100661162 222
64 3300031711 Ga0265314_10003174 Ga0265314_1000317410 222
65 3300031712 Ga0265342_10038510 Ga0265342_100385103 222
66 3300044673 Ga0453683_0322363 Ga0453683_0322363_33_701 222
67 3300045051 Ga0451576_0596845 Ga0451576_0596845_453_1121 222
68 3300046452 Ga0495617_000003 Ga0495617_000003_385955_386623 222
69 3300046453 Ga0495627_033206 Ga0495627_033206_684_1352 222
70 3300046463 Ga0495653_0000024 Ga0495653_0000024_77992_78660 222
71 3300046471 Ga0495650_0000390 Ga0495650_0000390_32283_32951 222
72 3300046471 Ga0495650_0001932 Ga0495650_0001932_15601_16269 222
73 3300046471 Ga0495650_0012609 Ga0495650_0012609_2855_3676 222
74 3300046492 Ga0495585_0005962 Ga0495585_0005962_3984_4652 222
75 3300046501 Ga0495607_0015094 Ga0495607_0015094_85_753 222
76 3300046507 Ga0495606_0000095 Ga0495606_0000095_90960_91628 222
77 3300046512 Ga0495610_0000003 Ga0495610_0000003_1077281_1077949 222
78 3300046520 Ga0495637_0002179 Ga0495637_0002179_7434_8255 222
79 3300046522 Ga0495643_0063709 Ga0495643_0063709_849_1517 222
80 3300046524 Ga0495648_0003815 Ga0495648_0003815_10182_10850 222
81 3300046524 Ga0495648_0008978 Ga0495648_0008978_3201_3869 222
82 3300046530 Ga0495654_0000176 Ga0495654_0000176_40941_41762 222
83 3300046558 Ga0495633_0008124 Ga0495633_0008124_1385_2053 222
84 3300046558 Ga0495633_0028431 Ga0495633_0028431_929_1597 222
85 3300046616 Ga0495668_0000214 Ga0495668_0000214_24856_25524 222
86 3300046616 Ga0495668_0009615 Ga0495668_0009615_3595_4302 222
87 3300046660 Ga0495625_0002132 Ga0495625_0002132_15698_16366 222
88 3300046692 Ga0495671_0000010 Ga0495671_0000010_318700_319368 222
89 3300046794 Ga0495589_0206496 Ga0495589_0206496_30_698 222
90 3300046810 Ga0495660_0006746 Ga0495660_0006746_2382_3050 222
91 3300046810 Ga0495660_0048213 Ga0495660_0048213_198_989 222
92 3300047446 Ga0495679_022268 Ga0495679_022268_411_1079 222
93 3300047469 Ga0495673_0000016 Ga0495673_0000016_126823_127491 222
94 3300047472 Ga0495686_0198131 Ga0495686_0198131_385_1053 222
95 3300048907 Ga0496104_0555204 Ga0496104_0555204_124_792 222
96 3300048910 Ga0496107_0065972 Ga0496107_0065972_249_956 222
97 3300048923 Ga0496120_0092901 Ga0496120_0092901_271_939 222
98 3300048925 Ga0496122_0087460 Ga0496122_0087460_167_835 222
99 3300048925 Ga0496122_0116979 Ga0496122_0116979_693_1361 222
100 3300048926 Ga0496123_0002828 Ga0496123_0002828_14859_15527 222
101 3300048927 Ga0496124_0035431 Ga0496124_0035431_2506_3213 222
102 3300048927 Ga0496124_0205298 Ga0496124_0205298_673_1341 222
103 3300048929 Ga0496126_0004246 Ga0496126_0004246_5335_6003 222
104 3300049589 Ga0501073_0194263 Ga0501073_0194263_501_1187 222
105 3300049744 Ga0501083_0128391 Ga0501083_0128391_490_1161 222
106 3300050489 nmdc:mga03683_62278_c1 nmdc:mga03683_62278_c1_635_1303 222
107 3300050507 nmdc:mga05p37_277876_c1 nmdc:mga05p37_277876_c1_10_684 222
108 3300053145 Ga0500586_000138 Ga0500586_000138_9553_10221 222
109 3300005458 Ga0070681_10234534 Ga0070681_102345342 225
110 3300005615 Ga0070702_100174493 Ga0070702_1001744932 225
111 3300005616 Ga0068852_100029942 Ga0068852_1000299424 225
112 3300006844 Ga0075428_100001879 Ga0075428_1000018797 225
113 3300006846 Ga0075430_100007938 Ga0075430_1000079382 225
114 3300006880 Ga0075429_100011126 Ga0075429_1000111264 225
115 3300009093 Ga0105240_10063651 Ga0105240_100636516 225
116 3300009094 Ga0111539_10002969 Ga0111539_100029699 225
117 3300009094 Ga0111539_11287431 Ga0111539_112874312 225
118 3300009177 Ga0105248_10000005 Ga0105248_10000005288 225
119 3300009553 Ga0105249_10233620 Ga0105249_102336202 225
120 3300025911 Ga0207654_10386315 Ga0207654_103863152 225
121 3300025912 Ga0207707_10374478 Ga0207707_103744782 225
122 3300025913 Ga0207695_10040099 Ga0207695_100400997 225
123 3300025941 Ga0207711_10000002 Ga0207711_10000002288 225
124 3300026142 Ga0207698_10099771 Ga0207698_100997712 225
125 3300031247 Ga0265340_10001040 Ga0265340_100010408 225
126 3300031344 Ga0265316_10006025 Ga0265316_1000602510 225
127 3300046616 Ga0495668_0000018 Ga0495668_0000018_372102_372800 225
128 3300049459 Ga0495678_022484 Ga0495678_022484_658_1356 225
129 3300049576 Ga0501040_0170630 Ga0501040_0170630_258_935 225
130 3300049587 Ga0501071_0131614 Ga0501071_0131614_957_1634 225
131 3300049824 Ga0501045_0225480 Ga0501045_0225480_457_1134 225
132 3300050508 nmdc:mga09592_222781_c1 nmdc:mga09592_222781_c1_766_1443 225
133 3300053154 Ga0500619_033482 Ga0500619_033482_584_1261 225
134 3300005435 Ga0070714_100060101 Ga0070714_1000601013 227
135 3300025929 Ga0207664_10006655 Ga0207664_100066558 227
136 3300035086 Ga0373934_0007797 Ga0373934_0007797_601_1287 227
137 3300035111 Ga0373923_0188329 Ga0373923_0188329_192_878 227
138 3300035117 Ga0373953_0018003 Ga0373953_0018003_782_1468 227
139 3300035118 Ga0373954_0028856 Ga0373954_0028856_972_1658 227
140 3300035119 Ga0373956_0048829 Ga0373956_0048829_1137_1823 227
141 3300035120 Ga0373957_0027903 Ga0373957_0027903_1030_1716 227
142 3300035172 Ga0373955_0105164 Ga0373955_0105164_164_850 227
143 3300035410 Ga0373924_0006228 Ga0373924_0006228_1743_2429 227
144 3300036401 Ga0373937_0073250 Ga0373937_0073250_947_1633 227
145 3300046454 Ga0495592_0020410 Ga0495592_0020410_1374_2060 227
146 3300046459 Ga0495629_0108164 Ga0495629_0108164_738_1424 227
147 3300046462 Ga0495651_0009538 Ga0495651_0009538_5593_6279 227
148 3300046477 Ga0495664_0030415 Ga0495664_0030415_1855_2541 227
149 3300046500 Ga0495596_0007204 Ga0495596_0007204_3979_4692 227
150 3300046511 Ga0495608_0088278 Ga0495608_0088278_274_960 227
151 3300046514 Ga0495618_0065670 Ga0495618_0065670_974_1660 227
152 3300046516 Ga0495628_0103225 Ga0495628_0103225_628_1314 227
153 3300046517 Ga0495630_0656718 Ga0495630_0656718_74_760 227
154 3300046529 Ga0495652_0039757 Ga0495652_0039757_1232_1918 227
155 3300046533 Ga0495640_0041441 Ga0495640_0041441_384_1070 227
156 3300046543 Ga0495645_0008575 Ga0495645_0008575_5917_6603 227
157 3300046642 Ga0495634_0085295 Ga0495634_0085295_520_1206 227
158 3300046663 Ga0495635_0035451 Ga0495635_0035451_1800_2486 227
159 3300046675 Ga0495657_0090173 Ga0495657_0090173_875_1561 227
160 3300046678 Ga0495599_0034365 Ga0495599_0034365_1984_2670 227
161 3300046679 Ga0495623_0058673 Ga0495623_0058673_416_1102 227
162 3300046680 Ga0495646_0010035 Ga0495646_0010035_4178_4864 227
163 3300046809 Ga0495600_0049815 Ga0495600_0049815_516_1202 227
164 3300047317 Ga0495604_0032778 Ga0495604_0032778_2564_3250 227
165 3300047319 Ga0495674_0031312 Ga0495674_0031312_3632_4318 227
166 3300047322 Ga0495680_0011531 Ga0495680_0011531_5948_6634 227
167 3300047471 Ga0495684_0079746 Ga0495684_0079746_1148_1834 227
168 3300048088 Ga0495602_0094269 Ga0495602_0094269_1715_2401 227
169 3300049590 Ga0501074_0179005 Ga0501074_0179005_440_1123 227
170 3300053077 Ga0495601_0049307 Ga0495601_0049307_168_854 227
171 3300053078 Ga0495612_0027109 Ga0495612_0027109_1031_1717 227
172 3300053085 Ga0495619_0016929 Ga0495619_0016929_1801_2487 227
173 3300005336 Ga0070680_100021681 Ga0070680_1000216815 228
174 3300005341 Ga0070691_10193834 Ga0070691_101938342 228
175 3300005347 Ga0070668_100021155 Ga0070668_1000211554 228
176 3300005353 Ga0070669_100016901 Ga0070669_1000169012 228
177 3300005356 Ga0070674_100005873 Ga0070674_1000058734 228
178 3300005441 Ga0070700_100035219 Ga0070700_1000352194 228
179 3300005459 Ga0068867_100001863 Ga0068867_1000018635 228
180 3300005530 Ga0070679_100349581 Ga0070679_1003495812 228
181 3300005543 Ga0070672_100010112 Ga0070672_1000101126 228
182 3300005578 Ga0068854_100421954 Ga0068854_1004219541 228
183 3300005719 Ga0068861_100112464 Ga0068861_1001124643 228
184 3300005844 Ga0068862_100051166 Ga0068862_1000511662 228
185 3300006844 Ga0075428_100333347 Ga0075428_1003333472 228
186 3300006844 Ga0075428_100611072 Ga0075428_1006110721 228
187 3300006846 Ga0075430_100082542 Ga0075430_1000825422 228
188 3300006847 Ga0075431_100033520 Ga0075431_1000335203 228
189 3300006880 Ga0075429_100115315 Ga0075429_1001153152 228
190 3300006881 Ga0068865_100037853 Ga0068865_1000378533 228
191 3300009094 Ga0111539_10043738 Ga0111539_100437384 228
192 3300009148 Ga0105243_10154370 Ga0105243_101543702 228
193 3300013308 Ga0157375_10112794 Ga0157375_101127942 228
194 3300014326 Ga0157380_10114296 Ga0157380_101142962 228
195 3300025907 Ga0207645_10000615 Ga0207645_1000061516 228
196 3300025917 Ga0207660_10085425 Ga0207660_100854253 228
197 3300025923 Ga0207681_10048854 Ga0207681_100488543 228
198 3300025933 Ga0207706_10000581 Ga0207706_100005814 228
199 3300025937 Ga0207669_10046579 Ga0207669_100465792 228
200 3300025940 Ga0207691_10008097 Ga0207691_100080976 228
201 3300025972 Ga0207668_10073664 Ga0207668_100736642 228
202 3300026089 Ga0207648_10001086 Ga0207648_100010868 228
203 3300026118 Ga0207675_100000780 Ga0207675_1000007804 228
204 3300027424 Ga0209984_1003512 Ga0209984_10035122 228
205 3300027552 Ga0209982_1001223 Ga0209982_10012233 228
206 3300027614 Ga0209970_1003615 Ga0209970_10036152 228
207 3300027682 Ga0209971_1000617 Ga0209971_10006174 228
208 3300027717 Ga0209998_10005470 Ga0209998_100054703 228
209 3300027876 Ga0209974_10004258 Ga0209974_100042584 228
210 3300028380 Ga0268265_10019056 Ga0268265_100190564 228
211 3300042436 Ga0439435_0008069 Ga0439435_0008069_496_1182 228
212 3300042437 Ga0439444_0010565 Ga0439444_0010565_753_1439 228
213 3300049587 Ga0501071_0365437 Ga0501071_0365437_305_1048 228
214 3300050508 nmdc:mga09592_245505_c1 nmdc:mga09592_245505_c1_451_1137 228
215 3300050509 nmdc:mga0qj67_4664_c1 nmdc:mga0qj67_4664_c1_988_1674 228
216 3300050510 nmdc:mga06r32_33944_c1 nmdc:mga06r32_33944_c1_3480_4166 228
217 3300050511 nmdc:mga08y16_981979_c1 nmdc:mga08y16_981979_c1_25_711 228
218 3300005459 Ga0068867_100326340 Ga0068867_1003263402 229
219 3300014326 Ga0157380_10177893 Ga0157380_101778931 229
220 3300025923 Ga0207681_10564108 Ga0207681_105641081 229
221 3300025931 Ga0207644_10111341 Ga0207644_101113412 229
222 3300025933 Ga0207706_10875999 Ga0207706_108759991 229
223 3300031665 Ga0316575_10031565 Ga0316575_100315653 229
224 3300031665 Ga0316575_10033955 Ga0316575_100339553 229
225 3300031728 Ga0316578_10027599 Ga0316578_100275993 229
226 3300031733 Ga0316577_10127121 Ga0316577_101271211 229
227 3300032139 Ga0316580_10026420 Ga0316580_100264202 229
228 3300035398 Ga0316574_0108235 Ga0316574_0108235_1037_1726 229
229 3300036647 Ga0316582_0029200 Ga0316582_0029200_1946_2635 229
230 3300036712 Ga0316584_0027873 Ga0316584_0027873_1156_1845 229
231 3300003763 Ga0055529_1000032 Ga0055529_1000032101 230
232 3300025272 Ga0209455_1000043 Ga0209455_1000043195 230
233 3300046506 Ga0495583_0000040 Ga0495583_0000040_77223_77918 230
234 3300002739 JGI25158J39367_1000382 JGI25158J39367_10003829 231
235 3300002773 JGI25152J39213_1000081 JGI25152J39213_10000816 231
236 3300002774 JGI25150J39212_1000295 JGI25150J39212_100029519 231
237 3300002774 JGI25150J39212_1014105 JGI25150J39212_10141051 231
238 3300002987 JGI25159J45721_1002590 JGI25159J45721_10025903 231
239 3300002987 JGI25159J45721_1017918 JGI25159J45721_10179182 231
240 3300003354 JGI25160J50197_1029563 JGI25160J50197_10295632 231
241 3300003374 JGI25161J50226_1000125 JGI25161J50226_10001256 231
242 3300003771 Ga0055526_1000875 Ga0055526_10008758 231
243 3300003773 Ga0055537_1001114 Ga0055537_10011146 231
244 3300003773 Ga0055537_1004443 Ga0055537_10044432 231
245 3300003775 Ga0055524_1000617 Ga0055524_100061719 231
246 3300003775 Ga0055524_1002007 Ga0055524_10020073 231
247 3300003775 Ga0055524_1005412 Ga0055524_10054124 231
248 3300003784 Ga0055534_1001390 Ga0055534_10013904 231
249 3300003784 Ga0055534_1004479 Ga0055534_10044794 231
250 3300003790 Ga0055528_1032221 Ga0055528_10322212 231
251 3300003791 Ga0055530_10001200 Ga0055530_1000120015 231
252 3300003791 Ga0055530_10003493 Ga0055530_100034936 231
253 3300003791 Ga0055530_10003494 Ga0055530_100034946 231
254 3300003794 Ga0055531_10004191 Ga0055531_100041916 231
255 3300004625 Ga0055543_1000063 Ga0055543_100006333 231
256 3300005262 Ga0065165_1002003 Ga0065165_100200315 231
257 3300021361 Ga0213872_10000072 Ga0213872_1000007252 231
258 3300021361 Ga0213872_10003437 Ga0213872_100034373 231
259 3300021361 Ga0213872_10047554 Ga0213872_100475542 231
260 3300025208 Ga0209436_100056 Ga0209436_10005624 231
261 3300025208 Ga0209436_101153 Ga0209436_1011535 231
262 3300025245 Ga0207425_1000001 Ga0207425_10000011023 231
263 3300025245 Ga0207425_1000039 Ga0207425_1000039138 231
264 3300025258 Ga0209129_1000001 Ga0209129_1000001200 231
265 3300025258 Ga0209129_1002688 Ga0209129_10026884 231
266 3300025263 Ga0209565_1001733 Ga0209565_10017336 231
267 3300025263 Ga0209565_1003077 Ga0209565_10030774 231
268 3300025263 Ga0209565_1010940 Ga0209565_10109402 231
269 3300025263 Ga0209565_1031147 Ga0209565_10311472 231
270 3300025273 Ga0209673_1010925 Ga0209673_10109253 231
271 3300025284 Ga0209130_1000128 Ga0209130_100012873 231
272 3300025284 Ga0209130_1024060 Ga0209130_10240602 231
273 3300025291 Ga0209675_1000620 Ga0209675_100062016 231
274 3300025291 Ga0209675_1011576 Ga0209675_10115763 231
275 3300025295 Ga0209564_1000109 Ga0209564_1000109141 231
276 3300025295 Ga0209564_1035418 Ga0209564_10354182 231
277 3300025295 Ga0209564_1045556 Ga0209564_10455562 231
278 3300025297 Ga0209758_1000020 Ga0209758_1000020253 231
279 3300025298 Ga0209050_1000074 Ga0209050_1000074140 231
280 3300025298 Ga0209050_1000628 Ga0209050_100062841 231
281 3300025298 Ga0209050_1002555 Ga0209050_10025558 231
282 3300025299 Ga0209256_1000028 Ga0209256_1000028226 231
283 3300025299 Ga0209256_1000621 Ga0209256_100062119 231
284 3300025299 Ga0209256_1004772 Ga0209256_10047724 231
285 3300025302 Ga0207426_1002060 Ga0207426_10020603 231
286 3300025304 Ga0209257_1000003 Ga0209257_100000372 231
287 3300025304 Ga0209257_1005394 Ga0209257_10053945 231
288 3300031548 Ga0307408_100000126 Ga0307408_10000012622 231
289 3300031548 Ga0307408_100002939 Ga0307408_1000029398 231
290 3300031548 Ga0307408_100020844 Ga0307408_1000208445 231
291 3300031727 Ga0316576_10129055 Ga0316576_101290552 231
292 3300032002 Ga0307416_100045218 Ga0307416_1000452182 231
293 3300036712 Ga0316584_0033489 Ga0316584_0033489_220_915 231
294 3300039447 Ga0436361_0262860 Ga0436361_0262860_29654_30349 231
295 3300039447 Ga0436361_0897037 Ga0436361_0897037_1137_1832 231
296 3300039447 Ga0436361_1023025 Ga0436361_1023025_2852_3547 231
297 3300039447 Ga0436361_1029820 Ga0436361_1029820_1141_1836 231
298 3300042876 Ga0451577_0016771 Ga0451577_0016771_3557_4252 231
299 3300045051 Ga0451576_0018096 Ga0451576_0018096_457_1152 231
300 3300046615 Ga0495656_0185464 Ga0495656_0185464_227_925 231
301 3300048905 Ga0496102_0000113 Ga0496102_0000113_60818_61516 231
302 3300048906 Ga0496103_0019894 Ga0496103_0019894_284_982 231
303 3300003577 Ga0007416J51690_1036789 Ga0007416J51690_10367891 232
304 3300003775 Ga0055524_1000003 Ga0055524_1000003125 232
305 3300006948 Ga0099826_10000002 Ga0099826_10000002578 232
306 3300025295 Ga0209564_1021787 Ga0209564_10217873 232
307 3300025299 Ga0209256_1000007 Ga0209256_1000007239 232
308 3300027666 Ga0209282_1000001 Ga0209282_1000001575 232
309 3300030745 Ga0316182_1087967 Ga0316182_10879672 232
310 3300037312 Ga0395899_0000127 Ga0395899_0000127_97490_98191 232
311 3300046491 Ga0495584_0000021 Ga0495584_0000021_58903_59631 232
312 3300046491 Ga0495584_0000271 Ga0495584_0000271_4020_4748 232
313 3300046492 Ga0495585_0000005 Ga0495585_0000005_117143_117904 232
314 3300046492 Ga0495585_0000465 Ga0495585_0000465_35330_36058 232
315 3300046492 Ga0495585_0005055 Ga0495585_0005055_7332_8060 232
316 3300046506 Ga0495583_0000189 Ga0495583_0000189_59350_60078 232
317 3300046507 Ga0495606_0010266 Ga0495606_0010266_4222_4950 232
318 3300046513 Ga0495616_0000408 Ga0495616_0000408_16249_17010 232
319 3300046513 Ga0495616_0001960 Ga0495616_0001960_2675_3403 232
320 3300046515 Ga0495620_0101238 Ga0495620_0101238_339_1085 232
321 3300046523 Ga0495644_0015195 Ga0495644_0015195_1125_1853 232
322 3300046524 Ga0495648_0000076 Ga0495648_0000076_11533_12294 232
323 3300046524 Ga0495648_0095746 Ga0495648_0095746_687_1433 232
324 3300046538 Ga0495609_0157162 Ga0495609_0157162_10_738 232
325 3300046542 Ga0495597_0013868 Ga0495597_0013868_882_1583 232
326 3300046557 Ga0495622_0000001 Ga0495622_0000001_89178_89915 232
327 3300046558 Ga0495633_0022937 Ga0495633_0022937_222_950 232
328 3300046616 Ga0495668_0005641 Ga0495668_0005641_4890_5618 232
329 3300046648 Ga0495611_0006968 Ga0495611_0006968_488_1234 232
330 3300046660 Ga0495625_0151329 Ga0495625_0151329_603_1304 232
331 3300046665 Ga0495661_0037246 Ga0495661_0037246_1527_2228 232
332 3300046674 Ga0495588_0006074 Ga0495588_0006074_2912_3625 232
333 3300046691 Ga0495670_0000516 Ga0495670_0000516_15494_16222 232
334 3300046691 Ga0495670_0076351 Ga0495670_0076351_38_739 232
335 3300047323 Ga0495683_0002722 Ga0495683_0002722_4332_5060 232
336 3300048091 Ga0495626_0001542 Ga0495626_0001542_1049_1750 232
337 3300049460 Ga0495682_0095350 Ga0495682_0095350_177_905 232
338 3300049568 Ga0501031_0001088 Ga0501031_0001088_3865_4590 232
339 3300049671 Ga0501238_004162 Ga0501238_004162_609_1310 232
340 3300006177 Ga0075362_10027036 Ga0075362_100270361 233
341 3300025728 Ga0207655_1008947 Ga0207655_10089474 233
342 3300030731 Ga0316177_1080323 Ga0316177_10803232 233
343 3300030744 Ga0316181_1123198 Ga0316181_11231982 233
344 3300046501 Ga0495607_0003191 Ga0495607_0003191_7161_7862 233
345 3300046506 Ga0495583_0038147 Ga0495583_0038147_133_930 233
346 3300046507 Ga0495606_0000614 Ga0495606_0000614_21931_22632 233
347 3300046507 Ga0495606_0000943 Ga0495606_0000943_1514_2215 233
348 3300046507 Ga0495606_0005199 Ga0495606_0005199_7077_7778 233
349 3300046512 Ga0495610_0005631 Ga0495610_0005631_4271_4972 233
350 3300046512 Ga0495610_0011572 Ga0495610_0011572_2693_3394 233
351 3300046512 Ga0495610_0017231 Ga0495610_0017231_2327_3028 233
352 3300046526 Ga0495666_0030288 Ga0495666_0030288_1273_2019 233
353 3300046528 Ga0495642_0030500 Ga0495642_0030500_211_915 233
354 3300046531 Ga0495665_0038121 Ga0495665_0038121_1089_1835 233
355 3300046535 Ga0495586_0052641 Ga0495586_0052641_955_1659 233
356 3300046539 Ga0495621_0074537 Ga0495621_0074537_279_983 233
357 3300046542 Ga0495597_0062651 Ga0495597_0062651_779_1483 233
358 3300046558 Ga0495633_0000117 Ga0495633_0000117_56087_56788 233
359 3300046558 Ga0495633_0003243 Ga0495633_0003243_8988_9689 233
360 3300046558 Ga0495633_0145696 Ga0495633_0145696_297_998 233
361 3300046615 Ga0495656_0001386 Ga0495656_0001386_4516_5220 233
362 3300046660 Ga0495625_0017192 Ga0495625_0017192_1364_2065 233
363 3300046660 Ga0495625_0128045 Ga0495625_0128045_74_820 233
364 3300046663 Ga0495635_0089675 Ga0495635_0089675_725_1429 233
365 3300046664 Ga0495659_0009136 Ga0495659_0009136_1954_2730 233
366 3300046674 Ga0495588_0267621 Ga0495588_0267621_71_775 233
367 3300046674 Ga0495588_0328339 Ga0495588_0328339_10_714 233
368 3300046809 Ga0495600_0270866 Ga0495600_0270866_73_777 233
369 3300047315 Ga0495581_0057142 Ga0495581_0057142_972_1676 233
370 3300047318 Ga0495636_0006158 Ga0495636_0006158_2988_3692 233
371 3300047318 Ga0495636_0060391 Ga0495636_0060391_88_792 233
372 3300047319 Ga0495674_0001458 Ga0495674_0001458_5167_5895 233
373 3300047447 Ga0495685_019344 Ga0495685_019344_1363_2067 233
374 3300047447 Ga0495685_043906 Ga0495685_043906_756_1460 233
375 3300048089 Ga0495614_0264446 Ga0495614_0264446_44_748 233
376 3300048090 Ga0495615_0000350 Ga0495615_0000350_2521_3225 233
377 3300048905 Ga0496102_0098430 Ga0496102_0098430_486_1283 233
378 3300048917 Ga0496114_0044109 Ga0496114_0044109_1730_2431 233
379 3300049766 Ga0501269_000517 Ga0501269_000517_296_997 233
380 3300050489 nmdc:mga03683_28649_c1 nmdc:mga03683_28649_c1_920_1621 233
381 3300050490 nmdc:mga03n38_145703_c1 nmdc:mga03n38_145703_c1_44_745 233
382 3300053145 Ga0500586_001188 Ga0500586_001188_3970_4671 233
383 3300049571 Ga0501034_0158476 Ga0501034_0158476_758_1465 234
384 3300006846 Ga0075430_100130072 Ga0075430_1001300723 235
385 3300031238 Ga0265332_10000006 Ga0265332_10000006144 235
386 3300031711 Ga0265314_10013519 Ga0265314_100135195 235
387 3300031838 Ga0307518_10173305 Ga0307518_101733052 235
388 3300039447 Ga0436361_1185928 Ga0436361_1185928_123557_124264 235
389 3300042876 Ga0451577_0424204 Ga0451577_0424204_431_1144 235
390 3300044712 Ga0453684_0115348 Ga0453684_0115348_692_1402 235
391 3300046452 Ga0495617_003569 Ga0495617_003569_2562_3269 235
392 3300046460 Ga0495638_0005021 Ga0495638_0005021_8071_8778 235
393 3300046471 Ga0495650_0000019 Ga0495650_0000019_201882_202625 235
394 3300046491 Ga0495584_0000298 Ga0495584_0000298_2592_3299 235
395 3300046492 Ga0495585_0100260 Ga0495585_0100260_674_1381 235
396 3300046501 Ga0495607_0074223 Ga0495607_0074223_225_932 235
397 3300046501 Ga0495607_0112484 Ga0495607_0112484_178_885 235
398 3300046506 Ga0495583_0000140 Ga0495583_0000140_2275_2982 235
399 3300046507 Ga0495606_0001972 Ga0495606_0001972_13512_14255 235
400 3300046513 Ga0495616_0068955 Ga0495616_0068955_379_1086 235
401 3300046523 Ga0495644_0000252 Ga0495644_0000252_17616_18323 235
402 3300046523 Ga0495644_0000711 Ga0495644_0000711_6475_7182 235
403 3300046524 Ga0495648_0000257 Ga0495648_0000257_30384_31091 235
404 3300046538 Ga0495609_0002090 Ga0495609_0002090_11030_11737 235
405 3300046542 Ga0495597_0005109 Ga0495597_0005109_4701_5408 235
406 3300046558 Ga0495633_0001137 Ga0495633_0001137_6927_7634 235
407 3300046558 Ga0495633_0006731 Ga0495633_0006731_423_1130 235
408 3300046615 Ga0495656_0075203 Ga0495656_0075203_784_1491 235
409 3300046648 Ga0495611_0010199 Ga0495611_0010199_2404_3111 235
410 3300046648 Ga0495611_0011895 Ga0495611_0011895_2223_2930 235
411 3300046648 Ga0495611_0017048 Ga0495611_0017048_160_867 235
412 3300046660 Ga0495625_0006149 Ga0495625_0006149_9745_10452 235
413 3300046660 Ga0495625_0014540 Ga0495625_0014540_2347_3054 235
414 3300046664 Ga0495659_0000536 Ga0495659_0000536_4065_4772 235
415 3300046665 Ga0495661_0060039 Ga0495661_0060039_25_732 235
416 3300046691 Ga0495670_0003076 Ga0495670_0003076_2328_3035 235
417 3300046692 Ga0495671_0000080 Ga0495671_0000080_21963_22670 235
418 3300046810 Ga0495660_0000053 Ga0495660_0000053_39167_39874 235
419 3300046810 Ga0495660_0103290 Ga0495660_0103290_261_968 235
420 3300047318 Ga0495636_0001107 Ga0495636_0001107_8920_9627 235
421 3300047320 Ga0495672_0000121 Ga0495672_0000121_112894_113601 235
422 3300047320 Ga0495672_0049274 Ga0495672_0049274_199_906 235
423 3300047443 Ga0495687_000368 Ga0495687_000368_11832_12539 235
424 3300047445 Ga0495677_0011576 Ga0495677_0011576_160_867 235
425 3300047445 Ga0495677_0012428 Ga0495677_0012428_2239_2946 235
426 3300047447 Ga0495685_000021 Ga0495685_000021_24237_24944 235
427 3300047469 Ga0495673_0007853 Ga0495673_0007853_1426_2133 235
428 3300047472 Ga0495686_0058497 Ga0495686_0058497_1075_1782 235
429 3300048905 Ga0496102_0099883 Ga0496102_0099883_1136_1846 235
430 3300049459 Ga0495678_003378 Ga0495678_003378_8101_8808 235
431 3300049460 Ga0495682_0000333 Ga0495682_0000333_32218_32925 235
432 3300049460 Ga0495682_0001680 Ga0495682_0001680_4104_4811 235
433 3300050509 nmdc:mga0qj67_105992_c1 nmdc:mga0qj67_105992_c1_406_1116 235
434 2162886007 SwRhRL2b_contig_2064111 SwRhRL2b_0883.00002060 236
435 3300027552 Ga0209982_1029527 Ga0209982_10295271 236
436 3300027614 Ga0209970_1000371 Ga0209970_10003712 236
437 3300027876 Ga0209974_10013287 Ga0209974_100132874 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

71

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

94

186

0.89

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

8

72

0.85

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

117

181

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9873 1 201
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.9865 1 201
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9737 3 197
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9704 1 200
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9681 1 201
ID Description Score Start End Superfamily
4eciA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9896 1 82 3.40.30.10
4ecjB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9713 83 191 1.20.1050.10
af_Q8SSN4_1_92_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9713 2 80 3.40.30.10
4puaA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9699 2 80 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9697 11 71 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N8V2P8-F1-model_v4 Glutathione S-transferase 1.002 1 91 GO:0016740
AF-A0A382V7F7-F1-model_v4 GST N-terminal domain-containing protein 0.999 1 84
AF-A0A433GBL5-F1-model_v4 deleted 0.9982 1 102
AF-A0A6I5RJ42-F1-model_v4 Glutathione S-transferase 0.9924 2 116 GO:0016740
AF-A0A011R784-F1-model_v4 Disulfide-bond oxidoreductase YfcG (EC 1.8.4.-) 0.9922 1 202 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.43 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map