F443800

General Info

Members Datasets Scaffolds Average Seq Length
437 223 874 67

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10001658|Ga0316576_1000165814
Length 64
Sequence MPSKKKATLKITLVRSPIGKQKSQKATVRALGISKLNQTVEQEDSPAIRGMINKVSHLLEVEEA

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
134 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
169 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
179 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
180 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
181 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
182 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
183 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
184 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
185 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
186 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
187 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
188 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
189 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
196 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
197 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
198 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
201 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
202 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
203 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
204 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
211 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
212 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
213 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
216 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
217 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
218 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
219 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
220 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.6
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10001658 3300031727 Bacteria 12188
2 CNAas_1000373 3300000532 Bacteria 4323
3 rootL2_10031109 3300003322 Bacteria 2625
4 Ga0065712_10327962 3300005290 Bacteria 795
5 Ga0065712_10344723 3300005290 Bacteria 795
6 Ga0065715_10119275 3300005293 Bacteria 2291
7 Ga0065715_10359536 3300005293 Bacteria 938
8 Ga0065715_10456168 3300005293 Bacteria 821
9 Ga0065707_10098064 3300005295 Bacteria 3116
10 Ga0070676_10225895 3300005328 Bacteria 1239
11 Ga0070676_10311563 3300005328 Bacteria 1070
12 Ga0070676_10328834 3300005328 Bacteria 1045
13 Ga0070676_10495640 3300005328 Bacteria 866
14 Ga0070676_11044156 3300005328 Bacteria 615
15 Ga0070683_100173911 3300005329 Bacteria 2044
16 Ga0070690_100762494 3300005330 Bacteria 748
17 Ga0070690_101237848 3300005330 Unclassified 596
18 Ga0070670_100131586 3300005331 Bacteria 2161
19 Ga0070670_100158869 3300005331 Bacteria 1959
20 Ga0070670_101237853 3300005331 Unclassified 683
21 Ga0070670_101289757 3300005331 Bacteria 668
22 Ga0070670_101656828 3300005331 Bacteria 588
23 Ga0070670_101870846 3300005331 Unclassified 553
24 Ga0070677_10031127 3300005333 Bacteria 2037
25 Ga0070677_10031159 3300005333 Bacteria 2036
26 Ga0068869_100766437 3300005334 Bacteria 827
27 Ga0070666_11415445 3300005335 Unclassified 519
28 Ga0070680_100026863 3300005336 Bacteria 4605
29 Ga0070682_101270641 3300005337 Bacteria 624
30 Ga0068868_100312647 3300005338 Bacteria 1337
31 Ga0068868_100692479 3300005338 Bacteria 911
32 Ga0068868_101947956 3300005338 Bacteria 557
33 Ga0070689_100052376 3300005340 Bacteria 3157
34 Ga0070661_100705870 3300005344 Bacteria 822
35 Ga0070661_100726611 3300005344 Bacteria 810
36 Ga0070692_10409403 3300005345 Bacteria 858
37 Ga0070692_11302238 3300005345 Bacteria 521
38 Ga0070668_100272893 3300005347 Unclassified 1410
39 Ga0070669_100122580 3300005353 Bacteria 1985
40 Ga0070669_100552520 3300005353 Bacteria 960
41 Ga0070669_101289593 3300005353 Bacteria 632
42 Ga0070675_100114049 3300005354 Bacteria 2290
43 Ga0070675_100192956 3300005354 Bacteria 1765
44 Ga0070675_101158217 3300005354 Bacteria 711
45 Ga0070675_101996529 3300005354 Unclassified 535
46 Ga0070671_100290989 3300005355 Bacteria 1390
47 Ga0070671_100625161 3300005355 Bacteria 931
48 Ga0070674_100490666 3300005356 Bacteria 1021
49 Ga0070673_100049384 3300005364 Bacteria 3285
50 Ga0070673_100135829 3300005364 Bacteria 2070
51 Ga0070673_101102001 3300005364 Bacteria 742
52 Ga0070673_101588022 3300005364 Unclassified 618
53 Ga0070688_100181136 3300005365 Bacteria 1461
54 Ga0070659_100427380 3300005366 Bacteria 1121
55 Ga0070659_101802903 3300005366 Unclassified 548
56 Ga0070667_100192119 3300005367 Bacteria 1809
57 Ga0070667_100825328 3300005367 Bacteria 861
58 Ga0070667_101378756 3300005367 Bacteria 661
59 Ga0070700_101324954 3300005441 Bacteria 606
60 Ga0070678_100087510 3300005456 Bacteria 2379
61 Ga0070662_101223477 3300005457 Bacteria 646
62 Ga0070662_101342305 3300005457 Bacteria 616
63 Ga0070681_10050667 3300005458 Bacteria 4142
64 Ga0068867_100708794 3300005459 Bacteria 889
65 Ga0070685_10010392 3300005466 Bacteria 4835
66 Ga0070706_101284664 3300005467 Bacteria 671
67 Ga0070679_100028695 3300005530 Bacteria 5488
68 Ga0070684_101037428 3300005535 Bacteria 770
69 Ga0068853_100008554 3300005539 Bacteria 8224
70 Ga0068853_100010342 3300005539 Bacteria 7548
71 Ga0070672_100188174 3300005543 Bacteria 1722
72 Ga0070672_100284099 3300005543 Bacteria 1400
73 Ga0070672_100413321 3300005543 Bacteria 1158
74 Ga0070672_100625335 3300005543 Bacteria 939
75 Ga0070672_101651763 3300005543 Unclassified 575
76 Ga0070686_100130660 3300005544 Bacteria 1736
77 Ga0070686_100206579 3300005544 Bacteria 1411
78 Ga0070695_100411025 3300005545 Bacteria 1028
79 Ga0070696_100796575 3300005546 Bacteria 777
80 Ga0070693_100165115 3300005547 Bacteria 1413
81 Ga0070693_101553996 3300005547 Bacteria 518
82 Ga0070704_100049342 3300005549 Bacteria 2953
83 Ga0068855_100349177 3300005563 Bacteria 1630
84 Ga0068855_100669369 3300005563 Bacteria 1113
85 Ga0070664_101616499 3300005564 Bacteria 614
86 Ga0068857_100290266 3300005577 Bacteria 1506
87 Ga0068857_100877072 3300005577 Bacteria 860
88 Ga0068857_101504358 3300005577 Bacteria 656
89 Ga0068857_101744602 3300005577 Bacteria 609
90 Ga0068857_102099895 3300005577 Unclassified 554
91 Ga0068854_100266252 3300005578 Bacteria 1374
92 Ga0068854_101871195 3300005578 Unclassified 551
93 Ga0068856_100278088 3300005614 Bacteria 1691
94 Ga0068852_100157931 3300005616 Bacteria 2114
95 Ga0068852_101505872 3300005616 Unclassified 695
96 Ga0068859_100006290 3300005617 Bacteria 12041
97 Ga0068859_102545058 3300005617 Bacteria 563
98 Ga0068864_100033265 3300005618 Bacteria 4383
99 Ga0068864_100067218 3300005618 Bacteria 3112
100 Ga0068851_10082593 3300005834 Bacteria 1680
101 Ga0068851_10086722 3300005834 Bacteria 1643
102 Ga0068870_10020926 3300005840 Bacteria 3193
103 Ga0068870_10867032 3300005840 Bacteria 635
104 Ga0068863_100135308 3300005841 Bacteria 2354
105 Ga0068863_100841954 3300005841 Bacteria 916
106 Ga0068858_100533296 3300005842 Bacteria 1136
107 Ga0068860_100237523 3300005843 Bacteria 1772
108 Ga0068862_100097130 3300005844 Bacteria 2572
109 Ga0068862_100156148 3300005844 Bacteria 2034
110 Ga0075428_100496895 3300006844 Bacteria 1305
111 Ga0075430_100469804 3300006846 Bacteria 1038
112 Ga0075431_101613148 3300006847 Unclassified 606
113 Ga0097620_100006289 3300006931 Bacteria 12041
114 Ga0097620_102544101 3300006931 Bacteria 563
115 Ga0105240_10095143 3300009093 Bacteria 3632
116 Ga0111539_10034843 3300009094 Bacteria 6099
117 Ga0111539_11883331 3300009094 Unclassified 693
118 Ga0114129_10815122 3300009147 Bacteria 1190
119 Ga0114129_12094297 3300009147 Unclassified 683
120 Ga0114129_12503274 3300009147 Bacteria 617
121 Ga0105241_11242967 3300009174 Unclassified 707
122 Ga0105242_12793573 3300009176 Bacteria 538
123 Ga0105248_10572733 3300009177 Bacteria 1274
124 Ga0105237_10030242 3300009545 Bacteria 5502
125 Ga0105237_11170211 3300009545 Bacteria 776
126 Ga0105249_10003244 3300009553 Bacteria 14094
127 Ga0105249_10900358 3300009553 Bacteria 952
128 Ga0105249_11299458 3300009553 Bacteria 799
129 Ga0105239_10195819 3300010375 Bacteria 2263
130 Ga0157327_1094198 3300012512 Unclassified 502
131 Ga0157373_10021188 3300013100 Bacteria 4719
132 Ga0157373_10093123 3300013100 Bacteria 2122
133 Ga0157373_10150313 3300013100 Bacteria 1638
134 Ga0157370_10056414 3300013104 Bacteria 3739
135 Ga0157369_10123051 3300013105 Bacteria 2752
136 Ga0157374_10017281 3300013296 Bacteria 6349
137 Ga0157374_10495285 3300013296 Bacteria 1226
138 Ga0157378_11680468 3300013297 Bacteria 682
139 Ga0157378_11765338 3300013297 Bacteria 666
140 Ga0157378_12235419 3300013297 Bacteria 598
141 Ga0163162_10198923 3300013306 Bacteria 2132
142 Ga0163162_10245814 3300013306 Bacteria 1921
143 Ga0163162_10327079 3300013306 Bacteria 1666
144 Ga0163162_10758453 3300013306 Bacteria 1089
145 Ga0157372_10030206 3300013307 Bacteria 5926
146 Ga0157372_10175007 3300013307 Bacteria 2484
147 Ga0157372_10192512 3300013307 Bacteria 2362
148 Ga0157375_10412866 3300013308 Bacteria 1516
149 Ga0157375_10430549 3300013308 Bacteria 1485
150 Ga0157375_10626001 3300013308 Bacteria 1234
151 Ga0157375_11019713 3300013308 Bacteria 967
152 Ga0157375_12015356 3300013308 Bacteria 686
153 Ga0163163_10193465 3300014325 Bacteria 2082
154 Ga0163163_13234617 3300014325 Bacteria 508
155 Ga0157380_10000457 3300014326 Bacteria 24958
156 Ga0157380_10041327 3300014326 Bacteria 3598
157 Ga0157380_10093565 3300014326 Bacteria 2485
158 Ga0157380_10664461 3300014326 Bacteria 1042
159 Ga0157380_11373533 3300014326 Bacteria 756
160 Ga0157377_10666337 3300014745 Unclassified 751
161 Ga0157377_11053384 3300014745 Bacteria 620
162 Ga0163161_10531083 3300017792 Bacteria 962
163 Ga0163161_10813458 3300017792 Bacteria 786
164 Ga0207656_10217675 3300025321 Bacteria 927
165 Ga0207682_10020335 3300025893 Bacteria 2606
166 Ga0207682_10279422 3300025893 Bacteria 781
167 Ga0207688_11001888 3300025901 Bacteria 528
168 Ga0207647_10211090 3300025904 Bacteria 1121
169 Ga0207645_10207177 3300025907 Bacteria 1291
170 Ga0207643_10202272 3300025908 Bacteria 1210
171 Ga0207707_10012588 3300025912 Bacteria 7352
172 Ga0207707_11517681 3300025912 Unclassified 530
173 Ga0207695_10107845 3300025913 Bacteria 2770
174 Ga0207671_10101033 3300025914 Bacteria 2185
175 Ga0207660_10022389 3300025917 Bacteria 4257
176 Ga0207649_10095747 3300025920 Bacteria 1954
177 Ga0207649_10143482 3300025920 Bacteria 1637
178 Ga0207652_10468122 3300025921 Bacteria 1135
179 Ga0207652_11778403 3300025921 Bacteria 521
180 Ga0207652_11831284 3300025921 Unclassified 512
181 Ga0207681_10566759 3300025923 Bacteria 936
182 Ga0207650_10020086 3300025925 Bacteria 4706
183 Ga0207650_10162893 3300025925 Bacteria 1768
184 Ga0207650_10576723 3300025925 Bacteria 944
185 Ga0207650_11434295 3300025925 Unclassified 587
186 Ga0207650_11702557 3300025925 Bacteria 534
187 Ga0207659_10110848 3300025926 Bacteria 2086
188 Ga0207659_10168369 3300025926 Bacteria 1727
189 Ga0207659_10281037 3300025926 Bacteria 1361
190 Ga0207659_10578296 3300025926 Bacteria 956
191 Ga0207644_10089080 3300025931 Bacteria 2296
192 Ga0207644_10130068 3300025931 Bacteria 1926
193 Ga0207644_10767804 3300025931 Bacteria 806
194 Ga0207644_10952091 3300025931 Bacteria 720
195 Ga0207690_10134831 3300025932 Bacteria 1812
196 Ga0207690_11316444 3300025932 Bacteria 604
197 Ga0207706_10961491 3300025933 Bacteria 719
198 Ga0207670_10425513 3300025936 Bacteria 1066
199 Ga0207669_11228696 3300025937 Unclassified 635
200 Ga0207669_11380103 3300025937 Unclassified 600
201 Ga0207704_10893492 3300025938 Bacteria 747
202 Ga0207704_11627300 3300025938 Bacteria 555
203 Ga0207691_10007142 3300025940 Bacteria 10778
204 Ga0207691_10090812 3300025940 Bacteria 2737
205 Ga0207691_10426875 3300025940 Bacteria 1129
206 Ga0207691_10471579 3300025940 Bacteria 1067
207 Ga0207691_10650027 3300025940 Bacteria 891
208 Ga0207711_10611882 3300025941 Bacteria 1017
209 Ga0207689_10330241 3300025942 Bacteria 1266
210 Ga0207661_12153503 3300025944 Bacteria 504
211 Ga0207679_10139209 3300025945 Bacteria 1959
212 Ga0207679_10202203 3300025945 Bacteria 1660
213 Ga0207667_10650159 3300025949 Bacteria 1060
214 Ga0207667_10716373 3300025949 Bacteria 1002
215 Ga0207651_10115522 3300025960 Bacteria 2024
216 Ga0207712_10251424 3300025961 Bacteria 1429
217 Ga0207712_10663188 3300025961 Bacteria 908
218 Ga0207668_10156751 3300025972 Bacteria 1770
219 Ga0207668_12030796 3300025972 Bacteria 518
220 Ga0207640_10229534 3300025981 Bacteria 1427
221 Ga0207640_10377011 3300025981 Bacteria 1148
222 Ga0207658_10334266 3300025986 Bacteria 1315
223 Ga0207658_10790644 3300025986 Bacteria 861
224 Ga0207677_10199403 3300026023 Bacteria 1589
225 Ga0207703_10441145 3300026035 Bacteria 1215
226 Ga0207703_10754775 3300026035 Bacteria 927
227 Ga0207639_10007718 3300026041 Bacteria 7346
228 Ga0207639_10061989 3300026041 Bacteria 2890
229 Ga0207678_10096933 3300026067 Bacteria 2520
230 Ga0207708_11794157 3300026075 Bacteria 538
231 Ga0207702_10165241 3300026078 Bacteria 2024
232 Ga0207641_10073232 3300026088 Bacteria 2952
233 Ga0207648_10964400 3300026089 Bacteria 798
234 Ga0207676_10104383 3300026095 Bacteria 2357
235 Ga0207676_10358982 3300026095 Bacteria 1350
236 Ga0207674_10134469 3300026116 Unclassified 2435
237 Ga0207674_10386484 3300026116 Bacteria 1353
238 Ga0207675_100493369 3300026118 Bacteria 1218
239 Ga0207683_10170627 3300026121 Bacteria 1970
240 Ga0207683_10182698 3300026121 Bacteria 1902
241 Ga0207698_10819476 3300026142 Bacteria 934
242 Ga0210002_1102267 3300027617 Unclassified 519
243 Ga0268265_10222950 3300028380 Bacteria 1651
244 Ga0268265_10326910 3300028380 Bacteria 1391
245 Ga0268264_10208939 3300028381 Bacteria 1791
246 Ga0316183_1040507 3300030742 Unclassified 662
247 Ga0316182_1225694 3300030745 Bacteria 816
248 Ga0307513_10016578 3300031456 Bacteria 8880
249 Ga0307408_100001928 3300031548 Bacteria 15077
250 Ga0307408_100066893 3300031548 Bacteria 2641
251 Ga0307408_100107452 3300031548 Bacteria 2137
252 Ga0307408_100129705 3300031548 Bacteria 1965
253 Ga0307408_100327710 3300031548 Bacteria 1292
254 Ga0307408_100359624 3300031548 Bacteria 1238
255 Ga0307408_100398614 3300031548 Bacteria 1181
256 Ga0307408_100857542 3300031548 Unclassified 828
257 Ga0307408_100890385 3300031548 Bacteria 814
258 Ga0316576_10552095 3300031727 Bacteria 844
259 Ga0316578_10261170 3300031728 Unclassified 1038
260 Ga0307405_10002167 3300031731 Bacteria 8576
261 Ga0307405_10055265 3300031731 Bacteria 2484
262 Ga0307405_10076980 3300031731 Bacteria 2166
263 Ga0307405_10255841 3300031731 Unclassified 1305
264 Ga0307405_10266712 3300031731 Bacteria 1282
265 Ga0307405_10332211 3300031731 Bacteria 1165
266 Ga0307405_10398695 3300031731 Bacteria 1076
267 Ga0307405_10406940 3300031731 Bacteria 1067
268 Ga0307405_11547528 3300031731 Bacteria 584
269 Ga0316577_10390628 3300031733 Unclassified 790
270 Ga0307413_10000449 3300031824 Bacteria 13415
271 Ga0307413_10000549 3300031824 Bacteria 12525
272 Ga0307413_10000852 3300031824 Bacteria 10735
273 Ga0307413_10016976 3300031824 Bacteria 3780
274 Ga0307413_10062064 3300031824 Bacteria 2310
275 Ga0307413_10216784 3300031824 Bacteria 1395
276 Ga0307413_10228232 3300031824 Bacteria 1365
277 Ga0307413_11895460 3300031824 Unclassified 535
278 Ga0307410_10000623 3300031852 Bacteria 14609
279 Ga0307410_10001120 3300031852 Bacteria 11726
280 Ga0307410_10003798 3300031852 Bacteria 7666
281 Ga0307410_10014218 3300031852 Bacteria 4676
282 Ga0307410_10016202 3300031852 Bacteria 4439
283 Ga0307410_10148313 3300031852 Bacteria 1743
284 Ga0307410_10985656 3300031852 Unclassified 726
285 Ga0307410_11027984 3300031852 Bacteria 712
286 Ga0307410_11209553 3300031852 Bacteria 658
287 Ga0307406_10006038 3300031901 Bacteria 6653
288 Ga0307406_10010360 3300031901 Bacteria 5255
289 Ga0307406_10036615 3300031901 Bacteria 3025
290 Ga0307406_10284588 3300031901 Unclassified 1263
291 Ga0307406_10408625 3300031901 Unclassified 1078
292 Ga0307406_10444114 3300031901 Bacteria 1039
293 Ga0307406_10835150 3300031901 Unclassified 780
294 Ga0307406_10871493 3300031901 Bacteria 765
295 Ga0307406_10951958 3300031901 Bacteria 734
296 Ga0307407_10001031 3300031903 Bacteria 9619
297 Ga0307407_10001139 3300031903 Bacteria 9316
298 Ga0307407_10002077 3300031903 Bacteria 7673
299 Ga0307407_10129596 3300031903 Bacteria 1611
300 Ga0307407_10229047 3300031903 Bacteria 1261
301 Ga0307407_10940006 3300031903 Bacteria 665
302 Ga0307412_10017627 3300031911 Bacteria 4276
303 Ga0307412_10017949 3300031911 Bacteria 4245
304 Ga0307412_10429367 3300031911 Bacteria 1083
305 Ga0307412_12098566 3300031911 Unclassified 525
306 Ga0307409_100003195 3300031995 Bacteria 8813
307 Ga0307409_100056100 3300031995 Bacteria 3045
308 Ga0307409_100086024 3300031995 Bacteria 2557
309 Ga0307409_100134714 3300031995 Bacteria 2117
310 Ga0307409_100217607 3300031995 Bacteria 1722
311 Ga0307409_100225738 3300031995 Bacteria 1694
312 Ga0307409_100295024 3300031995 Bacteria 1505
313 Ga0307409_100332590 3300031995 Bacteria 1426
314 Ga0307409_100418514 3300031995 Bacteria 1285
315 Ga0307409_101495352 3300031995 Bacteria 703
316 Ga0307409_101498757 3300031995 Unclassified 702
317 Ga0307409_102277891 3300031995 Bacteria 571
318 Ga0307416_100004739 3300032002 Bacteria 8252
319 Ga0307416_100022413 3300032002 Bacteria 4559
320 Ga0307416_100046255 3300032002 Bacteria 3433
321 Ga0307416_100145622 3300032002 Bacteria 2162
322 Ga0307416_100320318 3300032002 Bacteria 1552
323 Ga0307416_100413814 3300032002 Unclassified 1390
324 Ga0307416_100920673 3300032002 Bacteria 975
325 Ga0307416_102496303 3300032002 Unclassified 615
326 Ga0307416_102698001 3300032002 Unclassified 593
327 Ga0307416_102811716 3300032002 Bacteria 582
328 Ga0307416_103429456 3300032002 Unclassified 530
329 Ga0307414_10006487 3300032004 Bacteria 6524
330 Ga0307414_10034819 3300032004 Bacteria 3344
331 Ga0307414_10258466 3300032004 Bacteria 1452
332 Ga0307414_10635286 3300032004 Bacteria 961
333 Ga0307414_11284571 3300032004 Bacteria 679
334 Ga0307414_11456645 3300032004 Bacteria 637
335 Ga0307411_10005572 3300032005 Bacteria 6202
336 Ga0307411_10027961 3300032005 Bacteria 3421
337 Ga0307411_10082770 3300032005 Bacteria 2214
338 Ga0307411_10132603 3300032005 Bacteria 1824
339 Ga0307411_10534703 3300032005 Bacteria 997
340 Ga0307415_100002548 3300032126 Bacteria 9112
341 Ga0307415_100008779 3300032126 Bacteria 5625
342 Ga0307415_100017935 3300032126 Bacteria 4259
343 Ga0307415_100077857 3300032126 Unclassified 2356
344 Ga0307415_100258993 3300032126 Bacteria 1418
345 Ga0307415_100558448 3300032126 Bacteria 1012
346 Ga0307415_101308169 3300032126 Bacteria 687
347 Ga0307415_101584394 3300032126 Bacteria 629
348 Ga0307415_101758605 3300032126 Unclassified 599
349 Ga0316593_10000072 3300032168 Bacteria 12236
350 Ga0316593_10001454 3300032168 Bacteria 5230
351 Ga0316592_1001107 3300033524 Bacteria 4211
352 Ga0316588_1062751 3300033528 Unclassified 907
353 Ga0316596_1000126 3300033541 Bacteria 10161
354 Ga0316596_1232349 3300033541 Unclassified 518
355 Ga0316574_0007743 3300035398 Bacteria 5910
356 Ga0316584_0092821 3300036712 Unclassified 2260
357 Ga0395901_0690739 3300038443 Unclassified 1019
358 Ga0436365_1816203 3300039437 Bacteria 907
359 Ga0439466_0139365 3300041411 Bacteria 745
360 Ga0439465_0417041 3300041413 Bacteria 512
361 Ga0451791_0424851 3300041451 Bacteria 592
362 Ga0451802_0454777 3300041460 Bacteria 748
363 Ga0451807_2012440 3300041486 Unclassified 559
364 Ga0451845_0582635 3300041501 Bacteria 814
365 Ga0451843_1288918 3300041509 Bacteria 705
366 Ga0451853_2498370 3300041512 Bacteria 777
367 Ga0439445_0147362 3300042004 Bacteria 684
368 Ga0439432_024278 3300042006 Bacteria 1993
369 Ga0439432_242319 3300042006 Unclassified 518
370 Ga0450923_068691 3300042125 Unclassified 783
371 Ga0450890_037878 3300042127 Bacteria 706
372 Ga0439446_0045800 3300042156 Bacteria 1298
373 Ga0439444_0082391 3300042437 Bacteria 706
374 Ga0495668_0002148 3300046616 Bacteria 16955
375 Ga0495668_0551131 3300046616 Bacteria 636
376 Ga0496109_0062398 3300048912 Bacteria 3408
377 Ga0496110_0339369 3300048913 Bacteria 1369
378 Ga0496110_1536257 3300048913 Bacteria 576
379 Ga0496113_1452769 3300048916 Bacteria 530
380 Ga0501307_032813 3300049162 Unclassified 727
381 Ga0501292_032563 3300049515 Bacteria 880
382 Ga0501295_150759 3300049518 Bacteria 574
383 Ga0501296_007672 3300049519 Bacteria 1240
384 Ga0501297_006064 3300049520 Bacteria 1282
385 Ga0501298_019550 3300049521 Bacteria 1255
386 Ga0501299_082707 3300049522 Bacteria 716
387 Ga0501199_033556 3300049650 Bacteria 642
388 Ga0501201_040449 3300049651 Bacteria 559
389 Ga0501202_032472 3300049652 Bacteria 1096
390 Ga0501206_019486 3300049653 Bacteria 960
391 Ga0501207_035642 3300049654 Bacteria 851
392 Ga0501209_011489 3300049656 Bacteria 1856
393 Ga0501216_006230 3300049660 Bacteria 1824
394 Ga0501217_024288 3300049661 Bacteria 1449
395 Ga0501223_023079 3300049663 Bacteria 1214
396 Ga0501224_017858 3300049664 Bacteria 1056
397 Ga0501233_086598 3300049668 Bacteria 813
398 Ga0501235_020768 3300049669 Bacteria 1458
399 Ga0501235_162549 3300049669 Bacteria 585
400 Ga0501236_068201 3300049670 Bacteria 645
401 Ga0501236_120605 3300049670 Unclassified 532
402 Ga0501239_000255 3300049672 Bacteria 3838
403 Ga0501240_078547 3300049673 Unclassified 608
404 Ga0501242_016872 3300049674 Bacteria 917
405 Ga0501243_019433 3300049675 Bacteria 1113
406 Ga0501246_021167 3300049676 Bacteria 674
407 Ga0501247_001459 3300049677 Bacteria 2287
408 Ga0501247_069460 3300049677 Unclassified 554
409 Ga0501249_004335 3300049679 Bacteria 2880
410 Ga0501249_204766 3300049679 Unclassified 519
411 Ga0501253_005415 3300049683 Bacteria 1673
412 Ga0501255_012675 3300049684 Bacteria 992
413 Ga0501257_004388 3300049686 Bacteria 3079
414 Ga0501257_005537 3300049686 Bacteria 2787
415 Ga0501259_141951 3300049688 Unclassified 588
416 Ga0501261_123328 3300049690 Bacteria 515
417 Ga0501221_104272 3300049704 Bacteria 707
418 Ga0501221_158417 3300049704 Bacteria 605
419 Ga0501225_0022084 3300049705 Bacteria 1757
420 Ga0501225_0240158 3300049705 Bacteria 591
421 Ga0501225_0279232 3300049705 Unclassified 559
422 Ga0501229_089276 3300049706 Unclassified 501
423 Ga0501262_097485 3300049759 Unclassified 503
424 Ga0501263_000291 3300049760 Bacteria 3418
425 Ga0501263_004992 3300049760 Bacteria 1484
426 Ga0501267_061312 3300049764 Bacteria 509
427 Ga0501268_120851 3300049765 Unclassified 580
428 Ga0501270_029523 3300049767 Unclassified 895
429 Ga0501273_002356 3300049770 Bacteria 1915
430 Ga0501276_028392 3300049773 Unclassified 573
431 Ga0501278_013548 3300049774 Bacteria 684
432 Ga0501280_114089 3300049776 Bacteria 530
433 Ga0501204_007166 3300049850 Bacteria 1251
434 nmdc:mga05p37_1462457_c1 3300050507 Unclassified 683
435 nmdc:mga05p37_1728407_c1 3300050507 Unclassified 608
436 nmdc:mga08y16_257549_c1 3300050511 Bacteria 1802
437 Ga0500568_0055223 3300053139 Bacteria 1551
438 Ga0316576_10001658
439 CNAas_1000373
440 rootL2_10031109
441 Ga0065712_10327962
442 Ga0065712_10344723
443 Ga0065715_10119275
444 Ga0065715_10359536
445 Ga0065715_10456168
446 Ga0065707_10098064
447 Ga0070676_10225895
448 Ga0070676_10311563
449 Ga0070676_10328834
450 Ga0070676_10495640
451 Ga0070676_11044156
452 Ga0070683_100173911
453 Ga0070690_100762494
454 Ga0070690_101237848
455 Ga0070670_100131586
456 Ga0070670_100158869
457 Ga0070670_101237853
458 Ga0070670_101289757
459 Ga0070670_101656828
460 Ga0070670_101870846
461 Ga0070677_10031127
462 Ga0070677_10031159
463 Ga0068869_100766437
464 Ga0070666_11415445
465 Ga0070680_100026863
466 Ga0070682_101270641
467 Ga0068868_100312647
468 Ga0068868_100692479
469 Ga0068868_101947956
470 Ga0070689_100052376
471 Ga0070661_100705870
472 Ga0070661_100726611
473 Ga0070692_10409403
474 Ga0070692_11302238
475 Ga0070668_100272893
476 Ga0070669_100122580
477 Ga0070669_100552520
478 Ga0070669_101289593
479 Ga0070675_100114049
480 Ga0070675_100192956
481 Ga0070675_101158217
482 Ga0070675_101996529
483 Ga0070671_100290989
484 Ga0070671_100625161
485 Ga0070674_100490666
486 Ga0070673_100049384
487 Ga0070673_100135829
488 Ga0070673_101102001
489 Ga0070673_101588022
490 Ga0070688_100181136
491 Ga0070659_100427380
492 Ga0070659_101802903
493 Ga0070667_100192119
494 Ga0070667_100825328
495 Ga0070667_101378756
496 Ga0070700_101324954
497 Ga0070678_100087510
498 Ga0070662_101223477
499 Ga0070662_101342305
500 Ga0070681_10050667
501 Ga0068867_100708794
502 Ga0070685_10010392
503 Ga0070706_101284664
504 Ga0070679_100028695
505 Ga0070684_101037428
506 Ga0068853_100008554
507 Ga0068853_100010342
508 Ga0070672_100188174
509 Ga0070672_100284099
510 Ga0070672_100413321
511 Ga0070672_100625335
512 Ga0070672_101651763
513 Ga0070686_100130660
514 Ga0070686_100206579
515 Ga0070695_100411025
516 Ga0070696_100796575
517 Ga0070693_100165115
518 Ga0070693_101553996
519 Ga0070704_100049342
520 Ga0068855_100349177
521 Ga0068855_100669369
522 Ga0070664_101616499
523 Ga0068857_100290266
524 Ga0068857_100877072
525 Ga0068857_101504358
526 Ga0068857_101744602
527 Ga0068857_102099895
528 Ga0068854_100266252
529 Ga0068854_101871195
530 Ga0068856_100278088
531 Ga0068852_100157931
532 Ga0068852_101505872
533 Ga0068859_100006290
534 Ga0068859_102545058
535 Ga0068864_100033265
536 Ga0068864_100067218
537 Ga0068851_10082593
538 Ga0068851_10086722
539 Ga0068870_10020926
540 Ga0068870_10867032
541 Ga0068863_100135308
542 Ga0068863_100841954
543 Ga0068858_100533296
544 Ga0068860_100237523
545 Ga0068862_100097130
546 Ga0068862_100156148
547 Ga0075428_100496895
548 Ga0075430_100469804
549 Ga0075431_101613148
550 Ga0097620_100006289
551 Ga0097620_102544101
552 Ga0105240_10095143
553 Ga0111539_10034843
554 Ga0111539_11883331
555 Ga0114129_10815122
556 Ga0114129_12094297
557 Ga0114129_12503274
558 Ga0105241_11242967
559 Ga0105242_12793573
560 Ga0105248_10572733
561 Ga0105237_10030242
562 Ga0105237_11170211
563 Ga0105249_10003244
564 Ga0105249_10900358
565 Ga0105249_11299458
566 Ga0105239_10195819
567 Ga0157327_1094198
568 Ga0157373_10021188
569 Ga0157373_10093123
570 Ga0157373_10150313
571 Ga0157370_10056414
572 Ga0157369_10123051
573 Ga0157374_10017281
574 Ga0157374_10495285
575 Ga0157378_11680468
576 Ga0157378_11765338
577 Ga0157378_12235419
578 Ga0163162_10198923
579 Ga0163162_10245814
580 Ga0163162_10327079
581 Ga0163162_10758453
582 Ga0157372_10030206
583 Ga0157372_10175007
584 Ga0157372_10192512
585 Ga0157375_10412866
586 Ga0157375_10430549
587 Ga0157375_10626001
588 Ga0157375_11019713
589 Ga0157375_12015356
590 Ga0163163_10193465
591 Ga0163163_13234617
592 Ga0157380_10000457
593 Ga0157380_10041327
594 Ga0157380_10093565
595 Ga0157380_10664461
596 Ga0157380_11373533
597 Ga0157377_10666337
598 Ga0157377_11053384
599 Ga0163161_10531083
600 Ga0163161_10813458
601 Ga0207656_10217675
602 Ga0207682_10020335
603 Ga0207682_10279422
604 Ga0207688_11001888
605 Ga0207647_10211090
606 Ga0207645_10207177
607 Ga0207643_10202272
608 Ga0207707_10012588
609 Ga0207707_11517681
610 Ga0207695_10107845
611 Ga0207671_10101033
612 Ga0207660_10022389
613 Ga0207649_10095747
614 Ga0207649_10143482
615 Ga0207652_10468122
616 Ga0207652_11778403
617 Ga0207652_11831284
618 Ga0207681_10566759
619 Ga0207650_10020086
620 Ga0207650_10162893
621 Ga0207650_10576723
622 Ga0207650_11434295
623 Ga0207650_11702557
624 Ga0207659_10110848
625 Ga0207659_10168369
626 Ga0207659_10281037
627 Ga0207659_10578296
628 Ga0207644_10089080
629 Ga0207644_10130068
630 Ga0207644_10767804
631 Ga0207644_10952091
632 Ga0207690_10134831
633 Ga0207690_11316444
634 Ga0207706_10961491
635 Ga0207670_10425513
636 Ga0207669_11228696
637 Ga0207669_11380103
638 Ga0207704_10893492
639 Ga0207704_11627300
640 Ga0207691_10007142
641 Ga0207691_10090812
642 Ga0207691_10426875
643 Ga0207691_10471579
644 Ga0207691_10650027
645 Ga0207711_10611882
646 Ga0207689_10330241
647 Ga0207661_12153503
648 Ga0207679_10139209
649 Ga0207679_10202203
650 Ga0207667_10650159
651 Ga0207667_10716373
652 Ga0207651_10115522
653 Ga0207712_10251424
654 Ga0207712_10663188
655 Ga0207668_10156751
656 Ga0207668_12030796
657 Ga0207640_10229534
658 Ga0207640_10377011
659 Ga0207658_10334266
660 Ga0207658_10790644
661 Ga0207677_10199403
662 Ga0207703_10441145
663 Ga0207703_10754775
664 Ga0207639_10007718
665 Ga0207639_10061989
666 Ga0207678_10096933
667 Ga0207708_11794157
668 Ga0207702_10165241
669 Ga0207641_10073232
670 Ga0207648_10964400
671 Ga0207676_10104383
672 Ga0207676_10358982
673 Ga0207674_10134469
674 Ga0207674_10386484
675 Ga0207675_100493369
676 Ga0207683_10170627
677 Ga0207683_10182698
678 Ga0207698_10819476
679 Ga0210002_1102267
680 Ga0268265_10222950
681 Ga0268265_10326910
682 Ga0268264_10208939
683 Ga0316183_1040507
684 Ga0316182_1225694
685 Ga0307513_10016578
686 Ga0307408_100001928
687 Ga0307408_100066893
688 Ga0307408_100107452
689 Ga0307408_100129705
690 Ga0307408_100327710
691 Ga0307408_100359624
692 Ga0307408_100398614
693 Ga0307408_100857542
694 Ga0307408_100890385
695 Ga0316576_10552095
696 Ga0316578_10261170
697 Ga0307405_10002167
698 Ga0307405_10055265
699 Ga0307405_10076980
700 Ga0307405_10255841
701 Ga0307405_10266712
702 Ga0307405_10332211
703 Ga0307405_10398695
704 Ga0307405_10406940
705 Ga0307405_11547528
706 Ga0316577_10390628
707 Ga0307413_10000449
708 Ga0307413_10000549
709 Ga0307413_10000852
710 Ga0307413_10016976
711 Ga0307413_10062064
712 Ga0307413_10216784
713 Ga0307413_10228232
714 Ga0307413_11895460
715 Ga0307410_10000623
716 Ga0307410_10001120
717 Ga0307410_10003798
718 Ga0307410_10014218
719 Ga0307410_10016202
720 Ga0307410_10148313
721 Ga0307410_10985656
722 Ga0307410_11027984
723 Ga0307410_11209553
724 Ga0307406_10006038
725 Ga0307406_10010360
726 Ga0307406_10036615
727 Ga0307406_10284588
728 Ga0307406_10408625
729 Ga0307406_10444114
730 Ga0307406_10835150
731 Ga0307406_10871493
732 Ga0307406_10951958
733 Ga0307407_10001031
734 Ga0307407_10001139
735 Ga0307407_10002077
736 Ga0307407_10129596
737 Ga0307407_10229047
738 Ga0307407_10940006
739 Ga0307412_10017627
740 Ga0307412_10017949
741 Ga0307412_10429367
742 Ga0307412_12098566
743 Ga0307409_100003195
744 Ga0307409_100056100
745 Ga0307409_100086024
746 Ga0307409_100134714
747 Ga0307409_100217607
748 Ga0307409_100225738
749 Ga0307409_100295024
750 Ga0307409_100332590
751 Ga0307409_100418514
752 Ga0307409_101495352
753 Ga0307409_101498757
754 Ga0307409_102277891
755 Ga0307416_100004739
756 Ga0307416_100022413
757 Ga0307416_100046255
758 Ga0307416_100145622
759 Ga0307416_100320318
760 Ga0307416_100413814
761 Ga0307416_100920673
762 Ga0307416_102496303
763 Ga0307416_102698001
764 Ga0307416_102811716
765 Ga0307416_103429456
766 Ga0307414_10006487
767 Ga0307414_10034819
768 Ga0307414_10258466
769 Ga0307414_10635286
770 Ga0307414_11284571
771 Ga0307414_11456645
772 Ga0307411_10005572
773 Ga0307411_10027961
774 Ga0307411_10082770
775 Ga0307411_10132603
776 Ga0307411_10534703
777 Ga0307415_100002548
778 Ga0307415_100008779
779 Ga0307415_100017935
780 Ga0307415_100077857
781 Ga0307415_100258993
782 Ga0307415_100558448
783 Ga0307415_101308169
784 Ga0307415_101584394
785 Ga0307415_101758605
786 Ga0316593_10000072
787 Ga0316593_10001454
788 Ga0316592_1001107
789 Ga0316588_1062751
790 Ga0316596_1000126
791 Ga0316596_1232349
792 Ga0316574_0007743
793 Ga0316584_0092821
794 Ga0395901_0690739
795 Ga0436365_1816203
796 Ga0439466_0139365
797 Ga0439465_0417041
798 Ga0451791_0424851
799 Ga0451802_0454777
800 Ga0451807_2012440
801 Ga0451845_0582635
802 Ga0451843_1288918
803 Ga0451853_2498370
804 Ga0439445_0147362
805 Ga0439432_024278
806 Ga0439432_242319
807 Ga0450923_068691
808 Ga0450890_037878
809 Ga0439446_0045800
810 Ga0439444_0082391
811 Ga0495668_0002148
812 Ga0495668_0551131
813 Ga0496109_0062398
814 Ga0496110_0339369
815 Ga0496110_1536257
816 Ga0496113_1452769
817 Ga0501307_032813
818 Ga0501292_032563
819 Ga0501295_150759
820 Ga0501296_007672
821 Ga0501297_006064
822 Ga0501298_019550
823 Ga0501299_082707
824 Ga0501199_033556
825 Ga0501201_040449
826 Ga0501202_032472
827 Ga0501206_019486
828 Ga0501207_035642
829 Ga0501209_011489
830 Ga0501216_006230
831 Ga0501217_024288
832 Ga0501223_023079
833 Ga0501224_017858
834 Ga0501233_086598
835 Ga0501235_020768
836 Ga0501235_162549
837 Ga0501236_068201
838 Ga0501236_120605
839 Ga0501239_000255
840 Ga0501240_078547
841 Ga0501242_016872
842 Ga0501243_019433
843 Ga0501246_021167
844 Ga0501247_001459
845 Ga0501247_069460
846 Ga0501249_004335
847 Ga0501249_204766
848 Ga0501253_005415
849 Ga0501255_012675
850 Ga0501257_004388
851 Ga0501257_005537
852 Ga0501259_141951
853 Ga0501261_123328
854 Ga0501221_104272
855 Ga0501221_158417
856 Ga0501225_0022084
857 Ga0501225_0240158
858 Ga0501225_0279232
859 Ga0501229_089276
860 Ga0501262_097485
861 Ga0501263_000291
862 Ga0501263_004992
863 Ga0501267_061312
864 Ga0501268_120851
865 Ga0501270_029523
866 Ga0501273_002356
867 Ga0501276_028392
868 Ga0501278_013548
869 Ga0501280_114089
870 Ga0501204_007166
871 nmdc:mga05p37_1462457_c1
872 nmdc:mga05p37_1728407_c1
873 nmdc:mga08y16_257549_c1
874 Ga0500568_0055223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

9

59

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.8839 12 68
8qpp-assembly1.cif.gz_x bacillus subtilis muts2-collided disome complex (stalled 70s) 0.8812 12 68
6ppf-assembly1.cif.gz_Z bacterial 45srbga ribosomal particle class b 0.8809 12 68
4wf9-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin 0.8771 12 68
7s9u-assembly1.cif.gz_Z 44sr3c ribosomal particle 0.8758 12 68
ID Description Score Start End Superfamily
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8839 12 68 3.30.1390.20
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.875 12 68 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8716 12 68 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8701 12 68 3.30.1390.20
af_I1L1F3_83_188_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8701 14 68 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A7C4FT27-F1-model_v4 Large ribosomal subunit protein uL30 0.9109 9 68 GO:0003735
GO:0006412
GO:0022625
AF-A0A4Q0T147-F1-model_v4 Large ribosomal subunit protein uL30 0.9092 12 68 GO:0003735
GO:0006412
GO:0022625
AF-A0A5B9EEZ4-F1-model_v4 Large ribosomal subunit protein uL30 0.9079 12 68 GO:0003735
GO:0006412
GO:0022625
AF-C7LKI6-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] 0.9073 13 68 GO:0003735
GO:0006412
GO:0015934
GO:0015935
GO:0019843
AF-A0A831WVV1-F1-model_v4 Large ribosomal subunit protein uL30 0.9067 9 68 GO:0003735
GO:0006412
GO:0022625

Map