F443208

General Info

Members Datasets Scaffolds Average Seq Length
434 290 404 384

Family's Representative Sequence

Representative Sequence 3300053118|Ga0500594_0000393|Ga0500594_0000393_8227_9528
Length 433
Sequence MRADPARPGFARPHQPSLLRDGVPPFLHTSRNPGPGFPSTIMTTPNTSLRRTALTLXXXTCAGIGQLASAATIGLMAPLSGPIAVVGQDQVDGFMLAVEQLGGKLGGQAATVLKEDDQLKPEIGGQIVRKFIDKDKVDAIVGLSFSNVMMASLPRIAESGTVAIATNAGPSPVAGAGCKANVFSTAWQNDGAAEAMGKFAQDRGVKKVYLMAPNYQAGKDMLSGFKRYFKGQIVEEVYTQVNQPDYSAELAQLQAAKPDAAFVFYPGGMGVNFIKQMAQAGLMTKVPLYSVFTVDGTTLPALRDAAVGSISGAMWDAALDTPESKKFVAAFEAKYKRTPSEYAATAYDAANLLNIALGKVKPGDSKALAAAVRAAGDELKSVRGPFAFNNNNMPVQNYYAFETVKDGGRITGKLLATPLTKHVDAYHTQCAQK

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
8 2643221569 Achromobacter sp. Root565 Isolate Unclassified
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541280 Massilia sp. GV090 Isolate Unclassified
15 2738541297 Duganella sp. GV083 Isolate Unclassified
16 2738541357 Duganella sp. GV053 Isolate Unclassified
17 2738543003 Duganella sp. GV066 Isolate Unclassified
18 2738543019 Variovorax sp. GV040 Isolate Unclassified
19 2738543026 Duganella sp. GV089 Isolate Unclassified
20 2738543029 Duganella sp. GV039 Isolate Unclassified
21 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
22 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
23 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
24 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
25 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
26 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
27 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
28 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2941479691
31 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
150 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
151 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
152 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
268 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
269 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
270 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
271 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
274 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
275 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
276 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
280 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
281 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
287 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
290 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.09
Metatranscriptomes 0
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.8
Nodule 0.92
Rhizoplane 0.46
Rhizosphere 56.22
Stem 0
Stem Tuber 0
Unclassified 13.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000062 3300002704 Bacteria 70719
2 JGI25156J39149_1000012 3300002705 Bacteria 194393
3 JGI25154J39366_1000029 3300002738 Bacteria 194393
4 JGI25157J39369_1000014 3300002741 Bacteria 194393
5 JGI25150J39212_1007017 3300002774 Bacteria 2288
6 JGI25159J45721_1000054 3300002987 Bacteria 56576
7 JGI25159J45721_1003080 3300002987 Bacteria 6025
8 JGI25151J46595_10004424 3300003187 Bacteria 7439
9 JGI25151J46595_10006031 3300003187 Bacteria 6171
10 JGI25151J46595_10006574 3300003187 Bacteria 5823
11 JGI25160J50197_1000088 3300003354 Bacteria 93050
12 JGI25160J50197_1000119 3300003354 Bacteria 71366
13 JGI25161J50226_1000056 3300003374 Bacteria 103097
14 Ga0055535_1000222 3300003761 Bacteria 60095
15 Ga0055542_1000266 3300003762 Bacteria 58419
16 Ga0055537_1000024 3300003773 Bacteria 111410
17 Ga0055537_1000047 3300003773 Bacteria 88000
18 Ga0055537_1007290 3300003773 Bacteria 2682
19 Ga0055524_1000039 3300003775 Bacteria 159897
20 Ga0055534_1000032 3300003784 Bacteria 118890
21 Ga0055534_1000141 3300003784 Bacteria 53818
22 Ga0055528_1002122 3300003790 Bacteria 10944
23 Ga0055528_1002521 3300003790 Bacteria 9752
24 Ga0055530_10000532 3300003791 Bacteria 33030
25 Ga0055530_10024447 3300003791 Bacteria 1711
26 Ga0055540_1000047 3300003792 Bacteria 146914
27 Ga0055531_10010150 3300003794 Bacteria 4720
28 Ga0055543_1001077 3300004625 Bacteria 11969
29 Ga0065165_1005321 3300005262 Bacteria 7314
30 Ga0065704_10012889 3300005289 Bacteria 2002
31 Ga0070670_100258164 3300005331 Bacteria 1519
32 Ga0068868_100002606 3300005338 Bacteria 12501
33 Ga0068868_100094776 3300005338 Bacteria 2408
34 Ga0070671_100034118 3300005355 Bacteria 4212
35 Ga0070673_100086947 3300005364 Bacteria 2547
36 Ga0070659_100320792 3300005366 Bacteria 1295
37 Ga0070672_100010739 3300005543 Bacteria 6363
38 Ga0068855_100047998 3300005563 Bacteria 5041
39 Ga0068870_10026651 3300005840 Bacteria 2883
40 Ga0075365_10001914 3300006038 Bacteria 9814
41 Ga0075363_100024058 3300006048 Bacteria 3093
42 Ga0075363_100045287 3300006048 Bacteria 2333
43 Ga0075364_10032521 3300006051 Bacteria 3354
44 Ga0075432_10040334 3300006058 Bacteria 1629
45 Ga0075432_10045250 3300006058 Bacteria 1544
46 Ga0070712_100000946 3300006175 Bacteria 17458
47 Ga0075362_10042956 3300006177 Bacteria 2000
48 Ga0075367_10095159 3300006178 Bacteria 1816
49 Ga0075369_10048692 3300006186 Bacteria 1829
50 Ga0075366_10024928 3300006195 Bacteria 3490
51 Ga0075366_10053195 3300006195 Bacteria 2405
52 Ga0075370_10025251 3300006353 Bacteria 3285
53 Ga0075370_10027500 3300006353 Bacteria 3156
54 Ga0075370_10067824 3300006353 Bacteria 2037
55 Ga0075370_10135995 3300006353 Bacteria 1436
56 Ga0075434_100139155 3300006871 Bacteria 2447
57 Ga0105240_10320884 3300009093 Bacteria 1766
58 Ga0105245_10147538 3300009098 Bacteria 2220
59 Ga0105243_10266514 3300009148 Bacteria 1536
60 Ga0105241_10071656 3300009174 Bacteria 2691
61 Ga0163162_10467452 3300013306 Bacteria 1393
62 Ga0157376_10001974 3300014969 Bacteria 13725
63 Ga0209435_100002 3300025206 Bacteria 794178
64 Ga0209436_103397 3300025208 Bacteria 4252
65 Ga0209672_100367 3300025228 Bacteria 28039
66 Ga0209147_100377 3300025229 Bacteria 31152
67 Ga0209258_100374 3300025242 Bacteria 58471
68 Ga0207425_1001011 3300025245 Bacteria 13170
69 Ga0207425_1020023 3300025245 Bacteria 1434
70 Ga0209646_1000001 3300025246 Bacteria 3092932
71 Ga0209026_1000040 3300025250 Bacteria 277470
72 Ga0209148_1000358 3300025254 Bacteria 58471
73 Ga0209759_1000001 3300025256 Bacteria 2799452
74 Ga0209129_1008680 3300025258 Bacteria 2792
75 Ga0209565_1000039 3300025263 Bacteria 278026
76 Ga0209565_1000080 3300025263 Bacteria 156999
77 Ga0209565_1000876 3300025263 Bacteria 16569
78 Ga0209673_1000088 3300025273 Bacteria 204629
79 Ga0209673_1000284 3300025273 Bacteria 94932
80 Ga0209130_1000040 3300025284 Bacteria 262926
81 Ga0209130_1000346 3300025284 Bacteria 53329
82 Ga0209675_1000030 3300025291 Bacteria 278026
83 Ga0209675_1000133 3300025291 Bacteria 101207
84 Ga0209675_1000471 3300025291 Bacteria 30899
85 Ga0209676_1000073 3300025292 Bacteria 305947
86 Ga0209676_1008787 3300025292 Bacteria 4451
87 Ga0209025_1002084 3300025294 Bacteria 22602
88 Ga0209025_1004730 3300025294 Bacteria 11596
89 Ga0209025_1006776 3300025294 Bacteria 8785
90 Ga0209025_1013516 3300025294 Bacteria 5123
91 Ga0209564_1000313 3300025295 Bacteria 95224
92 Ga0209564_1000823 3300025295 Bacteria 42196
93 Ga0209758_1000679 3300025297 Bacteria 50729
94 Ga0209758_1005216 3300025297 Bacteria 10191
95 Ga0209050_1000008 3300025298 Bacteria 1144179
96 Ga0209050_1001577 3300025298 Bacteria 23647
97 Ga0209050_1004596 3300025298 Bacteria 9232
98 Ga0209256_1000096 3300025299 Bacteria 204629
99 Ga0207426_1000188 3300025302 Bacteria 153510
100 Ga0207426_1001354 3300025302 Bacteria 20775
101 Ga0209051_1000005 3300025303 Bacteria 1142353
102 Ga0209257_1000031 3300025304 Bacteria 688770
103 Ga0207645_10013156 3300025907 Bacteria 5586
104 Ga0207643_10009830 3300025908 Bacteria 5138
105 Ga0207693_10045852 3300025915 Bacteria 3434
106 Ga0207650_10048034 3300025925 Bacteria 3146
107 Ga0207687_10056676 3300025927 Bacteria 2749
108 Ga0207687_10078852 3300025927 Bacteria 2372
109 Ga0207709_10145991 3300025935 Bacteria 1632
110 Ga0207689_10295779 3300025942 Bacteria 1341
111 Ga0207658_10017295 3300025986 Bacteria 4967
112 Ga0207677_10001179 3300026023 Bacteria 14211
113 Ga0207677_10024064 3300026023 Bacteria 3776
114 Ga0207648_10019036 3300026089 Bacteria 6200
115 Ga0207675_100343337 3300026118 Bacteria 1462
116 Ga0209968_1000702 3300027526 Bacteria 5159
117 Ga0209966_1000040 3300027695 Bacteria 54404
118 Ga0209974_10006173 3300027876 Bacteria 4198
119 Ga0307517_10000160 3300028786 Bacteria 108370
120 Ga0307515_10000332 3300028794 Bacteria 116126
121 Ga0307515_10000893 3300028794 Bacteria 68669
122 Ga0307515_10033807 3300028794 Bacteria 8403
123 Ga0307515_10080735 3300028794 Bacteria 4235
124 Ga0268256_1010329 3300030500 Bacteria 3035
125 Ga0307512_10041345 3300030522 Bacteria 3833
126 Ga0265320_10013483 3300031240 Bacteria 4700
127 Ga0265327_10016954 3300031251 Bacteria 4595
128 Ga0307513_10003528 3300031456 Bacteria 21162
129 Ga0307509_10000317 3300031507 Bacteria 79032
130 Ga0307509_10001515 3300031507 Bacteria 39177
131 Ga0307509_10286269 3300031507 Bacteria 1405
132 Ga0307408_100064073 3300031548 Bacteria 2691
133 Ga0307508_10000332 3300031616 Bacteria 57039
134 Ga0307508_10006375 3300031616 Bacteria 11096
135 Ga0307508_10041135 3300031616 Bacteria 4149
136 Ga0307514_10001713 3300031649 Bacteria 25184
137 Ga0307514_10002158 3300031649 Bacteria 21139
138 Ga0265314_10028927 3300031711 Bacteria 4124
139 Ga0307516_10004792 3300031730 Bacteria 16488
140 Ga0307406_10127434 3300031901 Bacteria 1781
141 Ga0307412_10001460 3300031911 Bacteria 13160
142 Ga0307507_10003609 3300033179 Bacteria 29424
143 Ga0307507_10084452 3300033179 Bacteria 2767
144 Ga0316574_0000501 3300035398 Bacteria 15898
145 Ga0316582_0171519 3300036647 Bacteria 1473
146 Ga0316584_0003032 3300036712 Bacteria 10817
147 Ga0316584_0022273 3300036712 Bacteria 4619
148 Ga0316584_0041093 3300036712 Bacteria 3447
149 Ga0373925_0057822 3300037068 Bacteria 2906
150 Ga0395899_0000439 3300037312 Bacteria 47640
151 Ga0395899_0000953 3300037312 Bacteria 27077
152 Ga0395900_0006634 3300037418 Bacteria 12039
153 Ga0395900_0071210 3300037418 Bacteria 3573
154 Ga0395900_0124974 3300037418 Bacteria 2638
155 Ga0395900_0328642 3300037418 Bacteria 1507
156 Ga0395898_0086707 3300037466 Bacteria 3016
157 Ga0395905_0005906 3300037471 Bacteria 12414
158 Ga0395905_0018561 3300037471 Bacteria 6600
159 Ga0395905_0021175 3300037471 Bacteria 6154
160 Ga0395905_0115052 3300037471 Bacteria 2527
161 Ga0395905_0154779 3300037471 Bacteria 2156
162 Ga0395901_0041590 3300038443 Bacteria 4764
163 Ga0436361_1001773 3300039447 Bacteria 1596
164 Ga0439436_0011244 3300041404 Bacteria 2719
165 Ga0439439_0035542 3300041406 Bacteria 1280
166 Ga0451853_1119332 3300041512 Bacteria 1585
167 Ga0451853_1322005 3300041512 Bacteria 1736
168 Ga0439431_0010323 3300041997 Bacteria 2119
169 Ga0439433_0014926 3300041999 Bacteria 1713
170 Ga0439442_000420 3300042002 Bacteria 9794
171 Ga0439449_0001455 3300042007 Bacteria 9260
172 Ga0439455_0003947 3300042012 Bacteria 2893
173 Ga0450912_000785 3300042116 Bacteria 1728
174 Ga0450923_001850 3300042125 Bacteria 2908
175 Ga0450906_001353 3300042145 Bacteria 5374
176 Ga0450910_001018 3300042147 Bacteria 3421
177 Ga0439446_0011968 3300042156 Bacteria 2365
178 Ga0450908_000762 3300042184 Bacteria 6170
179 Ga0439434_0012818 3300042435 Bacteria 2484
180 Ga0439434_0043195 3300042435 Bacteria 1387
181 Ga0450918_000746 3300042531 Bacteria 6882
182 Ga0451577_0083621 3300042876 Bacteria 2847
183 Ga0453683_0036755 3300044673 Bacteria 3082
184 Ga0466965_0008498 3300044683 Bacteria 4750
185 Ga0466966_0026160 3300044684 Bacteria 3811
186 Ga0466964_0017669 3300044706 Bacteria 2731
187 Ga0453684_0038152 3300044712 Bacteria 6575
188 Ga0451576_0397885 3300045051 Bacteria 1444
189 Ga0495627_000015 3300046453 Bacteria 320787
190 Ga0495627_025580 3300046453 Bacteria 1913
191 Ga0495592_0000175 3300046454 Bacteria 56416
192 Ga0495590_0000001 3300046457 Bacteria 762984
193 Ga0495638_0006541 3300046460 Bacteria 8480
194 Ga0495638_0009094 3300046460 Bacteria 6993
195 Ga0495638_0009812 3300046460 Bacteria 6686
196 Ga0495638_0022826 3300046460 Bacteria 4102
197 Ga0495653_0000009 3300046463 Bacteria 304207
198 Ga0495650_0000001 3300046471 Bacteria 1085492
199 Ga0495650_0000164 3300046471 Bacteria 147142
200 Ga0495650_0000289 3300046471 Bacteria 93255
201 Ga0495650_0006827 3300046471 Bacteria 7036
202 Ga0495605_0025997 3300046474 Bacteria 3045
203 Ga0495639_0010678 3300046475 Bacteria 3954
204 Ga0495584_0000179 3300046491 Bacteria 44738
205 Ga0495584_0022844 3300046491 Bacteria 3173
206 Ga0495584_0047944 3300046491 Bacteria 2155
207 Ga0495585_0000587 3300046492 Bacteria 34126
208 Ga0495585_0005376 3300046492 Bacteria 8082
209 Ga0495585_0012347 3300046492 Bacteria 5033
210 Ga0495607_0003055 3300046501 Bacteria 13021
211 Ga0495607_0050545 3300046501 Bacteria 2419
212 Ga0495583_0000014 3300046506 Bacteria 320136
213 Ga0495583_0000058 3300046506 Bacteria 200120
214 Ga0495583_0000127 3300046506 Bacteria 127780
215 Ga0495583_0003009 3300046506 Bacteria 13477
216 Ga0495610_0000008 3300046512 Bacteria 622732
217 Ga0495610_0001018 3300046512 Bacteria 25838
218 Ga0495610_0019411 3300046512 Bacteria 3804
219 Ga0495610_0022203 3300046512 Bacteria 3476
220 Ga0495616_0000294 3300046513 Bacteria 40512
221 Ga0495616_0000982 3300046513 Bacteria 20446
222 Ga0495620_0027879 3300046515 Bacteria 2636
223 Ga0495637_0018995 3300046520 Bacteria 3183
224 Ga0495637_0033270 3300046520 Bacteria 2265
225 Ga0495643_0000044 3300046522 Bacteria 226211
226 Ga0495643_0000330 3300046522 Bacteria 65068
227 Ga0495644_0000030 3300046523 Bacteria 66319
228 Ga0495644_0000087 3300046523 Bacteria 46212
229 Ga0495648_0000001 3300046524 Bacteria 696872
230 Ga0495648_0000476 3300046524 Bacteria 43122
231 Ga0495648_0001285 3300046524 Bacteria 25043
232 Ga0495648_0001508 3300046524 Bacteria 22794
233 Ga0495648_0003813 3300046524 Bacteria 13095
234 Ga0495648_0023383 3300046524 Bacteria 4233
235 Ga0495648_0041837 3300046524 Bacteria 2889
236 Ga0495642_0000401 3300046528 Bacteria 23277
237 Ga0495642_0119311 3300046528 Bacteria 1131
238 Ga0495654_0000058 3300046530 Bacteria 139884
239 Ga0495654_0002363 3300046530 Bacteria 12189
240 Ga0495654_0007163 3300046530 Bacteria 6262
241 Ga0495654_0045998 3300046530 Bacteria 2151
242 Ga0495609_0001143 3300046538 Bacteria 18299
243 Ga0495609_0002960 3300046538 Bacteria 10046
244 Ga0495609_0005276 3300046538 Bacteria 6857
245 Ga0495609_0082688 3300046538 Bacteria 1402
246 Ga0495597_0000115 3300046542 Bacteria 72325
247 Ga0495597_0000996 3300046542 Bacteria 21725
248 Ga0495622_0000088 3300046557 Bacteria 82716
249 Ga0495622_0003623 3300046557 Bacteria 7251
250 Ga0495622_0038154 3300046557 Bacteria 2237
251 Ga0495633_0000521 3300046558 Bacteria 38447
252 Ga0495633_0003990 3300046558 Bacteria 9560
253 Ga0495633_0004607 3300046558 Bacteria 8688
254 Ga0495633_0019390 3300046558 Bacteria 3441
255 Ga0495656_0001972 3300046615 Bacteria 6773
256 Ga0495656_0006352 3300046615 Bacteria 4144
257 Ga0495656_0016114 3300046615 Bacteria 2832
258 Ga0495668_0000045 3300046616 Bacteria 225145
259 Ga0495668_0000193 3300046616 Bacteria 89740
260 Ga0495611_0000439 3300046648 Bacteria 25620
261 Ga0495611_0002144 3300046648 Bacteria 9221
262 Ga0495625_0000065 3300046660 Bacteria 173230
263 Ga0495625_0000224 3300046660 Bacteria 89521
264 Ga0495625_0010801 3300046660 Bacteria 7516
265 Ga0495625_0015337 3300046660 Bacteria 6071
266 Ga0495625_0024273 3300046660 Bacteria 4616
267 Ga0495659_0000041 3300046664 Bacteria 59124
268 Ga0495659_0000243 3300046664 Bacteria 22725
269 Ga0495588_0001682 3300046674 Bacteria 9422
270 Ga0495588_0049131 3300046674 Bacteria 2169
271 Ga0495646_0005993 3300046680 Bacteria 7705
272 Ga0495669_0019761 3300046684 Bacteria 2910
273 Ga0495670_0000064 3300046691 Bacteria 47436
274 Ga0495670_0000065 3300046691 Bacteria 46913
275 Ga0495671_0000002 3300046692 Bacteria 1136189
276 Ga0495671_0000584 3300046692 Bacteria 27018
277 Ga0495671_0001101 3300046692 Bacteria 18664
278 Ga0495671_0001577 3300046692 Bacteria 15095
279 Ga0495671_0002461 3300046692 Bacteria 11681
280 Ga0495649_0000166 3300046694 Bacteria 57538
281 Ga0495589_0030122 3300046794 Bacteria 2734
282 Ga0495660_0010686 3300046810 Bacteria 5334
283 Ga0495660_0027838 3300046810 Bacteria 3195
284 Ga0495660_0030060 3300046810 Bacteria 3062
285 Ga0495660_0086782 3300046810 Bacteria 1633
286 Ga0495636_0000067 3300047318 Bacteria 44261
287 Ga0495636_0000361 3300047318 Bacteria 17364
288 Ga0495636_0005816 3300047318 Bacteria 4835
289 Ga0495636_0078504 3300047318 Bacteria 1418
290 Ga0495672_0000918 3300047320 Bacteria 30795
291 Ga0495672_0001603 3300047320 Bacteria 22074
292 Ga0495672_0080627 3300047320 Bacteria 1814
293 Ga0495676_0000398 3300047321 Bacteria 35184
294 Ga0495683_0005381 3300047323 Bacteria 7106
295 Ga0495687_000566 3300047443 Bacteria 43606
296 Ga0495687_000603 3300047443 Bacteria 42021
297 Ga0495687_001099 3300047443 Bacteria 26415
298 Ga0495687_001273 3300047443 Bacteria 23729
299 Ga0495677_0000512 3300047445 Bacteria 16307
300 Ga0495677_0000790 3300047445 Bacteria 12780
301 Ga0495677_0001444 3300047445 Bacteria 9529
302 Ga0495679_000296 3300047446 Bacteria 40360
303 Ga0495679_002037 3300047446 Bacteria 10678
304 Ga0495685_001654 3300047447 Bacteria 6876
305 Ga0495673_0000061 3300047469 Bacteria 230647
306 Ga0495673_0000926 3300047469 Bacteria 26610
307 Ga0495681_0022987 3300047470 Bacteria 3324
308 Ga0495686_0117012 3300047472 Bacteria 1593
309 Ga0495593_0000083 3300047673 Bacteria 41204
310 Ga0495614_0001760 3300048089 Bacteria 9466
311 Ga0495615_0002597 3300048090 Bacteria 2915
312 Ga0495626_0003695 3300048091 Bacteria 9685
313 Ga0496113_0133633 3300048916 Bacteria 1949
314 Ga0496116_0008118 3300048919 Bacteria 9173
315 Ga0496118_0051930 3300048921 Bacteria 3132
316 Ga0496119_0060372 3300048922 Bacteria 2270
317 Ga0496120_0032986 3300048923 Bacteria 3115
318 Ga0496121_0001370 3300048924 Bacteria 41492
319 Ga0496122_0000821 3300048925 Bacteria 59417
320 Ga0496123_0000872 3300048926 Bacteria 47911
321 Ga0496124_0227351 3300048927 Bacteria 1398
322 Ga0496125_0000884 3300048928 Bacteria 47543
323 Ga0496125_0029732 3300048928 Bacteria 4903
324 Ga0495678_000009 3300049459 Bacteria 373806
325 Ga0495678_000215 3300049459 Bacteria 66940
326 Ga0495678_000870 3300049459 Bacteria 26857
327 Ga0495682_0006118 3300049460 Bacteria 4908
328 Ga0495682_0007946 3300049460 Bacteria 4194
329 Ga0501031_0000294 3300049568 Bacteria 28430
330 Ga0501032_0000076 3300049569 Bacteria 83609
331 Ga0501033_0000093 3300049570 Bacteria 85243
332 Ga0501034_0001640 3300049571 Bacteria 28905
333 Ga0501036_0000035 3300049572 Bacteria 88062
334 Ga0501037_0000026 3300049573 Bacteria 142936
335 Ga0501038_0000037 3300049574 Bacteria 124444
336 Ga0501039_0000263 3300049575 Bacteria 38312
337 Ga0501043_0000115 3300049579 Bacteria 75659
338 Ga0501046_0000210 3300049580 Bacteria 60801
339 Ga0501047_0000094 3300049581 Bacteria 109928
340 Ga0501067_0031381 3300049583 Bacteria 2948
341 Ga0501068_0001202 3300049584 Bacteria 13764
342 Ga0501069_0008138 3300049585 Bacteria 5509
343 Ga0501070_0000134 3300049586 Bacteria 66993
344 Ga0501071_0025860 3300049587 Bacteria 4115
345 Ga0501072_0317717 3300049588 Bacteria 1238
346 Ga0501073_0001636 3300049589 Bacteria 16614
347 Ga0501074_0023502 3300049590 Bacteria 4480
348 Ga0501079_0009992 3300049741 Bacteria 7204
349 Ga0501080_0000076 3300049742 Bacteria 66341
350 Ga0501035_0000533 3300049822 Bacteria 42510
351 Ga0501044_0000507 3300049823 Bacteria 47418
352 nmdc:mga03683_18703_c1 3300050489 Bacteria 2637
353 nmdc:mga00v17_22087_c1 3300050491 Bacteria 3667
354 nmdc:mga0yw44_32210_c1 3300050492 Bacteria 3053
355 nmdc:mga0k408_12545_c1 3300050493 Bacteria 4635
356 nmdc:mga0k408_133_c1 3300050493 Bacteria 36991
357 nmdc:mga0k408_2173_c2 3300050493 Bacteria 6893
358 nmdc:mga0k408_38001_c1 3300050493 Bacteria 2764
359 nmdc:mga0k408_86409_c1 3300050493 Bacteria 1841
360 nmdc:mga06z11_3475_c1 3300050494 Bacteria 6102
361 nmdc:mga04h51_20157_c1 3300050495 Bacteria 1987
362 nmdc:mga07m45_127_c1 3300050496 Bacteria 30414
363 nmdc:mga07m45_43916_c1 3300050496 Bacteria 2507
364 nmdc:mga05p37_86214_c1 3300050507 Bacteria 3870
365 Ga0500610_0000055 3300053079 Bacteria 36032
366 Ga0495619_0035263 3300053085 Bacteria 3254
367 Ga0500643_010591 3300053087 Bacteria 3420
368 Ga0500644_0001772 3300053088 Bacteria 5586
369 Ga0500651_0000242 3300053093 Bacteria 33458
370 Ga0500556_0000005 3300053104 Bacteria 581135
371 Ga0500562_000225 3300053108 Bacteria 14909
372 Ga0500562_005122 3300053108 Bacteria 3294
373 Ga0500571_000184 3300053110 Bacteria 22472
374 Ga0500593_000097 3300053117 Bacteria 32867
375 Ga0500593_003350 3300053117 Bacteria 6035
376 Ga0500594_0000393 3300053118 Bacteria 9759
377 Ga0500594_0003320 3300053118 Bacteria 3523
378 Ga0500607_000049 3300053121 Bacteria 80941
379 Ga0500608_000783 3300053122 Bacteria 11596
380 Ga0500618_000173 3300053125 Bacteria 53346
381 Ga0500618_007885 3300053125 Bacteria 3006
382 Ga0500626_021083 3300053128 Bacteria 2902
383 Ga0500642_0000006 3300053130 Bacteria 350064
384 Ga0500652_029224 3300053131 Bacteria 2148
385 Ga0500655_016179 3300053133 Bacteria 1372
386 Ga0500658_0000028 3300053134 Bacteria 105688
387 Ga0500658_0003984 3300053134 Bacteria 5545
388 Ga0500559_0000067 3300053136 Bacteria 83330
389 Ga0500559_0001694 3300053136 Bacteria 12147
390 Ga0500559_0003971 3300053136 Bacteria 7123
391 Ga0500564_028515 3300053138 Bacteria 2570
392 Ga0500574_000767 3300053141 Bacteria 4310
393 Ga0500586_000727 3300053145 Bacteria 6760
394 Ga0500590_036677 3300053148 Bacteria 2535
395 Ga0500619_017417 3300053154 Bacteria 1998
396 Ga0500622_0000060 3300053156 Bacteria 133737
397 Ga0500627_0001347 3300053158 Bacteria 6800
398 Ga0500634_0003729 3300053161 Bacteria 6872
399 Ga0500634_0011269 3300053161 Bacteria 4606
400 Ga0500638_005215 3300053162 Bacteria 5137
401 Ga0500636_0023196 3300053177 Bacteria 3668
402 Ga0500636_0114562 3300053177 Bacteria 1519
403 Ga0500587_002697 3300053739 Bacteria 2515
404 Ga0500661_003998 3300055283 Bacteria 2759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100343337 Ga0207675_1003433371 346
2 3300046524 Ga0495648_0003813 Ga0495648_0003813_5921_7096 350
3 3300037471 Ga0395905_0154779 Ga0395905_0154779_221_1381 351
4 3300036712 Ga0316584_0022273 Ga0316584_0022273_2512_3672 352
5 3300047443 Ga0495687_001099 Ga0495687_001099_6173_7333 355
6 3300047443 Ga0495687_001273 Ga0495687_001273_6168_7328 355
7 3300006048 Ga0075363_100024058 Ga0075363_1000240582 357
8 3300006051 Ga0075364_10032521 Ga0075364_100325213 357
9 3300006178 Ga0075367_10095159 Ga0075367_100951592 357
10 3300006186 Ga0075369_10048692 Ga0075369_100486922 357
11 3300006353 Ga0075370_10025251 Ga0075370_100252513 357
12 3300009093 Ga0105240_10320884 Ga0105240_103208842 357
13 3300050491 nmdc:mga00v17_22087_c1 nmdc:mga00v17_22087_c1_942_2102 357
14 3300050492 nmdc:mga0yw44_32210_c1 nmdc:mga0yw44_32210_c1_1026_2186 357
15 3300050493 nmdc:mga0k408_12545_c1 nmdc:mga0k408_12545_c1_1694_2854 357
16 3300050493 nmdc:mga0k408_133_c1 nmdc:mga0k408_133_c1_3760_4920 357
17 3300050494 nmdc:mga06z11_3475_c1 nmdc:mga06z11_3475_c1_1412_2572 357
18 3300050495 nmdc:mga04h51_20157_c1 nmdc:mga04h51_20157_c1_10_1170 357
19 3300050496 nmdc:mga07m45_127_c1 nmdc:mga07m45_127_c1_9719_10879 357
20 3300046528 Ga0495642_0119311 Ga0495642_0119311_28_1104 358
21 3300047472 Ga0495686_0117012 Ga0495686_0117012_280_1383 358
22 3300005338 Ga0068868_100094776 Ga0068868_1000947762 359
23 3300026023 Ga0207677_10024064 Ga0207677_100240644 359
24 3300031507 Ga0307509_10286269 Ga0307509_102862692 359
25 3300031616 Ga0307508_10041135 Ga0307508_100411353 359
26 3300046471 Ga0495650_0000001 Ga0495650_0000001_692315_693484 359
27 3300048091 Ga0495626_0003695 Ga0495626_0003695_7093_8262 361
28 3300009098 Ga0105245_10147538 Ga0105245_101475383 362
29 3300009174 Ga0105241_10071656 Ga0105241_100716562 362
30 3300014969 Ga0157376_10001974 Ga0157376_1000197410 362
31 3300025927 Ga0207687_10056676 Ga0207687_100566764 362
32 3300025927 Ga0207687_10078852 Ga0207687_100788522 362
33 3300025986 Ga0207658_10017295 Ga0207658_100172955 362
34 3300006353 Ga0075370_10067824 Ga0075370_100678242 363
35 3300046530 Ga0495654_0002363 Ga0495654_0002363_9767_10873 365
36 3300046558 Ga0495633_0019390 Ga0495633_0019390_2013_3119 365
37 3300049460 Ga0495682_0007946 Ga0495682_0007946_1085_2191 365
38 3300027876 Ga0209974_10006173 Ga0209974_100061735 366
39 3300028794 Ga0307515_10000893 Ga0307515_1000089314 366
40 3300046538 Ga0495609_0001143 Ga0495609_0001143_16902_18083 366
41 3300047470 Ga0495681_0022987 Ga0495681_0022987_1493_2674 366
42 3300002774 JGI25150J39212_1007017 JGI25150J39212_10070173 367
43 3300025245 Ga0207425_1001011 Ga0207425_10010118 367
44 3300025294 Ga0209025_1006776 Ga0209025_10067763 367
45 3300025297 Ga0209758_1000679 Ga0209758_100067932 367
46 3300046471 Ga0495650_0006827 Ga0495650_0006827_4939_6078 367
47 3300046475 Ga0495639_0010678 Ga0495639_0010678_2782_3921 367
48 3300046506 Ga0495583_0000058 Ga0495583_0000058_1405_2544 367
49 3300046557 Ga0495622_0003623 Ga0495622_0003623_3332_4471 367
50 3300046457 Ga0495590_0000001 Ga0495590_0000001_341882_343042 368
51 3300046522 Ga0495643_0000044 Ga0495643_0000044_49369_50529 368
52 3300046542 Ga0495597_0000115 Ga0495597_0000115_53539_54699 368
53 3300046616 Ga0495668_0000045 Ga0495668_0000045_34823_35983 368
54 3300047469 Ga0495673_0000061 Ga0495673_0000061_160615_161787 368
55 3300046524 Ga0495648_0000001 Ga0495648_0000001_506185_507345 369
56 3300046528 Ga0495642_0000401 Ga0495642_0000401_11476_12636 369
57 3300046538 Ga0495609_0002960 Ga0495609_0002960_6595_7755 369
58 3300046660 Ga0495625_0000065 Ga0495625_0000065_138515_139675 369
59 3300046810 Ga0495660_0010686 Ga0495660_0010686_4025_5185 369
60 3300048927 Ga0496124_0227351 Ga0496124_0227351_130_1311 369
61 3300028786 Ga0307517_10000160 Ga0307517_1000016044 370
62 3300031507 Ga0307509_10000317 Ga0307509_1000031722 370
63 3300046491 Ga0495584_0047944 Ga0495584_0047944_871_2040 370
64 3300046520 Ga0495637_0018995 Ga0495637_0018995_886_2055 370
65 3300031649 Ga0307514_10001713 Ga0307514_100017138 371
66 3300044712 Ga0453684_0038152 Ga0453684_0038152_5323_6495 371
67 3300046471 Ga0495650_0000289 Ga0495650_0000289_48786_49925 371
68 3300046506 Ga0495583_0000127 Ga0495583_0000127_22358_23527 371
69 3300047446 Ga0495679_002037 Ga0495679_002037_8089_9228 371
70 3300048922 Ga0496119_0060372 Ga0496119_0060372_12_1151 371
71 3300053145 Ga0500586_000727 Ga0500586_000727_1585_2724 371
72 3300053148 Ga0500590_036677 Ga0500590_036677_1375_2520 371
73 3300053177 Ga0500636_0023196 Ga0500636_0023196_481_1626 371
74 3300046558 Ga0495633_0003990 Ga0495633_0003990_5026_6198 372
75 3300002987 JGI25159J45721_1003080 JGI25159J45721_10030803 374
76 3300003791 Ga0055530_10000532 Ga0055530_1000053234 374
77 3300003792 Ga0055540_1000047 Ga0055540_100004735 374
78 3300003794 Ga0055531_10010150 Ga0055531_100101505 374
79 3300025284 Ga0209130_1000346 Ga0209130_100034635 374
80 3300025292 Ga0209676_1000073 Ga0209676_1000073216 374
81 3300025298 Ga0209050_1000008 Ga0209050_1000008847 374
82 3300025302 Ga0207426_1001354 Ga0207426_100135427 374
83 3300025303 Ga0209051_1000005 Ga0209051_1000005847 374
84 3300025304 Ga0209257_1000031 Ga0209257_1000031437 374
85 3300037068 Ga0373925_0057822 Ga0373925_0057822_1529_2689 374
86 3300028794 Ga0307515_10000332 Ga0307515_1000033223 375
87 3300046453 Ga0495627_000015 Ga0495627_000015_227788_228969 375
88 3300046492 Ga0495585_0000587 Ga0495585_0000587_19509_20681 375
89 3300046674 Ga0495588_0049131 Ga0495588_0049131_532_1704 375
90 3300046810 Ga0495660_0027838 Ga0495660_0027838_1332_2513 375
91 3300049459 Ga0495678_000009 Ga0495678_000009_104188_105369 375
92 3300050507 nmdc:mga05p37_86214_c1 nmdc:mga05p37_86214_c1_572_1741 375
93 3300053085 Ga0495619_0035263 Ga0495619_0035263_1604_2752 375
94 3300006048 Ga0075363_100045287 Ga0075363_1000452872 376
95 3300030522 Ga0307512_10041345 Ga0307512_100413454 376
96 3300031507 Ga0307509_10001515 Ga0307509_1000151522 376
97 3300031616 Ga0307508_10006375 Ga0307508_100063758 376
98 3300033179 Ga0307507_10084452 Ga0307507_100844522 376
99 3300042007 Ga0439449_0001455 Ga0439449_0001455_1190_2326 376
100 3300046454 Ga0495592_0000175 Ga0495592_0000175_21637_22797 376
101 3300046460 Ga0495638_0009812 Ga0495638_0009812_2104_3276 376
102 3300046474 Ga0495605_0025997 Ga0495605_0025997_970_2142 376
103 3300046491 Ga0495584_0022844 Ga0495584_0022844_904_2076 376
104 3300046492 Ga0495585_0012347 Ga0495585_0012347_1393_2565 376
105 3300046501 Ga0495607_0050545 Ga0495607_0050545_863_2035 376
106 3300046506 Ga0495583_0000014 Ga0495583_0000014_108777_109949 376
107 3300046513 Ga0495616_0000982 Ga0495616_0000982_8105_9277 376
108 3300046523 Ga0495644_0000087 Ga0495644_0000087_32678_33850 376
109 3300046524 Ga0495648_0000476 Ga0495648_0000476_6747_7919 376
110 3300046524 Ga0495648_0023383 Ga0495648_0023383_2552_3712 376
111 3300046538 Ga0495609_0005276 Ga0495609_0005276_1608_2780 376
112 3300046558 Ga0495633_0004607 Ga0495633_0004607_7421_8593 376
113 3300046615 Ga0495656_0016114 Ga0495656_0016114_1480_2652 376
114 3300046648 Ga0495611_0002144 Ga0495611_0002144_4809_5981 376
115 3300046660 Ga0495625_0015337 Ga0495625_0015337_4037_5209 376
116 3300046664 Ga0495659_0000041 Ga0495659_0000041_40315_41454 376
117 3300046664 Ga0495659_0000243 Ga0495659_0000243_13227_14399 376
118 3300046680 Ga0495646_0005993 Ga0495646_0005993_3438_4598 376
119 3300046691 Ga0495670_0000064 Ga0495670_0000064_12871_14043 376
120 3300046692 Ga0495671_0002461 Ga0495671_0002461_662_1834 376
121 3300046794 Ga0495589_0030122 Ga0495589_0030122_1116_2288 376
122 3300047318 Ga0495636_0000361 Ga0495636_0000361_1098_2270 376
123 3300047320 Ga0495672_0080627 Ga0495672_0080627_607_1779 376
124 3300047323 Ga0495683_0005381 Ga0495683_0005381_5509_6681 376
125 3300047443 Ga0495687_000603 Ga0495687_000603_34242_35414 376
126 3300047445 Ga0495677_0000790 Ga0495677_0000790_9617_10789 376
127 3300047446 Ga0495679_000296 Ga0495679_000296_26021_27160 376
128 3300047447 Ga0495685_001654 Ga0495685_001654_1418_2590 376
129 3300049459 Ga0495678_000870 Ga0495678_000870_17166_18338 376
130 3300050493 nmdc:mga0k408_2173_c2 nmdc:mga0k408_2173_c2_4700_5866 376
131 3300050496 nmdc:mga07m45_43916_c1 nmdc:mga07m45_43916_c1_527_1693 376
132 3300053118 Ga0500594_0003320 Ga0500594_0003320_1573_2733 376
133 3300053131 Ga0500652_029224 Ga0500652_029224_633_1793 376
134 3300053133 Ga0500655_016179 Ga0500655_016179_55_1215 376
135 3300053136 Ga0500559_0001694 Ga0500559_0001694_9688_10848 376
136 3300053154 Ga0500619_017417 Ga0500619_017417_46_1206 376
137 3300042876 Ga0451577_0083621 Ga0451577_0083621_635_1786 377
138 3300006871 Ga0075434_100139155 Ga0075434_1001391553 378
139 3300048919 Ga0496116_0008118 Ga0496116_0008118_6132_7292 378
140 3300048925 Ga0496122_0000821 Ga0496122_0000821_9360_10520 378
141 3300048926 Ga0496123_0000872 Ga0496123_0000872_26966_28126 378
142 3300053161 Ga0500634_0003729 Ga0500634_0003729_3651_4805 378
143 iso_pu_bacteria 2597490356 2599105362 378
144 iso_pu_bacteria 2643221646 2644257491 378
145 iso_pu_bacteria 2846952575 2846954956 378
146 iso_pu_bacteria 2848858292 2848858754 378
147 3300006175 Ga0070712_100000946 Ga0070712_10000094611 379
148 3300025915 Ga0207693_10045852 Ga0207693_100458522 379
149 3300037312 Ga0395899_0000953 Ga0395899_0000953_23933_25084 379
150 3300037418 Ga0395900_0006634 Ga0395900_0006634_3611_4762 379
151 iso_pu_bacteria 2599185292 2599907663 379
152 iso_pu_bacteria 2643221569 2643858721 379
153 iso_pu_bacteria 2857537821 2857540155 379
154 iso_pu_bacteria 2941479691 2941480016 379
155 3300037471 Ga0395905_0115052 Ga0395905_0115052_1038_2186 380
156 3300039447 Ga0436361_1001773 Ga0436361_1001773_176_1348 380
157 3300041406 Ga0439439_0035542 Ga0439439_0035542_115_1263 380
158 3300041999 Ga0439433_0014926 Ga0439433_0014926_354_1502 380
159 3300046460 Ga0495638_0009094 Ga0495638_0009094_2887_4062 380
160 3300046530 Ga0495654_0007163 Ga0495654_0007163_1689_2864 380
161 3300046691 Ga0495670_0000065 Ga0495670_0000065_33536_34711 380
162 3300046692 Ga0495671_0001577 Ga0495671_0001577_13767_14942 380
163 3300049568 Ga0501031_0000294 Ga0501031_0000294_21706_22878 380
164 3300049569 Ga0501032_0000076 Ga0501032_0000076_55106_56278 380
165 3300049570 Ga0501033_0000093 Ga0501033_0000093_28966_30138 380
166 3300049571 Ga0501034_0001640 Ga0501034_0001640_5213_6385 380
167 3300049572 Ga0501036_0000035 Ga0501036_0000035_31787_32959 380
168 3300049573 Ga0501037_0000026 Ga0501037_0000026_27571_28743 380
169 3300049574 Ga0501038_0000037 Ga0501038_0000037_55079_56251 380
170 3300049575 Ga0501039_0000263 Ga0501039_0000263_17735_18907 380
171 3300049579 Ga0501043_0000115 Ga0501043_0000115_19408_20580 380
172 3300049580 Ga0501046_0000210 Ga0501046_0000210_19380_20552 380
173 3300049581 Ga0501047_0000094 Ga0501047_0000094_32398_33570 380
174 3300049583 Ga0501067_0031381 Ga0501067_0031381_877_2049 380
175 3300049584 Ga0501068_0001202 Ga0501068_0001202_7685_8857 380
176 3300049585 Ga0501069_0008138 Ga0501069_0008138_2472_3644 380
177 3300049586 Ga0501070_0000134 Ga0501070_0000134_32494_33666 380
178 3300049587 Ga0501071_0025860 Ga0501071_0025860_1665_2837 380
179 3300049588 Ga0501072_0317717 Ga0501072_0317717_42_1214 380
180 3300049589 Ga0501073_0001636 Ga0501073_0001636_12194_13366 380
181 3300049590 Ga0501074_0023502 Ga0501074_0023502_1394_2566 380
182 3300049741 Ga0501079_0009992 Ga0501079_0009992_4706_5878 380
183 3300049742 Ga0501080_0000076 Ga0501080_0000076_13847_15019 380
184 3300049822 Ga0501035_0000533 Ga0501035_0000533_19408_20580 380
185 3300049823 Ga0501044_0000507 Ga0501044_0000507_13848_15020 380
186 3300053087 Ga0500643_010591 Ga0500643_010591_959_2134 380
187 3300053088 Ga0500644_0001772 Ga0500644_0001772_2677_3852 380
188 3300053104 Ga0500556_0000005 Ga0500556_0000005_252244_253419 380
189 3300053108 Ga0500562_000225 Ga0500562_000225_3246_4421 380
190 3300053122 Ga0500608_000783 Ga0500608_000783_9887_11062 380
191 3300053125 Ga0500618_007885 Ga0500618_007885_1723_2898 380
192 3300053130 Ga0500642_0000006 Ga0500642_0000006_125285_126460 380
193 3300053134 Ga0500658_0003984 Ga0500658_0003984_702_1877 380
194 3300053136 Ga0500559_0000067 Ga0500559_0000067_52146_53321 380
195 3300053156 Ga0500622_0000060 Ga0500622_0000060_124036_125211 380
196 3300053177 Ga0500636_0114562 Ga0500636_0114562_258_1433 380
197 iso_pu_bacteria 2510065045 2510251131 380
198 iso_pu_bacteria 2512047030 2512351943 380
199 iso_pu_bacteria 2585428062 2587758678 380
200 iso_pu_bacteria 2718217991 2719640263 380
201 iso_pu_bacteria 2895511927 2895517353 380
202 3300005289 Ga0065704_10012889 Ga0065704_100128892 381
203 3300005338 Ga0068868_100002606 Ga0068868_1000026065 381
204 3300005563 Ga0068855_100047998 Ga0068855_1000479985 381
205 3300026023 Ga0207677_10001179 Ga0207677_100011799 381
206 3300031240 Ga0265320_10013483 Ga0265320_100134831 381
207 3300031548 Ga0307408_100064073 Ga0307408_1000640733 381
208 3300031711 Ga0265314_10028927 Ga0265314_100289273 381
209 3300036712 Ga0316584_0041093 Ga0316584_0041093_1157_2320 381
210 3300042116 Ga0450912_000785 Ga0450912_000785_339_1490 381
211 3300046512 Ga0495610_0000008 Ga0495610_0000008_585641_586813 381
212 3300046522 Ga0495643_0000330 Ga0495643_0000330_13826_14998 381
213 3300046524 Ga0495648_0001508 Ga0495648_0001508_7326_8498 381
214 3300046530 Ga0495654_0045998 Ga0495654_0045998_881_2053 381
215 3300046542 Ga0495597_0000996 Ga0495597_0000996_12530_13702 381
216 3300046692 Ga0495671_0001101 Ga0495671_0001101_9420_10592 381
217 3300046810 Ga0495660_0030060 Ga0495660_0030060_926_2098 381
218 3300047320 Ga0495672_0000918 Ga0495672_0000918_23136_24308 381
219 3300047469 Ga0495673_0000926 Ga0495673_0000926_9309_10481 381
220 3300049459 Ga0495678_000215 Ga0495678_000215_15697_16869 381
221 iso_pu_bacteria 2842333319 2842333952 381
222 iso_pu_bacteria 2858688981 2858695763 381
223 3300025292 Ga0209676_1008787 Ga0209676_10087872 382
224 3300025298 Ga0209050_1004596 Ga0209050_10045967 382
225 3300031911 Ga0307412_10001460 Ga0307412_100014606 382
226 3300035398 Ga0316574_0000501 Ga0316574_0000501_5597_6775 382
227 3300036647 Ga0316582_0171519 Ga0316582_0171519_67_1245 382
228 3300036712 Ga0316584_0003032 Ga0316584_0003032_4233_5411 382
229 3300044673 Ga0453683_0036755 Ga0453683_0036755_56_1231 382
230 3300048921 Ga0496118_0051930 Ga0496118_0051930_155_1330 382
231 3300048928 Ga0496125_0029732 Ga0496125_0029732_341_1516 382
232 iso_pu_bacteria 2738541280 2738739725 382
233 iso_pu_bacteria 2738541297 2738830459 382
234 iso_pu_bacteria 2738541357 2739154255 382
235 iso_pu_bacteria 2738543003 2739196212 382
236 iso_pu_bacteria 2738543026 2739322651 382
237 iso_pu_bacteria 2738543029 2739340892 382
238 iso_pu_bacteria 2897803580 2897804103 382
239 3300031251 Ga0265327_10016954 Ga0265327_100169542 383
240 3300037471 Ga0395905_0021175 Ga0395905_0021175_265_1422 383
241 3300042435 Ga0439434_0043195 Ga0439434_0043195_70_1230 383
242 3300048916 Ga0496113_0133633 Ga0496113_0133633_97_1257 383
243 3300003187 JGI25151J46595_10006031 JGI25151J46595_100060317 384
244 3300003773 Ga0055537_1000047 Ga0055537_100004739 384
245 3300003775 Ga0055524_1000039 Ga0055524_100003945 384
246 3300003784 Ga0055534_1000141 Ga0055534_100014122 384
247 3300003790 Ga0055528_1002521 Ga0055528_10025216 384
248 3300005331 Ga0070670_100258164 Ga0070670_1002581642 384
249 3300005355 Ga0070671_100034118 Ga0070671_1000341184 384
250 3300005364 Ga0070673_100086947 Ga0070673_1000869473 384
251 3300005366 Ga0070659_100320792 Ga0070659_1003207921 384
252 3300005543 Ga0070672_100010739 Ga0070672_1000107395 384
253 3300005840 Ga0068870_10026651 Ga0068870_100266513 384
254 3300009148 Ga0105243_10266514 Ga0105243_102665141 384
255 3300013306 Ga0163162_10467452 Ga0163162_104674521 384
256 3300025263 Ga0209565_1000080 Ga0209565_100008040 384
257 3300025273 Ga0209673_1000088 Ga0209673_1000088106 384
258 3300025291 Ga0209675_1000133 Ga0209675_100013380 384
259 3300025294 Ga0209025_1004730 Ga0209025_100473012 384
260 3300025295 Ga0209564_1000313 Ga0209564_100031344 384
261 3300025295 Ga0209564_1000823 Ga0209564_100082317 384
262 3300025299 Ga0209256_1000096 Ga0209256_1000096101 384
263 3300025907 Ga0207645_10013156 Ga0207645_100131563 384
264 3300025908 Ga0207643_10009830 Ga0207643_100098305 384
265 3300025925 Ga0207650_10048034 Ga0207650_100480341 384
266 3300025935 Ga0207709_10145991 Ga0207709_101459912 384
267 3300026089 Ga0207648_10019036 Ga0207648_100190364 384
268 3300027526 Ga0209968_1000702 Ga0209968_10007026 384
269 3300027695 Ga0209966_1000040 Ga0209966_100004037 384
270 3300028794 Ga0307515_10033807 Ga0307515_100338078 384
271 3300028794 Ga0307515_10080735 Ga0307515_100807353 384
272 3300031456 Ga0307513_10003528 Ga0307513_100035282 384
273 3300031616 Ga0307508_10000332 Ga0307508_100003325 384
274 3300033179 Ga0307507_10003609 Ga0307507_1000360928 384
275 3300037471 Ga0395905_0018561 Ga0395905_0018561_927_2093 384
276 3300041997 Ga0439431_0010323 Ga0439431_0010323_770_1930 384
277 3300042012 Ga0439455_0003947 Ga0439455_0003947_933_2093 384
278 3300046512 Ga0495610_0022203 Ga0495610_0022203_665_1825 384
279 3300046515 Ga0495620_0027879 Ga0495620_0027879_47_1207 384
280 3300046660 Ga0495625_0010801 Ga0495625_0010801_672_1832 384
281 3300053739 Ga0500587_002697 Ga0500587_002697_380_1540 384
282 iso_pu_bacteria 2739367655 2739611165 384
283 3300045051 Ga0451576_0397885 Ga0451576_0397885_174_1358 385
284 3300046615 Ga0495656_0001972 Ga0495656_0001972_1465_2634 385
285 3300047318 Ga0495636_0005816 Ga0495636_0005816_1124_2293 385
286 3300047318 Ga0495636_0078504 Ga0495636_0078504_23_1192 385
287 3300048090 Ga0495615_0002597 Ga0495615_0002597_200_1369 385
288 iso_pu_bacteria 2551306416 2553004591 385
289 iso_pu_bacteria 2923510766 2923515419 385
290 3300037312 Ga0395899_0000439 Ga0395899_0000439_37813_38985 386
291 3300037418 Ga0395900_0071210 Ga0395900_0071210_1304_2476 386
292 3300037418 Ga0395900_0124974 Ga0395900_0124974_959_2131 386
293 3300037418 Ga0395900_0328642 Ga0395900_0328642_306_1478 386
294 3300037466 Ga0395898_0086707 Ga0395898_0086707_1745_2917 386
295 3300037471 Ga0395905_0005906 Ga0395905_0005906_5302_6474 386
296 3300038443 Ga0395901_0041590 Ga0395901_0041590_1386_2558 386
297 3300042156 Ga0439446_0011968 Ga0439446_0011968_218_1381 386
298 3300044683 Ga0466965_0008498 Ga0466965_0008498_565_1737 386
299 3300044684 Ga0466966_0026160 Ga0466966_0026160_887_2059 386
300 3300044706 Ga0466964_0017669 Ga0466964_0017669_758_1930 386
301 3300046460 Ga0495638_0022826 Ga0495638_0022826_477_1649 386
302 3300046463 Ga0495653_0000009 Ga0495653_0000009_210142_211314 386
303 3300046471 Ga0495650_0000164 Ga0495650_0000164_21130_22302 386
304 3300046491 Ga0495584_0000179 Ga0495584_0000179_39281_40453 386
305 3300046492 Ga0495585_0005376 Ga0495585_0005376_5912_7084 386
306 3300046501 Ga0495607_0003055 Ga0495607_0003055_8733_9905 386
307 3300046506 Ga0495583_0003009 Ga0495583_0003009_5526_6698 386
308 3300046512 Ga0495610_0001018 Ga0495610_0001018_17388_18560 386
309 3300046520 Ga0495637_0033270 Ga0495637_0033270_493_1665 386
310 3300046523 Ga0495644_0000030 Ga0495644_0000030_12200_13372 386
311 3300046524 Ga0495648_0001285 Ga0495648_0001285_1673_2845 386
312 3300046524 Ga0495648_0041837 Ga0495648_0041837_607_1779 386
313 3300046530 Ga0495654_0000058 Ga0495654_0000058_103959_105131 386
314 3300046538 Ga0495609_0082688 Ga0495609_0082688_217_1389 386
315 3300046557 Ga0495622_0000088 Ga0495622_0000088_73052_74224 386
316 3300046558 Ga0495633_0000521 Ga0495633_0000521_20917_22089 386
317 3300046615 Ga0495656_0006352 Ga0495656_0006352_851_2023 386
318 3300046616 Ga0495668_0000193 Ga0495668_0000193_37225_38397 386
319 3300046648 Ga0495611_0000439 Ga0495611_0000439_7359_8531 386
320 3300046684 Ga0495669_0019761 Ga0495669_0019761_278_1450 386
321 3300046692 Ga0495671_0000002 Ga0495671_0000002_1109035_1110207 386
322 3300046694 Ga0495649_0000166 Ga0495649_0000166_43345_44517 386
323 3300047318 Ga0495636_0000067 Ga0495636_0000067_38027_39199 386
324 3300047320 Ga0495672_0001603 Ga0495672_0001603_12958_14130 386
325 3300047443 Ga0495687_000566 Ga0495687_000566_38149_39321 386
326 3300047445 Ga0495677_0000512 Ga0495677_0000512_7119_8291 386
327 3300047445 Ga0495677_0001444 Ga0495677_0001444_4352_5524 386
328 3300049460 Ga0495682_0006118 Ga0495682_0006118_3129_4301 386
329 3300053125 Ga0500618_000173 Ga0500618_000173_43078_44250 386
330 3300025942 Ga0207689_10295779 Ga0207689_102957792 387
331 3300031730 Ga0307516_10004792 Ga0307516_100047924 387
332 3300041512 Ga0451853_1322005 Ga0451853_1322005_375_1580 387
333 iso_pu_bacteria 2643221628 2644159022 387
334 iso_pu_bacteria 2643221658 2644328658 387
335 iso_pu_bacteria 2738541277 2738723714 387
336 iso_pu_bacteria 2738543019 2739284445 387
337 3300030500 Ga0268256_1010329 Ga0268256_10103292 389
338 3300048923 Ga0496120_0032986 Ga0496120_0032986_1210_2454 389
339 3300048924 Ga0496121_0001370 Ga0496121_0001370_34473_35717 389
340 3300048928 Ga0496125_0000884 Ga0496125_0000884_21869_23113 389
341 iso_pu_bacteria 2511231002 2511242548 389
342 3300003187 JGI25151J46595_10006574 JGI25151J46595_100065741 391
343 3300003761 Ga0055535_1000222 Ga0055535_100022211 391
344 3300003762 Ga0055542_1000266 Ga0055542_100026654 391
345 3300003773 Ga0055537_1000024 Ga0055537_1000024111 391
346 3300003784 Ga0055534_1000032 Ga0055534_1000032117 391
347 3300003790 Ga0055528_1002122 Ga0055528_10021226 391
348 3300003791 Ga0055530_10024447 Ga0055530_100244471 391
349 3300005262 Ga0065165_1005321 Ga0065165_10053211 391
350 3300006038 Ga0075365_10001914 Ga0075365_100019144 391
351 3300006058 Ga0075432_10045250 Ga0075432_100452501 391
352 3300006195 Ga0075366_10053195 Ga0075366_100531952 391
353 3300006353 Ga0075370_10027500 Ga0075370_100275003 391
354 3300025228 Ga0209672_100367 Ga0209672_10036712 391
355 3300025229 Ga0209147_100377 Ga0209147_10037726 391
356 3300025242 Ga0209258_100374 Ga0209258_10037454 391
357 3300025254 Ga0209148_1000358 Ga0209148_100035854 391
358 3300025258 Ga0209129_1008680 Ga0209129_10086802 391
359 3300025263 Ga0209565_1000039 Ga0209565_1000039117 391
360 3300025273 Ga0209673_1000284 Ga0209673_100028413 391
361 3300025291 Ga0209675_1000030 Ga0209675_1000030117 391
362 3300025294 Ga0209025_1002084 Ga0209025_10020844 391
363 3300031649 Ga0307514_10002158 Ga0307514_1000215820 391
364 3300031901 Ga0307406_10127434 Ga0307406_101274342 391
365 3300041404 Ga0439436_0011244 Ga0439436_0011244_159_1337 391
366 3300042002 Ga0439442_000420 Ga0439442_000420_3095_4273 391
367 3300042125 Ga0450923_001850 Ga0450923_001850_1446_2624 391
368 3300042145 Ga0450906_001353 Ga0450906_001353_2920_4098 391
369 3300042147 Ga0450910_001018 Ga0450910_001018_2082_3260 391
370 3300042184 Ga0450908_000762 Ga0450908_000762_2292_3470 391
371 3300042435 Ga0439434_0012818 Ga0439434_0012818_549_1727 391
372 3300042531 Ga0450918_000746 Ga0450918_000746_422_1600 391
373 3300046453 Ga0495627_025580 Ga0495627_025580_275_1453 391
374 3300046460 Ga0495638_0006541 Ga0495638_0006541_4520_5698 391
375 3300046512 Ga0495610_0019411 Ga0495610_0019411_382_1560 391
376 3300046513 Ga0495616_0000294 Ga0495616_0000294_13587_14765 391
377 3300046557 Ga0495622_0038154 Ga0495622_0038154_438_1616 391
378 3300046660 Ga0495625_0000224 Ga0495625_0000224_65442_66620 391
379 3300046660 Ga0495625_0024273 Ga0495625_0024273_1581_2759 391
380 3300046674 Ga0495588_0001682 Ga0495588_0001682_357_1535 391
381 3300046692 Ga0495671_0000584 Ga0495671_0000584_10109_11287 391
382 3300046810 Ga0495660_0086782 Ga0495660_0086782_388_1566 391
383 3300047321 Ga0495676_0000398 Ga0495676_0000398_23858_25036 391
384 3300047673 Ga0495593_0000083 Ga0495593_0000083_7760_8938 391
385 3300048089 Ga0495614_0001760 Ga0495614_0001760_7313_8491 391
386 3300050489 nmdc:mga03683_18703_c1 nmdc:mga03683_18703_c1_248_1426 391
387 3300050493 nmdc:mga0k408_86409_c1 nmdc:mga0k408_86409_c1_648_1826 391
388 3300053079 Ga0500610_0000055 Ga0500610_0000055_32408_33586 391
389 3300053093 Ga0500651_0000242 Ga0500651_0000242_15537_16715 391
390 3300053108 Ga0500562_005122 Ga0500562_005122_135_1313 391
391 3300053110 Ga0500571_000184 Ga0500571_000184_538_1716 391
392 3300053117 Ga0500593_000097 Ga0500593_000097_13620_14798 391
393 3300053118 Ga0500594_0000393 Ga0500594_0000393_8227_9528 391
394 3300053121 Ga0500607_000049 Ga0500607_000049_32024_33202 391
395 3300053128 Ga0500626_021083 Ga0500626_021083_996_2174 391
396 3300053134 Ga0500658_0000028 Ga0500658_0000028_87767_88945 391
397 3300053136 Ga0500559_0003971 Ga0500559_0003971_4042_5220 391
398 3300053138 Ga0500564_028515 Ga0500564_028515_977_2155 391
399 3300053141 Ga0500574_000767 Ga0500574_000767_2658_3836 391
400 3300053158 Ga0500627_0001347 Ga0500627_0001347_3343_4521 391
401 3300053161 Ga0500634_0011269 Ga0500634_0011269_700_1878 391
402 3300053162 Ga0500638_005215 Ga0500638_005215_1813_2991 391
403 3300006195 Ga0075366_10024928 Ga0075366_100249284 392
404 3300050493 nmdc:mga0k408_38001_c1 nmdc:mga0k408_38001_c1_618_1799 392
405 3300002704 JGI25155J39150_1000062 JGI25155J39150_100006251 393
406 3300002705 JGI25156J39149_1000012 JGI25156J39149_1000012155 393
407 3300002738 JGI25154J39366_1000029 JGI25154J39366_100002916 393
408 3300002741 JGI25157J39369_1000014 JGI25157J39369_1000014155 393
409 3300002987 JGI25159J45721_1000054 JGI25159J45721_100005432 393
410 3300003187 JGI25151J46595_10004424 JGI25151J46595_100044242 393
411 3300003354 JGI25160J50197_1000088 JGI25160J50197_100008865 393
412 3300003354 JGI25160J50197_1000119 JGI25160J50197_100011932 393
413 3300003374 JGI25161J50226_1000056 JGI25161J50226_100005632 393
414 3300003773 Ga0055537_1007290 Ga0055537_10072904 393
415 3300004625 Ga0055543_1001077 Ga0055543_10010777 393
416 3300006058 Ga0075432_10040334 Ga0075432_100403341 393
417 3300006177 Ga0075362_10042956 Ga0075362_100429562 393
418 3300006353 Ga0075370_10135995 Ga0075370_101359952 393
419 3300025206 Ga0209435_100002 Ga0209435_100002558 393
420 3300025208 Ga0209436_103397 Ga0209436_1033974 393
421 3300025245 Ga0207425_1020023 Ga0207425_10200232 393
422 3300025246 Ga0209646_1000001 Ga0209646_10000012701 393
423 3300025250 Ga0209026_1000040 Ga0209026_100004074 393
424 3300025256 Ga0209759_1000001 Ga0209759_10000012332 393
425 3300025263 Ga0209565_1000876 Ga0209565_100087610 393
426 3300025284 Ga0209130_1000040 Ga0209130_100004065 393
427 3300025291 Ga0209675_1000471 Ga0209675_100047113 393
428 3300025294 Ga0209025_1013516 Ga0209025_10135164 393
429 3300025297 Ga0209758_1005216 Ga0209758_10052169 393
430 3300025298 Ga0209050_1001577 Ga0209050_10015777 393
431 3300025302 Ga0207426_1000188 Ga0207426_100018865 393
432 3300041512 Ga0451853_1119332 Ga0451853_1119332_27_1241 393
433 3300053117 Ga0500593_003350 Ga0500593_003350_3756_4952 393
434 3300055283 Ga0500661_003998 Ga0500661_003998_283_1467 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

70

409

0.96

PF13433

Peripla_BP_5

Periplasmic binding protein domain

71

421

0.87

PF01094

ANF_receptor

Receptor family ligand binding region

93

391

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.9423 30 392
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.9372 30 392
4evs-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate 0.9216 32 382
4zpj-assembly1.cif.gz_A abc transporter substrate-binding protein from sphaerobacter thermophilus 0.9192 32 381
4eyk-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid 0.9127 32 385
ID Description Score Start End Superfamily
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9413 75 127 3.40.50.2300
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9304 76 127 3.40.50.2300
af_Q69L07_59_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9296 75 127 3.40.50.2300
4evrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9049 30 356 3.40.50.2300
3i45A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.903 149 272 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A536YCL7-F1-model_v4 ABC transporter substrate-binding protein 0.9712 30 393
AF-A0A537QTD2-F1-model_v4 ABC transporter substrate-binding protein 0.9696 52 393 GO:0006865
AF-A0A258JGM3-F1-model_v4 ABC transporter substrate-binding protein 0.9647 75 392 GO:0006865
AF-A0A537QTD2-F1-model_v4 ABC transporter substrate-binding protein 0.9558 52 393 GO:0006865
AF-A0A7X4IPQ6-F1-model_v4 deleted 0.954 135 390

Feature Viewer

pLDDT pTM Quality
91.28 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map