F443575

General Info

Members Datasets Scaffolds Average Seq Length
436 315 357 155

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10652572|Ga0207669_106525722
Length 189
Sequence MLLMADDVGSPTRTLDIHGIYRLLPHRPPFLMVDRIKDIDGDNFAIGIKNVTANEPFFAGHFPEMPIMPGVLLIEGMAQTAGAICILSRGRSRPGVVYFMTIDDAKFRKPVTPGDTVEYHVRKIRNRGRVWRFYGEARVDGKIAAEAEVSAMLADTSEARAFAAGKQAPRKALVVWWDVSAVGIRFDDK

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
6 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
7 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
8 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
9 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
10 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
11 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
12 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
13 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
14 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
17 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
18 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
19 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
20 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
21 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
22 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
23 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
24 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
25 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
26 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
27 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
28 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
29 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
30 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
31 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
32 2643221688 Rhizobium sp. Root482 Isolate Unclassified
33 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
34 2643221718 Rhizobium sp. Root268 Isolate Unclassified
35 2643221719 Rhizobium sp. Root274 Isolate Unclassified
36 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
37 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
38 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
39 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
40 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
41 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
42 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
43 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
44 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
45 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
46 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
47 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
48 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
49 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
50 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
51 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
52 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
53 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
54 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
55 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
56 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
57 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
58 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
59 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
60 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
61 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
62 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
63 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
64 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
65 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
66 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
67 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
68 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
69 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
70 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
71 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
72 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
73 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
74 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
79 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
80 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
84 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
95 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
128 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
129 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
299 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
302 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
307 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
308 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
309 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
310 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
311 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
312 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
313 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
314 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
315 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.65
Metatranscriptomes 0.23
Isolates 18.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.01
Nodule 7.57
Rhizoplane 5.73
Rhizosphere 58.94
Stem 0
Stem Tuber 0
Unclassified 16.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000011 3300002704 Bacteria 207685
2 JGI25156J39149_1000027 3300002705 Bacteria 127396
3 JGI25156J39149_1000030 3300002705 Bacteria 126029
4 JGI25162J39368_1002899 3300002737 Bacteria 5852
5 JGI25162J39368_1002900 3300002737 Bacteria 5852
6 JGI25154J39366_1000057 3300002738 Bacteria 110584
7 JGI25157J39369_1000010 3300002741 Bacteria 207685
8 JGI25152J39213_1004312 3300002773 Bacteria 4528
9 JGI25159J45721_1001890 3300002987 Bacteria 8367
10 JGI25151J46595_10001641 3300003187 Bacteria 14725
11 JGI25151J46595_10057293 3300003187 Bacteria 1271
12 JGI25165J46597_1002487 3300003214 Bacteria 5852
13 JGI25165J46597_1002504 3300003214 Bacteria 5822
14 JGI25165J46597_1011180 3300003214 Bacteria 1288
15 rootH1_10106418 3300003316 Bacteria 1987
16 rootH2_10177198 3300003320 Bacteria 3068
17 rootL2_10001766 3300003322 Bacteria 1633
18 rootL2_10001767 3300003322 Bacteria 11648
19 JGI25160J50197_1000004 3300003354 Bacteria 419797
20 JGI25161J50226_1000003 3300003374 Bacteria 413345
21 Ga0055526_1021905 3300003771 Bacteria 2199
22 Ga0055524_1011436 3300003775 Bacteria 3471
23 Ga0055528_1001889 3300003790 Bacteria 11931
24 Ga0055543_1000001 3300004625 Bacteria 419949
25 Ga0065165_1000049 3300005262 Bacteria 195588
26 Ga0065165_1015257 3300005262 Bacteria 2938
27 Ga0070658_10305979 3300005327 Bacteria 1356
28 Ga0070660_100944264 3300005339 Bacteria 728
29 Ga0070689_100309887 3300005340 Bacteria 1316
30 Ga0070669_100884344 3300005353 Bacteria 762
31 Ga0070667_100203072 3300005367 Bacteria 1759
32 Ga0070714_100139185 3300005435 Bacteria 2176
33 Ga0070714_100227002 3300005435 Bacteria 1719
34 Ga0070710_10166205 3300005437 Bacteria 1372
35 Ga0070710_11037716 3300005437 Bacteria 599
36 Ga0070681_10424116 3300005458 Bacteria 1242
37 Ga0070679_100092935 3300005530 Bacteria 3004
38 Ga0068853_101370050 3300005539 Bacteria 684
39 Ga0070665_100019094 3300005548 Bacteria 6877
40 Ga0068854_100023587 3300005578 Bacteria 4205
41 Ga0068856_100140755 3300005614 Bacteria 2420
42 Ga0068856_100294104 3300005614 Bacteria 1641
43 Ga0068852_100035348 3300005616 Bacteria 4167
44 Ga0068864_102378626 3300005618 Bacteria 536
45 Ga0068851_10191441 3300005834 Bacteria 1137
46 Ga0075364_10426046 3300006051 Bacteria 906
47 Ga0070712_101428151 3300006175 Bacteria 604
48 Ga0075370_10007141 3300006353 Bacteria 5671
49 Ga0075428_100002909 3300006844 Bacteria 18640
50 Ga0075430_100020618 3300006846 Bacteria 5607
51 Ga0075431_100000417 3300006847 Bacteria 34661
52 Ga0075433_10312413 3300006852 Bacteria 1391
53 Ga0075434_100100936 3300006871 Bacteria 2892
54 Ga0075429_100004216 3300006880 Bacteria 12312
55 Ga0075436_100339638 3300006914 Bacteria 1081
56 Ga0105240_10000005 3300009093 Bacteria 702630
57 Ga0111539_10004674 3300009094 Bacteria 17895
58 Ga0105245_11069739 3300009098 Bacteria 852
59 Ga0114129_10002339 3300009147 Bacteria 26307
60 Ga0105243_10678284 3300009148 Bacteria 1002
61 Ga0105237_10002240 3300009545 Bacteria 24098
62 Ga0105239_10000739 3300010375 Bacteria 46483
63 Ga0157370_10006233 3300013104 Bacteria 13211
64 Ga0157370_10551852 3300013104 Bacteria 1056
65 Ga0157369_10232742 3300013105 Bacteria 1926
66 Ga0157372_10741426 3300013307 Bacteria 1142
67 Ga0163163_10007735 3300014325 Bacteria 9497
68 Ga0182007_10001732 3300015262 Bacteria 11483
69 Ga0214544_1000024 3300021320 Bacteria 163562
70 Ga0214542_1000015 3300021321 Bacteria 227912
71 Ga0214542_1026314 3300021321 Bacteria 2863
72 Ga0214543_1000011 3300021327 Bacteria 344093
73 Ga0214543_1000032 3300021327 Bacteria 200766
74 Ga0209435_100022 3300025206 Bacteria 207766
75 Ga0209437_100160 3300025233 Bacteria 149451
76 Ga0209437_100310 3300025233 Bacteria 65905
77 Ga0209646_1000078 3300025246 Bacteria 207766
78 Ga0209026_1000065 3300025250 Bacteria 207766
79 Ga0209677_100545 3300025253 Bacteria 20941
80 Ga0209148_1006730 3300025254 Bacteria 2460
81 Ga0209759_1000055 3300025256 Bacteria 207766
82 Ga0209759_1013023 3300025256 Bacteria 2271
83 Ga0209129_1000349 3300025258 Bacteria 38942
84 Ga0209233_1000168 3300025261 Bacteria 149312
85 Ga0209233_1000303 3300025261 Bacteria 59138
86 Ga0209233_1000594 3300025261 Bacteria 18858
87 Ga0209233_1039512 3300025261 Bacteria 1033
88 Ga0209673_1000068 3300025273 Bacteria 245891
89 Ga0209130_1000012 3300025284 Bacteria 421329
90 Ga0209676_1040587 3300025292 Bacteria 1309
91 Ga0209025_1000320 3300025294 Bacteria 106773
92 Ga0209025_1000949 3300025294 Bacteria 43938
93 Ga0209564_1070581 3300025295 Bacteria 728
94 Ga0209758_1023693 3300025297 Bacteria 2766
95 Ga0209758_1063642 3300025297 Bacteria 1200
96 Ga0209256_1002171 3300025299 Bacteria 16856
97 Ga0209256_1032466 3300025299 Bacteria 1415
98 Ga0207426_1000010 3300025302 Bacteria 796003
99 Ga0209257_1035464 3300025304 Bacteria 1544
100 Ga0207656_10181827 3300025321 Bacteria 1009
101 Ga0207692_10436109 3300025898 Bacteria 822
102 Ga0207705_10754121 3300025909 Bacteria 756
103 Ga0207707_10263055 3300025912 Bacteria 1497
104 Ga0207707_10418804 3300025912 Bacteria 1149
105 Ga0207695_10000011 3300025913 Bacteria 910221
106 Ga0207671_10001291 3300025914 Bacteria 29425
107 Ga0207652_10109673 3300025921 Bacteria 2447
108 Ga0207652_10189902 3300025921 Bacteria 1848
109 Ga0207681_11720625 3300025923 Bacteria 524
110 Ga0207700_10696111 3300025928 Bacteria 907
111 Ga0207700_11175491 3300025928 Bacteria 685
112 Ga0207664_10017152 3300025929 Bacteria 5300
113 Ga0207664_10438008 3300025929 Bacteria 1165
114 Ga0207664_10614120 3300025929 Bacteria 977
115 Ga0207670_10366384 3300025936 Bacteria 1144
116 Ga0207669_10652572 3300025937 Bacteria 861
117 Ga0207640_10021585 3300025981 Bacteria 3840
118 Ga0207702_10351078 3300026078 Bacteria 1411
119 Ga0207676_12301401 3300026095 Bacteria 536
120 Ga0207698_10015324 3300026142 Bacteria 5129
121 Ga0209371_1001716 3300027312 Bacteria 13867
122 Ga0207428_10003786 3300027907 Bacteria 14512
123 Ga0268266_10034834 3300028379 Bacteria 4283
124 Ga0307515_10000274 3300028794 Bacteria 126011
125 Ga0307515_10022134 3300028794 Bacteria 11218
126 Ga0265338_10808578 3300028800 Bacteria 642
127 Ga0268256_1000997 3300030500 Bacteria 19214
128 Ga0265325_10000643 3300031241 Bacteria 25400
129 Ga0265340_10167268 3300031247 Bacteria 997
130 Ga0265340_10248218 3300031247 Bacteria 794
131 Ga0265339_10000953 3300031249 Bacteria 22121
132 Ga0265316_10206387 3300031344 Bacteria 1455
133 Ga0265316_10717582 3300031344 Bacteria 704
134 Ga0307513_10020747 3300031456 Bacteria 7779
135 Ga0265313_10029898 3300031595 Bacteria 2811
136 Ga0265313_10207081 3300031595 Bacteria 814
137 Ga0316579_10031779 3300031691 Bacteria 2418
138 Ga0307412_11429980 3300031911 Bacteria 627
139 Ga0307414_10043240 3300032004 Bacteria 3067
140 Ga0373953_0135838 3300035117 Bacteria 1050
141 Ga0373956_0060129 3300035119 Bacteria 1720
142 Ga0373956_0062564 3300035119 Bacteria 1687
143 Ga0373957_0077258 3300035120 Bacteria 1310
144 Ga0373946_0058668 3300035171 Bacteria 1631
145 Ga0316574_0165742 3300035398 Bacteria 1423
146 Ga0373924_0109878 3300035410 Bacteria 1191
147 Ga0373935_0385935 3300035692 Bacteria 1003
148 Ga0373927_0000055 3300035695 Bacteria 81098
149 Ga0373933_0042846 3300035724 Bacteria 2676
150 Ga0373933_0053775 3300035724 Bacteria 2412
151 Ga0373933_0804317 3300035724 Bacteria 619
152 Ga0373937_0061346 3300036401 Bacteria 3456
153 Ga0373925_0011698 3300037068 Bacteria 6346
154 Ga0395900_0022784 3300037418 Bacteria 6408
155 Ga0395900_1508010 3300037418 Bacteria 584
156 Ga0395905_0010545 3300037471 Bacteria 8975
157 Ga0436364_0702307 3300037853 Bacteria 4678
158 Ga0436361_1129876 3300039447 Bacteria 788
159 Ga0439465_0057771 3300041413 Bacteria 1281
160 Ga0439465_0310400 3300041413 Bacteria 591
161 Ga0439432_192964 3300042006 Bacteria 591
162 Ga0450920_004827 3300042122 Bacteria 2383
163 Ga0439446_0333632 3300042156 Bacteria 538
164 Ga0439434_0023554 3300042435 Bacteria 1855
165 Ga0450918_015592 3300042531 Bacteria 1321
166 Ga0466968_0061815 3300044735 Bacteria 1616
167 Ga0466967_1493868 3300045976 Bacteria 673
168 Ga0495592_0027496 3300046454 Bacteria 4313
169 Ga0495629_0005126 3300046459 Bacteria 9797
170 Ga0495641_0267010 3300046461 Bacteria 770
171 Ga0495639_0028535 3300046475 Bacteria 2473
172 Ga0495662_0008017 3300046476 Bacteria 5202
173 Ga0495606_0305198 3300046507 Bacteria 861
174 Ga0495618_0544816 3300046514 Bacteria 695
175 Ga0495632_0007052 3300046519 Bacteria 7120
176 Ga0495648_0209391 3300046524 Bacteria 970
177 Ga0495666_0469159 3300046526 Bacteria 563
178 Ga0495652_0222768 3300046529 Bacteria 1417
179 Ga0495640_0337365 3300046533 Bacteria 932
180 Ga0495587_0051571 3300046536 Bacteria 2432
181 Ga0495622_0166784 3300046557 Bacteria 991
182 Ga0495667_0229876 3300046559 Bacteria 1182
183 Ga0495634_0178213 3300046642 Bacteria 1332
184 Ga0495625_0074820 3300046660 Bacteria 2371
185 Ga0495625_0531084 3300046660 Bacteria 715
186 Ga0495635_0212677 3300046663 Bacteria 1309
187 Ga0495588_0018739 3300046674 Bacteria 3379
188 Ga0495588_0086652 3300046674 Bacteria 1638
189 Ga0495657_0018041 3300046675 Bacteria 5116
190 Ga0495623_0094822 3300046679 Bacteria 1825
191 Ga0495646_0177182 3300046680 Bacteria 1172
192 Ga0495658_0118681 3300046683 Bacteria 1598
193 Ga0495600_0029445 3300046809 Bacteria 3555
194 Ga0495604_0058070 3300047317 Bacteria 2972
195 Ga0495604_0311708 3300047317 Bacteria 1054
196 Ga0495674_0234777 3300047319 Bacteria 1513
197 Ga0495672_0025106 3300047320 Bacteria 3822
198 Ga0495676_0084914 3300047321 Bacteria 2387
199 Ga0495676_0085393 3300047321 Bacteria 2378
200 Ga0495602_0099087 3300048088 Bacteria 2397
201 Ga0496100_0047744 3300048903 Bacteria 2761
202 Ga0496100_0437644 3300048903 Bacteria 1001
203 Ga0496101_1037354 3300048904 Bacteria 644
204 Ga0496102_0037869 3300048905 Bacteria 4350
205 Ga0496102_0121776 3300048905 Bacteria 2437
206 Ga0496103_0142435 3300048906 Bacteria 1534
207 Ga0496104_0002270 3300048907 Bacteria 16574
208 Ga0496104_1027387 3300048907 Bacteria 728
209 Ga0496105_0069303 3300048908 Bacteria 2914
210 Ga0496106_0161679 3300048909 Bacteria 1771
211 Ga0496106_0395941 3300048909 Bacteria 1110
212 Ga0496107_0024441 3300048910 Bacteria 4274
213 Ga0496107_0824012 3300048910 Bacteria 679
214 Ga0496108_0007026 3300048911 Bacteria 9116
215 Ga0496109_0035133 3300048912 Bacteria 4519
216 Ga0496109_1694556 3300048912 Bacteria 566
217 Ga0496110_0674161 3300048913 Bacteria 934
218 Ga0496111_0032237 3300048914 Bacteria 3735
219 Ga0496112_0015450 3300048915 Bacteria 7127
220 Ga0496112_0338660 3300048915 Bacteria 1448
221 Ga0496113_0017362 3300048916 Bacteria 4993
222 Ga0496113_0124965 3300048916 Bacteria 2014
223 Ga0496115_0008747 3300048918 Bacteria 7506
224 Ga0496116_0017284 3300048919 Bacteria 5607
225 Ga0496116_0369528 3300048919 Bacteria 648
226 Ga0496117_0000338 3300048920 Bacteria 82688
227 Ga0496117_0006495 3300048920 Bacteria 11801
228 Ga0496118_0000958 3300048921 Bacteria 45054
229 Ga0496119_0004524 3300048922 Bacteria 13799
230 Ga0496119_0016820 3300048922 Bacteria 5537
231 Ga0496119_0191270 3300048922 Bacteria 1066
232 Ga0496121_0000612 3300048924 Bacteria 66397
233 Ga0496121_0004568 3300048924 Bacteria 18460
234 Ga0496121_0265203 3300048924 Bacteria 1183
235 Ga0496121_0279077 3300048924 Bacteria 1144
236 Ga0496121_0433565 3300048924 Bacteria 852
237 Ga0496121_0764679 3300048924 Bacteria 572
238 Ga0496122_0001265 3300048925 Bacteria 42335
239 Ga0496122_0037414 3300048925 Bacteria 3906
240 Ga0496122_0092560 3300048925 Bacteria 2054
241 Ga0496123_0000043 3300048926 Bacteria 253752
242 Ga0496123_0022796 3300048926 Bacteria 4812
243 Ga0496123_0054439 3300048926 Bacteria 2634
244 Ga0496124_0026216 3300048927 Bacteria 5261
245 Ga0496124_0029341 3300048927 Bacteria 4903
246 Ga0496124_0030229 3300048927 Bacteria 4811
247 Ga0496125_0014418 3300048928 Bacteria 7697
248 Ga0496125_0048248 3300048928 Bacteria 3553
249 Ga0496125_0110871 3300048928 Bacteria 1987
250 Ga0496125_0182014 3300048928 Bacteria 1399
251 Ga0496126_0001099 3300048929 Bacteria 45449
252 Ga0496126_0060135 3300048929 Bacteria 3418
253 Ga0496126_0173233 3300048929 Bacteria 1837
254 Ga0501315_071841 3300049531 Bacteria 575
255 Ga0501031_0064008 3300049568 Bacteria 2395
256 Ga0501031_0504379 3300049568 Bacteria 780
257 Ga0501032_0005962 3300049569 Bacteria 8994
258 Ga0501032_0056419 3300049569 Bacteria 2640
259 Ga0501032_0068559 3300049569 Bacteria 2368
260 Ga0501032_0212985 3300049569 Bacteria 1259
261 Ga0501032_0653780 3300049569 Bacteria 667
262 Ga0501033_0008543 3300049570 Bacteria 7922
263 Ga0501033_0020663 3300049570 Bacteria 4974
264 Ga0501033_0185781 3300049570 Bacteria 1489
265 Ga0501033_0564508 3300049570 Bacteria 783
266 Ga0501034_0110733 3300049571 Bacteria 2736
267 Ga0501034_0133244 3300049571 Bacteria 2467
268 Ga0501034_0137134 3300049571 Bacteria 2427
269 Ga0501034_0142303 3300049571 Bacteria 2377
270 Ga0501034_0167148 3300049571 Bacteria 2168
271 Ga0501034_0284501 3300049571 Bacteria 1593
272 Ga0501036_0032196 3300049572 Bacteria 4430
273 Ga0501036_0110701 3300049572 Bacteria 2320
274 Ga0501036_0114635 3300049572 Bacteria 2277
275 Ga0501036_0121302 3300049572 Bacteria 2207
276 Ga0501037_0018959 3300049573 Bacteria 5071
277 Ga0501037_0037763 3300049573 Bacteria 3561
278 Ga0501037_0102930 3300049573 Bacteria 2059
279 Ga0501037_0366917 3300049573 Bacteria 991
280 Ga0501038_0015813 3300049574 Bacteria 6855
281 Ga0501038_0071920 3300049574 Bacteria 2932
282 Ga0501038_0299911 3300049574 Bacteria 1261
283 Ga0501038_0494874 3300049574 Bacteria 935
284 Ga0501039_0051470 3300049575 Bacteria 3187
285 Ga0501039_0054609 3300049575 Bacteria 3092
286 Ga0501039_0447999 3300049575 Bacteria 1014
287 Ga0501043_0052072 3300049579 Bacteria 3216
288 Ga0501043_0090646 3300049579 Bacteria 2404
289 Ga0501043_0099850 3300049579 Bacteria 2281
290 Ga0501043_0320809 3300049579 Bacteria 1181
291 Ga0501046_0040574 3300049580 Bacteria 3718
292 Ga0501046_0091421 3300049580 Bacteria 2341
293 Ga0501047_0004381 3300049581 Bacteria 13286
294 Ga0501047_0168794 3300049581 Bacteria 2058
295 Ga0501047_0263645 3300049581 Bacteria 1570
296 Ga0501047_0266190 3300049581 Bacteria 1561
297 Ga0501047_0267645 3300049581 Bacteria 1555
298 Ga0501047_0320253 3300049581 Bacteria 1390
299 Ga0501047_0704785 3300049581 Bacteria 827
300 Ga0501048_0559327 3300049582 Bacteria 821
301 Ga0501067_0002317 3300049583 Bacteria 10528
302 Ga0501067_0188449 3300049583 Bacteria 1149
303 Ga0501068_0089991 3300049584 Bacteria 1893
304 Ga0501069_0066924 3300049585 Bacteria 2009
305 Ga0501070_0011025 3300049586 Bacteria 7630
306 Ga0501070_0044627 3300049586 Bacteria 3687
307 Ga0501070_0251627 3300049586 Bacteria 1445
308 Ga0501070_0289313 3300049586 Bacteria 1335
309 Ga0501070_0547932 3300049586 Bacteria 926
310 Ga0501071_1487463 3300049587 Bacteria 523
311 Ga0501072_0012673 3300049588 Bacteria 6446
312 Ga0501073_0005983 3300049589 Bacteria 9077
313 Ga0501073_0047000 3300049589 Bacteria 3034
314 Ga0501073_0706228 3300049589 Bacteria 696
315 Ga0501074_0062371 3300049590 Bacteria 2684
316 Ga0501075_0716376 3300049591 Bacteria 762
317 Ga0501077_0862365 3300049593 Bacteria 582
318 Ga0501079_0353170 3300049741 Bacteria 1152
319 Ga0501080_0427904 3300049742 Bacteria 1188
320 Ga0501080_0880812 3300049742 Bacteria 781
321 Ga0501080_1646210 3300049742 Bacteria 543
322 Ga0501083_0262870 3300049744 Bacteria 1123
323 Ga0501280_003338 3300049776 Bacteria 2483
324 Ga0501280_006856 3300049776 Bacteria 1600
325 Ga0501035_0004352 3300049822 Bacteria 13446
326 Ga0501035_0032607 3300049822 Bacteria 4738
327 Ga0501035_0155478 3300049822 Bacteria 1982
328 Ga0501035_0416047 3300049822 Bacteria 1116
329 Ga0501044_0030062 3300049823 Bacteria 5725
330 Ga0501044_0035226 3300049823 Bacteria 5243
331 Ga0501044_0035366 3300049823 Bacteria 5231
332 Ga0501044_0567450 3300049823 Bacteria 1030
333 nmdc:mga00v17_608330_c1 3300050491 Bacteria 704
334 nmdc:mga05p37_5554_c1 3300050507 Bacteria 14822
335 nmdc:mga09592_16793_c1 3300050508 Bacteria 5991
336 nmdc:mga0qj67_8335_c1 3300050509 Bacteria 7684
337 nmdc:mga06r32_1399_c1 3300050510 Bacteria 21806
338 nmdc:mga06r32_293613_c1 3300050510 Bacteria 1612
339 nmdc:mga08y16_2157_c1 3300050511 Bacteria 20180
340 nmdc:mga08y16_445069_c1 3300050511 Bacteria 1322
341 nmdc:mga0n895_90476_c1 3300050512 Bacteria 3062
342 nmdc:mga0rr50_211387_c1 3300050513 Bacteria 1598
343 nmdc:mga08x19_511399_c1 3300050514 Bacteria 848
344 nmdc:mga0a205_28315_c1 3300050515 Bacteria 5356
345 Ga0495601_0132758 3300053077 Bacteria 1622
346 Ga0495619_0308761 3300053085 Bacteria 1095
347 Ga0495619_1149651 3300053085 Bacteria 515
348 Ga0500646_0322803 3300053090 Bacteria 558
349 Ga0500614_062185 3300053123 Bacteria 1007
350 Ga0500618_003422 3300053125 Bacteria 5447
351 Ga0500573_0001192 3300053140 Bacteria 12152
352 Ga0500590_007617 3300053148 Bacteria 5363
353 Ga0500619_030604 3300053154 Bacteria 1637
354 Ga0500636_0278176 3300053177 Bacteria 837
355 Ga0501084_0050149 3300054114 Bacteria 3494
356 Ga0501082_0537896 3300060353 Bacteria 1022
357 Ga0501082_0940680 3300060353 Bacteria 756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0278176 Ga0500636_0278176_438_818 126
2 3300048912 Ga0496109_1694556 Ga0496109_1694556_120_548 129
3 iso_pu_bacteria 2838035591 2838040969 137
4 3300048924 Ga0496121_0265203 Ga0496121_0265203_11_427 138
5 3300050491 nmdc:mga00v17_608330_c1 nmdc:mga00v17_608330_c1_32_448 138
6 3300053085 Ga0495619_1149651 Ga0495619_1149651_14_430 138
7 3300048928 Ga0496125_0182014 Ga0496125_0182014_462_887 141
8 3300049589 Ga0501073_0706228 Ga0501073_0706228_203_658 148
9 3300060353 Ga0501082_0940680 Ga0501082_0940680_110_601 148
10 3300009098 Ga0105245_11069739 Ga0105245_110697391 149
11 3300005327 Ga0070658_10305979 Ga0070658_103059792 150
12 3300005339 Ga0070660_100944264 Ga0070660_1009442642 150
13 3300005353 Ga0070669_100884344 Ga0070669_1008843441 150
14 3300005435 Ga0070714_100139185 Ga0070714_1001391853 150
15 3300005435 Ga0070714_100227002 Ga0070714_1002270022 150
16 3300005437 Ga0070710_10166205 Ga0070710_101662052 150
17 3300005458 Ga0070681_10424116 Ga0070681_104241162 150
18 3300005530 Ga0070679_100092935 Ga0070679_1000929352 150
19 3300006175 Ga0070712_101428151 Ga0070712_1014281511 150
20 3300006852 Ga0075433_10312413 Ga0075433_103124132 150
21 3300006871 Ga0075434_100100936 Ga0075434_1001009363 150
22 3300006914 Ga0075436_100339638 Ga0075436_1003396381 150
23 3300013307 Ga0157372_10741426 Ga0157372_107414262 150
24 3300025261 Ga0209233_1039512 Ga0209233_10395122 150
25 3300025898 Ga0207692_10436109 Ga0207692_104361092 150
26 3300025909 Ga0207705_10754121 Ga0207705_107541212 150
27 3300025912 Ga0207707_10263055 Ga0207707_102630552 150
28 3300025912 Ga0207707_10418804 Ga0207707_104188042 150
29 3300025921 Ga0207652_10109673 Ga0207652_101096733 150
30 3300025921 Ga0207652_10189902 Ga0207652_101899022 150
31 3300025923 Ga0207681_11720625 Ga0207681_117206251 150
32 3300025928 Ga0207700_11175491 Ga0207700_111754912 150
33 3300025929 Ga0207664_10017152 Ga0207664_100171522 150
34 3300025929 Ga0207664_10438008 Ga0207664_104380082 150
35 3300028800 Ga0265338_10808578 Ga0265338_108085782 150
36 3300031241 Ga0265325_10000643 Ga0265325_1000064310 150
37 3300031247 Ga0265340_10167268 Ga0265340_101672682 150
38 3300031247 Ga0265340_10248218 Ga0265340_102482182 150
39 3300031249 Ga0265339_10000953 Ga0265339_100009539 150
40 3300031344 Ga0265316_10206387 Ga0265316_102063872 150
41 3300031344 Ga0265316_10717582 Ga0265316_107175821 150
42 3300031595 Ga0265313_10029898 Ga0265313_100298983 150
43 3300031595 Ga0265313_10207081 Ga0265313_102070812 150
44 3300031691 Ga0316579_10031779 Ga0316579_100317792 150
45 3300037418 Ga0395900_0022784 Ga0395900_0022784_1540_1998 150
46 3300037418 Ga0395900_1508010 Ga0395900_1508010_27_485 150
47 3300047320 Ga0495672_0025106 Ga0495672_0025106_585_1043 150
48 3300048924 Ga0496121_0000612 Ga0496121_0000612_1161_1619 150
49 3300048924 Ga0496121_0279077 Ga0496121_0279077_141_599 150
50 3300048924 Ga0496121_0433565 Ga0496121_0433565_322_780 150
51 3300048929 Ga0496126_0173233 Ga0496126_0173233_1240_1698 150
52 3300049568 Ga0501031_0504379 Ga0501031_0504379_43_501 150
53 3300049569 Ga0501032_0212985 Ga0501032_0212985_303_761 150
54 3300049569 Ga0501032_0653780 Ga0501032_0653780_76_534 150
55 3300049570 Ga0501033_0185781 Ga0501033_0185781_323_781 150
56 3300049571 Ga0501034_0167148 Ga0501034_0167148_901_1359 150
57 3300049572 Ga0501036_0032196 Ga0501036_0032196_1140_1598 150
58 3300049573 Ga0501037_0366917 Ga0501037_0366917_20_478 150
59 3300049574 Ga0501038_0299911 Ga0501038_0299911_457_915 150
60 3300049575 Ga0501039_0447999 Ga0501039_0447999_271_729 150
61 3300049579 Ga0501043_0052072 Ga0501043_0052072_2415_2873 150
62 3300049580 Ga0501046_0040574 Ga0501046_0040574_457_915 150
63 3300049581 Ga0501047_0168794 Ga0501047_0168794_1154_1612 150
64 3300049581 Ga0501047_0263645 Ga0501047_0263645_146_604 150
65 3300049581 Ga0501047_0267645 Ga0501047_0267645_366_824 150
66 3300049586 Ga0501070_0011025 Ga0501070_0011025_2489_2947 150
67 3300049586 Ga0501070_0547932 Ga0501070_0547932_448_906 150
68 3300049587 Ga0501071_1487463 Ga0501071_1487463_42_500 150
69 3300049593 Ga0501077_0862365 Ga0501077_0862365_93_551 150
70 3300049742 Ga0501080_0880812 Ga0501080_0880812_27_485 150
71 3300049742 Ga0501080_1646210 Ga0501080_1646210_14_490 150
72 3300049822 Ga0501035_0155478 Ga0501035_0155478_424_882 150
73 3300049823 Ga0501044_0035226 Ga0501044_0035226_4026_4484 150
74 3300050510 nmdc:mga06r32_293613_c1 nmdc:mga06r32_293613_c1_452_910 150
75 3300050512 nmdc:mga0n895_90476_c1 nmdc:mga0n895_90476_c1_1587_2045 150
76 3300050513 nmdc:mga0rr50_211387_c1 nmdc:mga0rr50_211387_c1_382_840 150
77 3300050514 nmdc:mga08x19_511399_c1 nmdc:mga08x19_511399_c1_299_757 150
78 3300050515 nmdc:mga0a205_28315_c1 nmdc:mga0a205_28315_c1_3115_3573 150
79 3300053090 Ga0500646_0322803 Ga0500646_0322803_39_497 150
80 iso_pu_bacteria 2509276019 2509376217 150
81 iso_pu_bacteria 2558860100 2558863086 150
82 iso_pu_bacteria 2657244999 2657683665 150
83 iso_pu_bacteria 2791355082 2792581157 150
84 iso_pu_bacteria 2802429268 2804751898 150
85 iso_pu_bacteria 2850079185 2850080844 150
86 iso_pu_bacteria 2913295892 2913300487 150
87 iso_pu_bacteria 2920760137 2920765618 150
88 iso_pu_bacteria 8005658619 8005659351 150
89 3300005340 Ga0070689_100309887 Ga0070689_1003098872 151
90 3300006844 Ga0075428_100002909 Ga0075428_1000029092 151
91 3300006846 Ga0075430_100020618 Ga0075430_1000206182 151
92 3300006847 Ga0075431_100000417 Ga0075431_10000041722 151
93 3300006880 Ga0075429_100004216 Ga0075429_1000042166 151
94 3300009094 Ga0111539_10004674 Ga0111539_1000467413 151
95 3300009147 Ga0114129_10002339 Ga0114129_1000233912 151
96 3300025928 Ga0207700_10696111 Ga0207700_106961112 151
97 3300025936 Ga0207670_10366384 Ga0207670_103663842 151
98 3300027907 Ga0207428_10003786 Ga0207428_1000378613 151
99 3300039447 Ga0436361_1129876 Ga0436361_1129876_64_525 151
100 3300049569 Ga0501032_0068559 Ga0501032_0068559_1140_1601 151
101 3300049570 Ga0501033_0564508 Ga0501033_0564508_58_519 151
102 3300049571 Ga0501034_0110733 Ga0501034_0110733_1822_2283 151
103 3300049579 Ga0501043_0320809 Ga0501043_0320809_149_610 151
104 3300049581 Ga0501047_0004381 Ga0501047_0004381_10071_10559 151
105 3300049583 Ga0501067_0002317 Ga0501067_0002317_2679_3167 151
106 3300049586 Ga0501070_0251627 Ga0501070_0251627_544_1005 151
107 3300049588 Ga0501072_0012673 Ga0501072_0012673_5319_5807 151
108 3300049589 Ga0501073_0005983 Ga0501073_0005983_7066_7554 151
109 3300049742 Ga0501080_0427904 Ga0501080_0427904_50_538 151
110 3300050507 nmdc:mga05p37_5554_c1 nmdc:mga05p37_5554_c1_241_708 151
111 3300050508 nmdc:mga09592_16793_c1 nmdc:mga09592_16793_c1_728_1195 151
112 3300050509 nmdc:mga0qj67_8335_c1 nmdc:mga0qj67_8335_c1_4601_5068 151
113 3300050510 nmdc:mga06r32_1399_c1 nmdc:mga06r32_1399_c1_12336_12803 151
114 3300050511 nmdc:mga08y16_2157_c1 nmdc:mga08y16_2157_c1_15956_16423 151
115 3300054114 Ga0501084_0050149 Ga0501084_0050149_824_1312 151
116 iso_pu_bacteria 2510461069 2510841070 151
117 iso_pu_bacteria 2513237144 2513909768 151
118 iso_pu_bacteria 2513237146 2513926538 151
119 iso_pu_bacteria 2513237159 2514000328 151
120 iso_pu_bacteria 2523231067 2523468088 151
121 iso_pu_bacteria 2582581283 2585168345 151
122 iso_pu_bacteria 2582581306 2585268972 151
123 iso_pu_bacteria 2582581865 2585389497 151
124 iso_pu_bacteria 2582581866 2585393890 151
125 iso_pu_bacteria 2599185170 2599418031 151
126 iso_pu_bacteria 2643221637 2644210981 151
127 iso_pu_bacteria 2643221643 2644239247 151
128 iso_pu_bacteria 2643221653 2644300348 151
129 iso_pu_bacteria 2643221688 2644494676 151
130 iso_pu_bacteria 2643221689 2644499053 151
131 iso_pu_bacteria 2643221718 2644654636 151
132 iso_pu_bacteria 2643221719 2644658572 151
133 iso_pu_bacteria 2738543031 2739350117 151
134 iso_pu_bacteria 2775507049 2776913270 151
135 iso_pu_bacteria 2791355253 2793279510 151
136 iso_pu_bacteria 2838661181 2838666186 151
137 iso_pu_bacteria 2842521101 2842525998 151
138 iso_pu_bacteria 2891373044 2891374210 151
139 iso_pu_bacteria 2933016740 2933017557 151
140 iso_pu_bacteria 2989776772 2989778691 151
141 iso_pu_bacteria 2995392953 2995393329 151
142 iso_pu_bacteria 3005409236 3005409671 151
143 iso_pu_bacteria 8018150411 8018155634 151
144 iso_pu_bacteria 8024486573 8024492537 151
145 3300035398 Ga0316574_0165742 Ga0316574_0165742_208_681 152
146 3300050511 nmdc:mga08y16_445069_c1 nmdc:mga08y16_445069_c1_603_1067 152
147 3300060353 Ga0501082_0537896 Ga0501082_0537896_252_719 152
148 iso_pu_bacteria 2818991272 2819242034 152
149 iso_pu_bacteria 2989349275 2989353034 152
150 iso_pu_bacteria 8005246636 8005250736 152
151 3300035724 Ga0373933_0804317 Ga0373933_0804317_55_555 153
152 iso_pu_bacteria 2510917022 2511133689 153
153 iso_pu_bacteria 2524023209 2524462663 153
154 iso_pu_bacteria 2582581307 2585270579 153
155 iso_pu_bacteria 2582581308 2585276924 153
156 iso_pu_bacteria 2582581315 2585324073 153
157 iso_pu_bacteria 2582581316 2585333533 153
158 iso_pu_bacteria 2585427527 2585534770 153
159 iso_pu_bacteria 2585427530 2585551784 153
160 iso_pu_bacteria 2585427531 2585558283 153
161 iso_pu_bacteria 2585427608 2585897677 153
162 iso_pu_bacteria 2585427609 2585904728 153
163 iso_pu_bacteria 2585428125 2587980156 153
164 iso_pu_bacteria 2615840626 2616308297 153
165 iso_pu_bacteria 2615840698 2616556642 153
166 iso_pu_bacteria 2617270742 2617381650 153
167 iso_pu_bacteria 2667528174 2671115694 153
168 iso_pu_bacteria 2775507266 2778176437 153
169 iso_pu_bacteria 2818991448 2819610449 153
170 iso_pu_bacteria 2818991453 2819638188 153
171 iso_pu_bacteria 2838029111 2838032170 153
172 iso_pu_bacteria 2842298080 2842301878 153
173 iso_pu_bacteria 2842357229 2842362324 153
174 iso_pu_bacteria 2842475841 2842479201 153
175 iso_pu_bacteria 2842482326 2842487172 153
176 iso_pu_bacteria 2842502639 2842506079 153
177 iso_pu_bacteria 2842509118 2842510170 153
178 iso_pu_bacteria 2852387548 2852389578 153
179 iso_pu_bacteria 2919408235 2919409747 153
180 iso_pu_bacteria 3005416602 3005420387 153
181 iso_pu_bacteria 8005314921 8005317338 153
182 iso_pu_bacteria 8005484373 8005486596 153
183 iso_pu_bacteria 8005645114 8005646260 153
184 iso_pu_bacteria 8046767195 8046770305 153
185 iso_pu_bacteria 8049293176 8049294433 153
186 iso_pu_bacteria 8057575449 8057578233 153
187 3300005437 Ga0070710_11037716 Ga0070710_110377161 154
188 3300005618 Ga0068864_102378626 Ga0068864_1023786261 154
189 3300014325 Ga0163163_10007735 Ga0163163_100077355 154
190 3300021320 Ga0214544_1000024 Ga0214544_1000024134 154
191 3300021321 Ga0214542_1000015 Ga0214542_1000015119 154
192 3300021321 Ga0214542_1026314 Ga0214542_10263143 154
193 3300021327 Ga0214543_1000011 Ga0214543_1000011286 154
194 3300021327 Ga0214543_1000032 Ga0214543_10000329 154
195 3300025929 Ga0207664_10614120 Ga0207664_106141202 154
196 3300026095 Ga0207676_12301401 Ga0207676_123014011 154
197 3300035119 Ga0373956_0060129 Ga0373956_0060129_88_576 154
198 3300035171 Ga0373946_0058668 Ga0373946_0058668_944_1417 154
199 3300035724 Ga0373933_0053775 Ga0373933_0053775_1818_2306 154
200 3300044735 Ga0466968_0061815 Ga0466968_0061815_216_710 154
201 3300045976 Ga0466967_1493868 Ga0466967_1493868_73_567 154
202 3300047321 Ga0495676_0085393 Ga0495676_0085393_1024_1497 154
203 3300048903 Ga0496100_0047744 Ga0496100_0047744_1661_2134 154
204 3300048904 Ga0496101_1037354 Ga0496101_1037354_71_544 154
205 3300048905 Ga0496102_0121776 Ga0496102_0121776_1632_2105 154
206 3300048906 Ga0496103_0142435 Ga0496103_0142435_456_929 154
207 3300048907 Ga0496104_0002270 Ga0496104_0002270_11689_12162 154
208 3300048908 Ga0496105_0069303 Ga0496105_0069303_1524_1997 154
209 3300048911 Ga0496108_0007026 Ga0496108_0007026_5649_6122 154
210 3300048912 Ga0496109_0035133 Ga0496109_0035133_3036_3509 154
211 3300048913 Ga0496110_0674161 Ga0496110_0674161_117_590 154
212 3300048914 Ga0496111_0032237 Ga0496111_0032237_1195_1668 154
213 3300048915 Ga0496112_0015450 Ga0496112_0015450_4941_5414 154
214 3300048916 Ga0496113_0017362 Ga0496113_0017362_1730_2203 154
215 3300048918 Ga0496115_0008747 Ga0496115_0008747_1524_1997 154
216 3300049531 Ga0501315_071841 Ga0501315_071841_75_539 154
217 3300049569 Ga0501032_0005962 Ga0501032_0005962_3622_4098 154
218 3300049570 Ga0501033_0008543 Ga0501033_0008543_5978_6454 154
219 3300049571 Ga0501034_0133244 Ga0501034_0133244_333_809 154
220 3300049571 Ga0501034_0142303 Ga0501034_0142303_1403_1879 154
221 3300049571 Ga0501034_0284501 Ga0501034_0284501_11_487 154
222 3300049572 Ga0501036_0110701 Ga0501036_0110701_914_1390 154
223 3300049572 Ga0501036_0114635 Ga0501036_0114635_1756_2232 154
224 3300049573 Ga0501037_0018959 Ga0501037_0018959_2025_2501 154
225 3300049573 Ga0501037_0037763 Ga0501037_0037763_1289_1765 154
226 3300049574 Ga0501038_0015813 Ga0501038_0015813_2229_2705 154
227 3300049574 Ga0501038_0494874 Ga0501038_0494874_46_522 154
228 3300049575 Ga0501039_0051470 Ga0501039_0051470_2406_2882 154
229 3300049575 Ga0501039_0054609 Ga0501039_0054609_704_1180 154
230 3300049579 Ga0501043_0090646 Ga0501043_0090646_771_1247 154
231 3300049580 Ga0501046_0091421 Ga0501046_0091421_743_1219 154
232 3300049581 Ga0501047_0266190 Ga0501047_0266190_92_568 154
233 3300049581 Ga0501047_0320253 Ga0501047_0320253_205_681 154
234 3300049582 Ga0501048_0559327 Ga0501048_0559327_100_576 154
235 3300049583 Ga0501067_0188449 Ga0501067_0188449_540_1016 154
236 3300049584 Ga0501068_0089991 Ga0501068_0089991_1206_1682 154
237 3300049585 Ga0501069_0066924 Ga0501069_0066924_210_686 154
238 3300049586 Ga0501070_0044627 Ga0501070_0044627_325_801 154
239 3300049586 Ga0501070_0289313 Ga0501070_0289313_727_1203 154
240 3300049589 Ga0501073_0047000 Ga0501073_0047000_594_1070 154
241 3300049590 Ga0501074_0062371 Ga0501074_0062371_659_1135 154
242 3300049741 Ga0501079_0353170 Ga0501079_0353170_158_634 154
243 3300049744 Ga0501083_0262870 Ga0501083_0262870_46_522 154
244 3300049822 Ga0501035_0004352 Ga0501035_0004352_3135_3611 154
245 3300049822 Ga0501035_0416047 Ga0501035_0416047_381_857 154
246 3300049823 Ga0501044_0030062 Ga0501044_0030062_4120_4596 154
247 3300049823 Ga0501044_0567450 Ga0501044_0567450_296_772 154
248 3300053085 Ga0495619_0308761 Ga0495619_0308761_497_985 154
249 3300002773 JGI25152J39213_1004312 JGI25152J39213_10043123 155
250 3300003187 JGI25151J46595_10001641 JGI25151J46595_1000164112 155
251 3300003187 JGI25151J46595_10057293 JGI25151J46595_100572932 155
252 3300003322 rootL2_10001766 rootL2_100017662 155
253 3300003771 Ga0055526_1021905 Ga0055526_10219052 155
254 3300003775 Ga0055524_1011436 Ga0055524_10114363 155
255 3300003790 Ga0055528_1001889 Ga0055528_10018899 155
256 3300005262 Ga0065165_1015257 Ga0065165_10152574 155
257 3300005539 Ga0068853_101370050 Ga0068853_1013700501 155
258 3300006051 Ga0075364_10426046 Ga0075364_104260462 155
259 3300013104 Ga0157370_10551852 Ga0157370_105518522 155
260 3300025258 Ga0209129_1000349 Ga0209129_100034915 155
261 3300025273 Ga0209673_1000068 Ga0209673_1000068161 155
262 3300025292 Ga0209676_1040587 Ga0209676_10405872 155
263 3300025294 Ga0209025_1000320 Ga0209025_1000320120 155
264 3300025294 Ga0209025_1000949 Ga0209025_100094912 155
265 3300025295 Ga0209564_1070581 Ga0209564_10705812 155
266 3300025297 Ga0209758_1023693 Ga0209758_10236934 155
267 3300025297 Ga0209758_1063642 Ga0209758_10636422 155
268 3300025299 Ga0209256_1002171 Ga0209256_10021719 155
269 3300025299 Ga0209256_1032466 Ga0209256_10324662 155
270 3300025304 Ga0209257_1035464 Ga0209257_10354642 155
271 3300028794 Ga0307515_10000274 Ga0307515_1000027447 155
272 3300028794 Ga0307515_10022134 Ga0307515_100221343 155
273 3300031456 Ga0307513_10020747 Ga0307513_100207473 155
274 3300031911 Ga0307412_11429980 Ga0307412_114299801 155
275 3300032004 Ga0307414_10043240 Ga0307414_100432404 155
276 3300035692 Ga0373935_0385935 Ga0373935_0385935_450_917 155
277 3300035695 Ga0373927_0000055 Ga0373927_0000055_5043_5510 155
278 3300037068 Ga0373925_0011698 Ga0373925_0011698_3739_4206 155
279 3300037471 Ga0395905_0010545 Ga0395905_0010545_44_511 155
280 3300041413 Ga0439465_0057771 Ga0439465_0057771_657_1124 155
281 3300041413 Ga0439465_0310400 Ga0439465_0310400_37_504 155
282 3300042006 Ga0439432_192964 Ga0439432_192964_32_499 155
283 3300042122 Ga0450920_004827 Ga0450920_004827_207_674 155
284 3300042156 Ga0439446_0333632 Ga0439446_0333632_30_497 155
285 3300042435 Ga0439434_0023554 Ga0439434_0023554_1173_1640 155
286 3300042531 Ga0450918_015592 Ga0450918_015592_198_665 155
287 3300046454 Ga0495592_0027496 Ga0495592_0027496_2210_2677 155
288 3300046459 Ga0495629_0005126 Ga0495629_0005126_8305_8772 155
289 3300046461 Ga0495641_0267010 Ga0495641_0267010_179_646 155
290 3300046475 Ga0495639_0028535 Ga0495639_0028535_774_1241 155
291 3300046476 Ga0495662_0008017 Ga0495662_0008017_3204_3671 155
292 3300046507 Ga0495606_0305198 Ga0495606_0305198_335_802 155
293 3300046514 Ga0495618_0544816 Ga0495618_0544816_153_620 155
294 3300046519 Ga0495632_0007052 Ga0495632_0007052_3124_3591 155
295 3300046524 Ga0495648_0209391 Ga0495648_0209391_105_572 155
296 3300046526 Ga0495666_0469159 Ga0495666_0469159_68_535 155
297 3300046529 Ga0495652_0222768 Ga0495652_0222768_655_1122 155
298 3300046533 Ga0495640_0337365 Ga0495640_0337365_81_548 155
299 3300046557 Ga0495622_0166784 Ga0495622_0166784_422_889 155
300 3300046642 Ga0495634_0178213 Ga0495634_0178213_20_487 155
301 3300046660 Ga0495625_0074820 Ga0495625_0074820_738_1208 155
302 3300046660 Ga0495625_0531084 Ga0495625_0531084_80_547 155
303 3300046663 Ga0495635_0212677 Ga0495635_0212677_573_1040 155
304 3300046674 Ga0495588_0018739 Ga0495588_0018739_1569_2036 155
305 3300046674 Ga0495588_0086652 Ga0495588_0086652_567_1034 155
306 3300046675 Ga0495657_0018041 Ga0495657_0018041_1310_1777 155
307 3300046680 Ga0495646_0177182 Ga0495646_0177182_185_652 155
308 3300046683 Ga0495658_0118681 Ga0495658_0118681_654_1121 155
309 3300046809 Ga0495600_0029445 Ga0495600_0029445_1043_1510 155
310 3300047317 Ga0495604_0058070 Ga0495604_0058070_558_1025 155
311 3300047321 Ga0495676_0084914 Ga0495676_0084914_306_773 155
312 3300048088 Ga0495602_0099087 Ga0495602_0099087_1343_1810 155
313 3300048903 Ga0496100_0437644 Ga0496100_0437644_405_872 155
314 3300048909 Ga0496106_0161679 Ga0496106_0161679_906_1373 155
315 3300048910 Ga0496107_0024441 Ga0496107_0024441_3455_3922 155
316 3300048919 Ga0496116_0369528 Ga0496116_0369528_86_556 155
317 3300048920 Ga0496117_0006495 Ga0496117_0006495_3059_3529 155
318 3300048922 Ga0496119_0191270 Ga0496119_0191270_424_894 155
319 3300048924 Ga0496121_0764679 Ga0496121_0764679_83_550 155
320 3300048925 Ga0496122_0001265 Ga0496122_0001265_16634_17104 155
321 3300048925 Ga0496122_0092560 Ga0496122_0092560_498_965 155
322 3300048926 Ga0496123_0000043 Ga0496123_0000043_97046_97516 155
323 3300048927 Ga0496124_0026216 Ga0496124_0026216_3862_4332 155
324 3300048928 Ga0496125_0014418 Ga0496125_0014418_1127_1597 155
325 3300048928 Ga0496125_0048248 Ga0496125_0048248_2803_3273 155
326 3300048929 Ga0496126_0001099 Ga0496126_0001099_37038_37508 155
327 3300049568 Ga0501031_0064008 Ga0501031_0064008_1242_1709 155
328 3300049569 Ga0501032_0056419 Ga0501032_0056419_782_1249 155
329 3300049570 Ga0501033_0020663 Ga0501033_0020663_1546_2013 155
330 3300049571 Ga0501034_0137134 Ga0501034_0137134_1464_1931 155
331 3300049572 Ga0501036_0121302 Ga0501036_0121302_694_1161 155
332 3300049573 Ga0501037_0102930 Ga0501037_0102930_774_1241 155
333 3300049574 Ga0501038_0071920 Ga0501038_0071920_837_1304 155
334 3300049579 Ga0501043_0099850 Ga0501043_0099850_1098_1565 155
335 3300049581 Ga0501047_0704785 Ga0501047_0704785_127_594 155
336 3300049776 Ga0501280_003338 Ga0501280_003338_691_1158 155
337 3300049776 Ga0501280_006856 Ga0501280_006856_646_1113 155
338 3300049822 Ga0501035_0032607 Ga0501035_0032607_1965_2432 155
339 3300049823 Ga0501044_0035366 Ga0501044_0035366_1045_1512 155
340 3300053077 Ga0495601_0132758 Ga0495601_0132758_322_789 155
341 3300053123 Ga0500614_062185 Ga0500614_062185_187_654 155
342 3300053140 Ga0500573_0001192 Ga0500573_0001192_8046_8513 155
343 3300053148 Ga0500590_007617 Ga0500590_007617_2928_3395 155
344 3300053154 Ga0500619_030604 Ga0500619_030604_831_1298 155
345 iso_pu_bacteria 2599185156 2599331504 155
346 iso_pu_bacteria 2842922631 2842923901 155
347 3300037853 Ga0436364_0702307 Ga0436364_0702307_236_730 156
348 3300049591 Ga0501075_0716376 Ga0501075_0716376_267_746 156
349 3300002704 JGI25155J39150_1000011 JGI25155J39150_100001199 157
350 3300002705 JGI25156J39149_1000027 JGI25156J39149_100002799 157
351 3300002705 JGI25156J39149_1000030 JGI25156J39149_100003013 157
352 3300002737 JGI25162J39368_1002899 JGI25162J39368_10028992 157
353 3300002737 JGI25162J39368_1002900 JGI25162J39368_10029002 157
354 3300002738 JGI25154J39366_1000057 JGI25154J39366_100005726 157
355 3300002741 JGI25157J39369_1000010 JGI25157J39369_1000010112 157
356 3300002987 JGI25159J45721_1001890 JGI25159J45721_10018903 157
357 3300003214 JGI25165J46597_1002487 JGI25165J46597_10024872 157
358 3300003214 JGI25165J46597_1002504 JGI25165J46597_10025042 157
359 3300003214 JGI25165J46597_1011180 JGI25165J46597_10111802 157
360 3300003316 rootH1_10106418 rootH1_101064183 157
361 3300003320 rootH2_10177198 rootH2_101771983 157
362 3300003322 rootL2_10001767 rootL2_100017678 157
363 3300003354 JGI25160J50197_1000004 JGI25160J50197_1000004114 157
364 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003314 157
365 3300004625 Ga0055543_1000001 Ga0055543_1000001320 157
366 3300005262 Ga0065165_1000049 Ga0065165_100004992 157
367 3300005367 Ga0070667_100203072 Ga0070667_1002030723 157
368 3300005548 Ga0070665_100019094 Ga0070665_1000190944 157
369 3300005578 Ga0068854_100023587 Ga0068854_1000235873 157
370 3300005614 Ga0068856_100140755 Ga0068856_1001407552 157
371 3300005614 Ga0068856_100294104 Ga0068856_1002941042 157
372 3300005616 Ga0068852_100035348 Ga0068852_1000353482 157
373 3300005834 Ga0068851_10191441 Ga0068851_101914412 157
374 3300006353 Ga0075370_10007141 Ga0075370_100071414 157
375 3300009093 Ga0105240_10000005 Ga0105240_10000005310 157
376 3300009148 Ga0105243_10678284 Ga0105243_106782842 157
377 3300009545 Ga0105237_10002240 Ga0105237_100022402 157
378 3300010375 Ga0105239_10000739 Ga0105239_100007393 157
379 3300013104 Ga0157370_10006233 Ga0157370_100062339 157
380 3300013105 Ga0157369_10232742 Ga0157369_102327422 157
381 3300015262 Ga0182007_10001732 Ga0182007_100017329 157
382 3300025206 Ga0209435_100022 Ga0209435_100022111 157
383 3300025233 Ga0209437_100160 Ga0209437_100160152 157
384 3300025233 Ga0209437_100310 Ga0209437_10031064 157
385 3300025246 Ga0209646_1000078 Ga0209646_1000078111 157
386 3300025250 Ga0209026_1000065 Ga0209026_1000065111 157
387 3300025253 Ga0209677_100545 Ga0209677_1005456 157
388 3300025254 Ga0209148_1006730 Ga0209148_10067302 157
389 3300025256 Ga0209759_1000055 Ga0209759_1000055111 157
390 3300025256 Ga0209759_1013023 Ga0209759_10130233 157
391 3300025261 Ga0209233_1000168 Ga0209233_100016810 157
392 3300025261 Ga0209233_1000303 Ga0209233_100030364 157
393 3300025261 Ga0209233_1000594 Ga0209233_100059410 157
394 3300025284 Ga0209130_1000012 Ga0209130_1000012114 157
395 3300025302 Ga0207426_1000010 Ga0207426_1000010473 157
396 3300025321 Ga0207656_10181827 Ga0207656_101818272 157
397 3300025913 Ga0207695_10000011 Ga0207695_10000011604 157
398 3300025914 Ga0207671_10001291 Ga0207671_1000129126 157
399 3300025937 Ga0207669_10652572 Ga0207669_106525722 157
400 3300025981 Ga0207640_10021585 Ga0207640_100215854 157
401 3300026078 Ga0207702_10351078 Ga0207702_103510782 157
402 3300026142 Ga0207698_10015324 Ga0207698_100153242 157
403 3300027312 Ga0209371_1001716 Ga0209371_10017164 157
404 3300028379 Ga0268266_10034834 Ga0268266_100348343 157
405 3300030500 Ga0268256_1000997 Ga0268256_10009978 157
406 3300035117 Ga0373953_0135838 Ga0373953_0135838_391_903 157
407 3300035119 Ga0373956_0062564 Ga0373956_0062564_866_1378 157
408 3300035120 Ga0373957_0077258 Ga0373957_0077258_464_976 157
409 3300035410 Ga0373924_0109878 Ga0373924_0109878_554_1066 157
410 3300035724 Ga0373933_0042846 Ga0373933_0042846_464_976 157
411 3300036401 Ga0373937_0061346 Ga0373937_0061346_1641_2153 157
412 3300046536 Ga0495587_0051571 Ga0495587_0051571_1541_2053 157
413 3300046559 Ga0495667_0229876 Ga0495667_0229876_338_850 157
414 3300046679 Ga0495623_0094822 Ga0495623_0094822_685_1197 157
415 3300047317 Ga0495604_0311708 Ga0495604_0311708_461_973 157
416 3300047319 Ga0495674_0234777 Ga0495674_0234777_425_937 157
417 3300048905 Ga0496102_0037869 Ga0496102_0037869_3140_3613 157
418 3300048907 Ga0496104_1027387 Ga0496104_1027387_36_560 157
419 3300048909 Ga0496106_0395941 Ga0496106_0395941_576_1100 157
420 3300048910 Ga0496107_0824012 Ga0496107_0824012_122_646 157
421 3300048915 Ga0496112_0338660 Ga0496112_0338660_900_1424 157
422 3300048916 Ga0496113_0124965 Ga0496113_0124965_1226_1699 157
423 3300048919 Ga0496116_0017284 Ga0496116_0017284_1902_2375 157
424 3300048920 Ga0496117_0000338 Ga0496117_0000338_73537_74010 157
425 3300048921 Ga0496118_0000958 Ga0496118_0000958_8691_9164 157
426 3300048922 Ga0496119_0004524 Ga0496119_0004524_9978_10451 157
427 3300048922 Ga0496119_0016820 Ga0496119_0016820_3055_3528 157
428 3300048924 Ga0496121_0004568 Ga0496121_0004568_8691_9164 157
429 3300048925 Ga0496122_0037414 Ga0496122_0037414_3247_3720 157
430 3300048926 Ga0496123_0022796 Ga0496123_0022796_3163_3636 157
431 3300048926 Ga0496123_0054439 Ga0496123_0054439_1902_2375 157
432 3300048927 Ga0496124_0029341 Ga0496124_0029341_1177_1650 157
433 3300048927 Ga0496124_0030229 Ga0496124_0030229_1474_1947 157
434 3300048928 Ga0496125_0110871 Ga0496125_0110871_1293_1766 157
435 3300048929 Ga0496126_0060135 Ga0496126_0060135_40_513 157
436 3300053125 Ga0500618_003422 Ga0500618_003422_3031_3504 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

24

148

0.91

PF03061

4HBT

Thioesterase superfamily

74

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zw0-assembly1.cif.gz_C crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from candidatus asiaticum 0.9728 9 151
4h4g-assembly1.cif.gz_B crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9643 12 144
4h4g-assembly2.cif.gz_H-2 crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9633 13 150
3doz-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with compound 3k 0.9624 10 152
3d6x-assembly1.cif.gz_A crystal structure of campylobacter jejuni fabz 0.9616 12 150
ID Description Score Start End Superfamily
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9578 9 148 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9529 12 148 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9529 12 151 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9522 12 150 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9452 12 150 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2G6NWY1-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9695 11 152 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
GO:0046872
GO:0103117
AF-H0G8A9-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) 0.9664 4 111 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-M1E447-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9658 12 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A437MJL4-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9653 10 152 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2D7BQS1-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acylglucosamine N-acyltransferase (EC 2.3.1.191)] 0.9651 6 153 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0016410
GO:0019171

Feature Viewer

pLDDT pTM Quality
85.53 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map