F443202

General Info

Members Datasets Scaffolds Average Seq Length
434 249 868 337

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_94440_c1|nmdc:mga06z11_94440_c1_153_1265
Length 370
Sequence MQLAMIGLGRMGANMVRRLQKAGHDCIVHDVSAAAVTSLEEEGFAGAGSLEDLVAKLDAPRHLWIMVPAAFVAGTVAKLAPLLSPGDTIIDGGNSWYRDDVDASGPLAEIGLHYLDVGTSGGVFGLERGYCLMVGGNSEAVAQMAPIFDSLAPGVASAERTPGLTGPPSTAERGWLHCGPSGAGHFVKMVHNGIEYGLMASYAEGLNILAHANIGLEEHARDAETAPLTHPEYYQYDLDLGAITEVWRRGSVVASWLLDLTAAAMNADPLLDAFEGQVSDSGEGRWTIHAAIDEGVPAPVLSAALYQRFSSRGHAGIADKVLSAMRAQFGGHIEKSEGELVDGRIKTVEEQPTEVRPSEVASQTAQAEKG

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
148 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
149 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
150 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
151 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
152 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
153 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
154 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
155 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
156 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2547132424 Nocardia nova SH22a Isolate Unclassified
246 2643221692 Nocardia sp. Root136 Isolate Unclassified
247 2739367700 Dyella sp. YR388 Isolate Unclassified
248 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
249 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0.23
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 3.92
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_94440_c1 3300050494 Bacteria 1630
2 Ga0070658_10045419 3300005327 Bacteria 3552
3 Ga0070683_100061834 3300005329 Bacteria 3481
4 Ga0070683_100101085 3300005329 Bacteria 2715
5 Ga0070680_100023937 3300005336 Bacteria 4875
6 Ga0068868_100011240 3300005338 Bacteria 6520
7 Ga0070692_10004568 3300005345 Bacteria 5795
8 Ga0070668_100038673 3300005347 Bacteria 3648
9 Ga0070675_100339721 3300005354 Bacteria 1330
10 Ga0070671_100001807 3300005355 Bacteria 16266
11 Ga0070671_100006081 3300005355 Bacteria 9619
12 Ga0070659_100006640 3300005366 Bacteria 8361
13 Ga0070659_100234345 3300005366 Bacteria 1517
14 Ga0070667_100170015 3300005367 Bacteria 1924
15 Ga0070714_100006514 3300005435 Bacteria 9028
16 Ga0070713_100310211 3300005436 Bacteria 1455
17 Ga0070701_10011059 3300005438 Bacteria 4017
18 Ga0070700_100000905 3300005441 Bacteria 14646
19 Ga0070694_100103720 3300005444 Bacteria 2015
20 Ga0070708_100013534 3300005445 Bacteria 6684
21 Ga0070662_100024826 3300005457 Bacteria 4133
22 Ga0070662_100326167 3300005457 Bacteria 1253
23 Ga0070681_10021700 3300005458 Bacteria 6439
24 Ga0070681_10153536 3300005458 Bacteria 2228
25 Ga0068867_100138996 3300005459 Bacteria 1897
26 Ga0070679_100006472 3300005530 Bacteria 10917
27 Ga0070679_100102999 3300005530 Bacteria 2840
28 Ga0070684_100154672 3300005535 Bacteria 2079
29 Ga0070684_100181538 3300005535 Bacteria 1914
30 Ga0068853_100222629 3300005539 Bacteria 1724
31 Ga0070695_100001613 3300005545 Bacteria 12630
32 Ga0070695_100002384 3300005545 Bacteria 10798
33 Ga0070696_100002164 3300005546 Bacteria 12946
34 Ga0070693_100051200 3300005547 Bacteria 2364
35 Ga0070665_100005066 3300005548 Bacteria 13672
36 Ga0070704_100004175 3300005549 Bacteria 8337
37 Ga0068855_100343845 3300005563 Bacteria 1644
38 Ga0068857_100007483 3300005577 Bacteria 9401
39 Ga0068857_100235804 3300005577 Bacteria 1674
40 Ga0068859_100001348 3300005617 Bacteria 25055
41 Ga0068859_100388664 3300005617 Bacteria 1491
42 Ga0068864_100090428 3300005618 Bacteria 2699
43 Ga0068861_100340182 3300005719 Bacteria 1313
44 Ga0068860_100003791 3300005843 Bacteria 15553
45 Ga0068860_100078561 3300005843 Bacteria 3138
46 Ga0068862_100000857 3300005844 Bacteria 29811
47 Ga0081455_10005251 3300005937 Bacteria 14238
48 Ga0081538_10002653 3300005981 Bacteria 17264
49 Ga0081538_10006298 3300005981 Bacteria 10483
50 Ga0081538_10008161 3300005981 Bacteria 8934
51 Ga0081538_10032120 3300005981 Bacteria 3526
52 Ga0081540_1026541 3300005983 Bacteria 3303
53 Ga0081539_10030876 3300005985 Bacteria 3315
54 Ga0075365_10028261 3300006038 Bacteria 3576
55 Ga0075363_100068733 3300006048 Bacteria 1921
56 Ga0075364_10009629 3300006051 Bacteria 5804
57 Ga0075364_10029585 3300006051 Bacteria 3513
58 Ga0075364_10119525 3300006051 Bacteria 1763
59 Ga0075432_10039065 3300006058 Bacteria 1654
60 Ga0070712_100000166 3300006175 Bacteria 35924
61 Ga0075367_10033396 3300006178 Bacteria 2965
62 Ga0075369_10092378 3300006186 Bacteria 1352
63 Ga0097621_100090018 3300006237 Bacteria 2567
64 Ga0068871_100108987 3300006358 Bacteria 2328
65 Ga0075428_100033770 3300006844 Bacteria 5645
66 Ga0075431_100276086 3300006847 Bacteria 1702
67 Ga0075429_100034779 3300006880 Bacteria 4379
68 Ga0068865_100096598 3300006881 Bacteria 2155
69 Ga0097620_100001348 3300006931 Bacteria 25055
70 Ga0097620_100388686 3300006931 Bacteria 1491
71 Ga0105240_10021393 3300009093 Bacteria 8604
72 Ga0111539_10115992 3300009094 Bacteria 3140
73 Ga0111539_10199506 3300009094 Bacteria 2333
74 Ga0105245_10013354 3300009098 Bacteria 7157
75 Ga0105245_10061854 3300009098 Bacteria 3376
76 Ga0105245_10253108 3300009098 Bacteria 1712
77 Ga0105245_10414192 3300009098 Bacteria 1349
78 Ga0114129_10063287 3300009147 Bacteria 5166
79 Ga0114129_10201962 3300009147 Bacteria 2692
80 Ga0105248_10224640 3300009177 Bacteria 2114
81 Ga0105249_10000689 3300009553 Bacteria 30748
82 Ga0105249_10023074 3300009553 Bacteria 5579
83 Ga0105239_10050058 3300010375 Bacteria 4583
84 Ga0105239_10103787 3300010375 Bacteria 3147
85 Ga0105246_10077926 3300011119 Bacteria 2353
86 Ga0157373_10033415 3300013100 Bacteria 3700
87 Ga0157371_10293409 3300013102 Bacteria 1176
88 Ga0157369_10006567 3300013105 Bacteria 13460
89 Ga0163162_10041190 3300013306 Bacteria 4621
90 Ga0157372_10018223 3300013307 Bacteria 7547
91 Ga0157372_10300456 3300013307 Bacteria 1867
92 Ga0163163_10002512 3300014325 Bacteria 15524
93 Ga0157377_10012433 3300014745 Bacteria 4280
94 Ga0157379_10051750 3300014968 Bacteria 3667
95 Ga0157379_10198329 3300014968 Bacteria 1815
96 Ga0163161_10244340 3300017792 Bacteria 1397
97 Ga0206353_10738461 3300020082 Bacteria 1487
98 Ga0213876_10000006 3300021384 Bacteria 700803
99 Ga0207710_10000075 3300025900 Bacteria 146077
100 Ga0207688_10009792 3300025901 Bacteria 5216
101 Ga0207707_10318769 3300025912 Bacteria 1342
102 Ga0207693_10000568 3300025915 Bacteria 33238
103 Ga0207660_10003438 3300025917 Bacteria 10326
104 Ga0207660_10410627 3300025917 Bacteria 1091
105 Ga0207652_10016668 3300025921 Bacteria 6004
106 Ga0207652_10019417 3300025921 Bacteria 5590
107 Ga0207652_10090987 3300025921 Bacteria 2682
108 Ga0207652_10182707 3300025921 Bacteria 1885
109 Ga0207681_10131571 3300025923 Bacteria 1851
110 Ga0207687_10040244 3300025927 Bacteria 3203
111 Ga0207644_10000715 3300025931 Bacteria 21084
112 Ga0207690_10035209 3300025932 Bacteria 3232
113 Ga0207690_10063945 3300025932 Bacteria 2511
114 Ga0207706_10033120 3300025933 Bacteria 4600
115 Ga0207706_10109510 3300025933 Bacteria 2431
116 Ga0207669_10034654 3300025937 Bacteria 2863
117 Ga0207704_10034807 3300025938 Bacteria 2878
118 Ga0207691_10024313 3300025940 Bacteria 5697
119 Ga0207711_10003152 3300025941 Bacteria 14373
120 Ga0207661_10034492 3300025944 Bacteria 3936
121 Ga0207667_10118603 3300025949 Bacteria 2727
122 Ga0207667_10379127 3300025949 Bacteria 1441
123 Ga0207651_10134747 3300025960 Bacteria 1898
124 Ga0207712_10000968 3300025961 Bacteria 20670
125 Ga0207712_10105774 3300025961 Bacteria 2101
126 Ga0207668_10360280 3300025972 Bacteria 1218
127 Ga0207677_10028144 3300026023 Bacteria 3550
128 Ga0207639_10173179 3300026041 Bacteria 1830
129 Ga0207678_10007443 3300026067 Bacteria 9695
130 Ga0207708_10002109 3300026075 Bacteria 14648
131 Ga0207641_10223755 3300026088 Bacteria 1746
132 Ga0207648_10038173 3300026089 Bacteria 4227
133 Ga0207676_10263723 3300026095 Bacteria 1557
134 Ga0207674_10006620 3300026116 Bacteria 13615
135 Ga0207675_100003257 3300026118 Bacteria 15900
136 Ga0207675_100263777 3300026118 Bacteria 1670
137 Ga0209971_1004463 3300027682 Bacteria 3321
138 Ga0209998_10000642 3300027717 Bacteria 9370
139 Ga0209813_10014109 3300027866 Bacteria 2146
140 Ga0209974_10006069 3300027876 Bacteria 4229
141 Ga0207428_10008731 3300027907 Bacteria 9143
142 Ga0268266_10007788 3300028379 Bacteria 9605
143 Ga0268265_10000953 3300028380 Bacteria 26598
144 Ga0268264_10029231 3300028381 Bacteria 4513
145 Ga0268264_10091493 3300028381 Bacteria 2624
146 Ga0265337_1000773 3300028556 Bacteria 16880
147 Ga0265334_10039480 3300028573 Bacteria 1852
148 Ga0265338_10006913 3300028800 Bacteria 14279
149 Ga0265338_10024317 3300028800 Bacteria 6191
150 Ga0265330_10000334 3300031235 Bacteria 33914
151 Ga0265330_10116419 3300031235 Bacteria 1140
152 Ga0265332_10000011 3300031238 Bacteria 284299
153 Ga0265320_10000112 3300031240 Bacteria 70460
154 Ga0265325_10004351 3300031241 Bacteria 8964
155 Ga0265340_10029952 3300031247 Bacteria 2731
156 Ga0265327_10002260 3300031251 Bacteria 20786
157 Ga0307508_10018086 3300031616 Bacteria 6402
158 Ga0316579_10014802 3300031691 Bacteria 3380
159 Ga0265314_10000026 3300031711 Bacteria 284299
160 Ga0265314_10015998 3300031711 Bacteria 5938
161 Ga0316578_10044451 3300031728 Bacteria 2584
162 Ga0316578_10073047 3300031728 Bacteria 2033
163 Ga0307405_10009033 3300031731 Bacteria 5091
164 Ga0307405_10068022 3300031731 Bacteria 2278
165 Ga0307410_10103768 3300031852 Bacteria 2043
166 Ga0307406_10054646 3300031901 Bacteria 2549
167 Ga0307406_10074429 3300031901 Bacteria 2236
168 Ga0307407_10173547 3300031903 Bacteria 1422
169 Ga0307412_10135156 3300031911 Bacteria 1798
170 Ga0307412_10164645 3300031911 Bacteria 1652
171 Ga0307412_10208893 3300031911 Bacteria 1488
172 Ga0307409_100002536 3300031995 Bacteria 9577
173 Ga0307409_100006733 3300031995 Bacteria 6796
174 Ga0307409_100007311 3300031995 Bacteria 6595
175 Ga0307409_100144240 3300031995 Bacteria 2056
176 Ga0307416_100007237 3300032002 Bacteria 7032
177 Ga0307416_100030743 3300032002 Bacteria 4033
178 Ga0307416_100252178 3300032002 Bacteria 1718
179 Ga0307411_10188716 3300032005 Bacteria 1572
180 Ga0307415_100000408 3300032126 Bacteria 18358
181 Ga0307415_100053379 3300032126 Bacteria 2753
182 Ga0307415_100122832 3300032126 Bacteria 1950
183 Ga0307415_100192256 3300032126 Bacteria 1611
184 Ga0373923_0046122 3300035111 Bacteria 1812
185 Ga0373939_0057082 3300035114 Bacteria 1231
186 Ga0373957_0021606 3300035120 Bacteria 2286
187 Ga0373955_0005682 3300035172 Bacteria 5617
188 Ga0373924_0059384 3300035410 Bacteria 1597
189 Ga0373931_0004827 3300035691 Bacteria 6191
190 Ga0373933_0030727 3300035724 Bacteria 3112
191 Ga0373933_0043322 3300035724 Bacteria 2663
192 Ga0373933_0181537 3300035724 Bacteria 1342
193 Ga0373937_0007086 3300036401 Bacteria 9683
194 Ga0373937_0013759 3300036401 Bacteria 7129
195 Ga0316582_0056047 3300036647 Bacteria 2513
196 Ga0395898_0034173 3300037466 Bacteria 5069
197 Ga0395901_0005805 3300038443 Bacteria 12504
198 Ga0436365_0695157 3300039437 Bacteria 511493
199 Ga0436361_0719257 3300039447 Bacteria 3130
200 Ga0451791_0601961 3300041451 Bacteria 1002
201 Ga0439445_0020970 3300042004 Bacteria 1639
202 Ga0439450_000239 3300042008 Bacteria 6675
203 Ga0439454_002916 3300042011 Bacteria 1857
204 Ga0439454_003959 3300042011 Bacteria 1681
205 Ga0439455_0016417 3300042012 Bacteria 1712
206 Ga0439463_003650 3300042016 Bacteria 3880
207 Ga0450913_000570 3300042117 Bacteria 1643
208 Ga0450914_000018 3300042118 Bacteria 3609
209 Ga0450900_000024 3300042136 Bacteria 7195
210 Ga0450902_011412 3300042137 Bacteria 1412
211 Ga0450905_006030 3300042142 Bacteria 1633
212 Ga0450906_006789 3300042145 Bacteria 2292
213 Ga0439464_0000011 3300042439 Bacteria 27415
214 Ga0439460_0000304 3300042461 Bacteria 10261
215 Ga0439460_0026604 3300042461 Bacteria 1619
216 Ga0451577_0001248 3300042876 Bacteria 35193
217 Ga0439440_0000047 3300042993 Bacteria 15205
218 Ga0466972_0044203 3300044658 Bacteria 2161
219 Ga0453684_0013114 3300044712 Bacteria 13525
220 Ga0466970_0022748 3300044765 Bacteria 3270
221 Ga0466960_0002291 3300044901 Bacteria 7170
222 Ga0466967_0069873 3300045976 Bacteria 3140
223 Ga0466967_0291584 3300045976 Bacteria 1568
224 Ga0495603_0043807 3300046455 Bacteria 2671
225 Ga0495596_0079654 3300046500 Bacteria 1272
226 Ga0495652_0126877 3300046529 Bacteria 2026
227 Ga0495586_0039760 3300046535 Bacteria 2529
228 Ga0495587_0040405 3300046536 Bacteria 2789
229 Ga0495621_0031938 3300046539 Bacteria 1809
230 Ga0495645_0104401 3300046543 Bacteria 2013
231 Ga0495667_0017038 3300046559 Bacteria 4906
232 Ga0495661_0059452 3300046665 Bacteria 2275
233 Ga0495588_0100877 3300046674 Bacteria 1517
234 Ga0495657_0003529 3300046675 Bacteria 12756
235 Ga0495623_0010251 3300046679 Bacteria 6064
236 Ga0495623_0076282 3300046679 Bacteria 2080
237 Ga0495600_0012159 3300046809 Bacteria 5376
238 Ga0495604_0062499 3300047317 Bacteria 2844
239 Ga0495604_0133123 3300047317 Bacteria 1785
240 Ga0495604_0166138 3300047317 Bacteria 1556
241 Ga0495674_0057900 3300047319 Bacteria 3390
242 Ga0495680_0003435 3300047322 Bacteria 15636
243 Ga0495677_0055770 3300047445 Bacteria 1459
244 Ga0495602_0089710 3300048088 Bacteria 2556
245 Ga0496101_0302785 3300048904 Bacteria 1252
246 Ga0496102_0007192 3300048905 Bacteria 9506
247 Ga0496102_0016252 3300048905 Bacteria 6503
248 Ga0496104_0176809 3300048907 Bacteria 2045
249 Ga0496105_0055659 3300048908 Bacteria 3266
250 Ga0496106_0002017 3300048909 Bacteria 15276
251 Ga0496107_0000548 3300048910 Bacteria 21012
252 Ga0496108_0041889 3300048911 Bacteria 3823
253 Ga0496109_0100151 3300048912 Bacteria 2688
254 Ga0496110_0001283 3300048913 Bacteria 17992
255 Ga0496110_0088882 3300048913 Bacteria 2760
256 Ga0496111_0032530 3300048914 Bacteria 3719
257 Ga0496111_0047167 3300048914 Bacteria 3103
258 Ga0496114_0145530 3300048917 Bacteria 2054
259 Ga0496114_0244696 3300048917 Bacteria 1578
260 Ga0496115_0037181 3300048918 Bacteria 3858
261 Ga0496119_0002598 3300048922 Bacteria 19602
262 Ga0496120_0000784 3300048923 Bacteria 45971
263 Ga0495682_0008035 3300049460 Bacteria 4173
264 Ga0501031_0001615 3300049568 Bacteria 14080
265 Ga0501031_0020481 3300049568 Bacteria 4312
266 Ga0501031_0047613 3300049568 Bacteria 2795
267 Ga0501031_0071940 3300049568 Bacteria 2251
268 Ga0501031_0125413 3300049568 Bacteria 1677
269 Ga0501032_0000399 3300049569 Bacteria 35904
270 Ga0501032_0009061 3300049569 Bacteria 7227
271 Ga0501033_0000076 3300049570 Bacteria 93921
272 Ga0501033_0063150 3300049570 Bacteria 2726
273 Ga0501033_0117247 3300049570 Bacteria 1934
274 Ga0501034_0000408 3300049571 Bacteria 72244
275 Ga0501034_0019794 3300049571 Bacteria 6879
276 Ga0501034_0029785 3300049571 Bacteria 5549
277 Ga0501034_0099854 3300049571 Bacteria 2897
278 Ga0501036_0000732 3300049572 Bacteria 24258
279 Ga0501036_0004136 3300049572 Bacteria 11673
280 Ga0501036_0008383 3300049572 Bacteria 8471
281 Ga0501036_0065059 3300049572 Bacteria 3086
282 Ga0501036_0184411 3300049572 Bacteria 1756
283 Ga0501036_0454822 3300049572 Bacteria 1067
284 Ga0501037_0001237 3300049573 Bacteria 18816
285 Ga0501037_0011560 3300049573 Bacteria 6497
286 Ga0501038_0000327 3300049574 Bacteria 40996
287 Ga0501038_0018426 3300049574 Bacteria 6303
288 Ga0501038_0077535 3300049574 Bacteria 2805
289 Ga0501038_0120811 3300049574 Bacteria 2161
290 Ga0501039_0000038 3300049575 Bacteria 119484
291 Ga0501039_0001634 3300049575 Bacteria 16529
292 Ga0501039_0012032 3300049575 Bacteria 6594
293 Ga0501039_0020593 3300049575 Bacteria 5054
294 Ga0501039_0046812 3300049575 Bacteria 3342
295 Ga0501039_0092456 3300049575 Bacteria 2358
296 Ga0501039_0156029 3300049575 Bacteria 1793
297 Ga0501040_0000644 3300049576 Bacteria 21398
298 Ga0501040_0006750 3300049576 Bacteria 7448
299 Ga0501040_0011470 3300049576 Bacteria 5803
300 Ga0501040_0019445 3300049576 Bacteria 4517
301 Ga0501040_0023149 3300049576 Bacteria 4163
302 Ga0501040_0123171 3300049576 Bacteria 1820
303 Ga0501041_0000041 3300049577 Bacteria 43676
304 Ga0501041_0018700 3300049577 Bacteria 4127
305 Ga0501041_0205262 3300049577 Bacteria 1236
306 Ga0501042_0004710 3300049578 Bacteria 8702
307 Ga0501042_0096304 3300049578 Bacteria 2126
308 Ga0501043_0000043 3300049579 Bacteria 115410
309 Ga0501043_0039334 3300049579 Bacteria 3717
310 Ga0501043_0065479 3300049579 Bacteria 2854
311 Ga0501043_0140568 3300049579 Bacteria 1891
312 Ga0501043_0236176 3300049579 Bacteria 1411
313 Ga0501046_0005202 3300049580 Bacteria 11644
314 Ga0501046_0039669 3300049580 Bacteria 3769
315 Ga0501046_0050621 3300049580 Bacteria 3280
316 Ga0501046_0440655 3300049580 Bacteria 937
317 Ga0501047_0403029 3300049581 Bacteria 1200
318 Ga0501048_0003684 3300049582 Bacteria 11679
319 Ga0501048_0008033 3300049582 Bacteria 7991
320 Ga0501048_0018650 3300049582 Bacteria 5102
321 Ga0501048_0021566 3300049582 Bacteria 4716
322 Ga0501048_0028936 3300049582 Bacteria 4021
323 Ga0501068_0014912 3300049584 Bacteria 4453
324 Ga0501068_0050017 3300049584 Bacteria 2526
325 Ga0501068_0066091 3300049584 Bacteria 2202
326 Ga0501068_0097067 3300049584 Bacteria 1823
327 Ga0501069_0016689 3300049585 Bacteria 3945
328 Ga0501069_0042773 3300049585 Bacteria 2507
329 Ga0501070_0003803 3300049586 Bacteria 13032
330 Ga0501070_0017371 3300049586 Bacteria 6038
331 Ga0501070_0022548 3300049586 Bacteria 5274
332 Ga0501070_0052488 3300049586 Bacteria 3384
333 Ga0501070_0130267 3300049586 Bacteria 2078
334 Ga0501070_0429868 3300049586 Bacteria 1066
335 Ga0501071_0002147 3300049587 Bacteria 11850
336 Ga0501071_0020088 3300049587 Bacteria 4641
337 Ga0501071_0028574 3300049587 Bacteria 3931
338 Ga0501071_0109389 3300049587 Bacteria 2042
339 Ga0501071_0143522 3300049587 Bacteria 1779
340 Ga0501071_0249642 3300049587 Bacteria 1339
341 Ga0501072_0004310 3300049588 Bacteria 10802
342 Ga0501072_0004987 3300049588 Bacteria 10098
343 Ga0501072_0009228 3300049588 Bacteria 7496
344 Ga0501072_0054446 3300049588 Bacteria 3152
345 Ga0501072_0071405 3300049588 Bacteria 2743
346 Ga0501072_0115259 3300049588 Bacteria 2140
347 Ga0501072_0194415 3300049588 Bacteria 1618
348 Ga0501072_0246035 3300049588 Bacteria 1424
349 Ga0501073_0025063 3300049589 Bacteria 4281
350 Ga0501073_0192654 3300049589 Bacteria 1411
351 Ga0501074_0091986 3300049590 Bacteria 2172
352 Ga0501074_0096150 3300049590 Bacteria 2121
353 Ga0501074_0104748 3300049590 Bacteria 2025
354 Ga0501075_0004593 3300049591 Bacteria 9363
355 Ga0501075_0030436 3300049591 Bacteria 3998
356 Ga0501075_0042203 3300049591 Bacteria 3419
357 Ga0501075_0050870 3300049591 Bacteria 3115
358 Ga0501075_0072902 3300049591 Bacteria 2596
359 Ga0501076_0000358 3300049592 Bacteria 28280
360 Ga0501076_0002210 3300049592 Bacteria 13326
361 Ga0501076_0010999 3300049592 Bacteria 6729
362 Ga0501076_0042829 3300049592 Bacteria 3565
363 Ga0501076_0052442 3300049592 Bacteria 3231
364 Ga0501076_0096494 3300049592 Bacteria 2381
365 Ga0501077_0001327 3300049593 Bacteria 14941
366 Ga0501077_0015170 3300049593 Bacteria 4845
367 Ga0501077_0028765 3300049593 Bacteria 3532
368 Ga0501077_0154474 3300049593 Bacteria 1456
369 Ga0501079_0005335 3300049741 Bacteria 9566
370 Ga0501079_0010368 3300049741 Bacteria 7082
371 Ga0501079_0020344 3300049741 Bacteria 5071
372 Ga0501079_0033238 3300049741 Bacteria 3967
373 Ga0501079_0062452 3300049741 Bacteria 2874
374 Ga0501080_0029601 3300049742 Bacteria 5099
375 Ga0501080_0058206 3300049742 Bacteria 3597
376 Ga0501080_0184913 3300049742 Bacteria 1916
377 Ga0501080_0406198 3300049742 Bacteria 1225
378 Ga0501081_0001548 3300049743 Bacteria 14146
379 Ga0501081_0002779 3300049743 Bacteria 11100
380 Ga0501081_0020348 3300049743 Bacteria 4422
381 Ga0501081_0033882 3300049743 Bacteria 3472
382 Ga0501081_0048971 3300049743 Bacteria 2908
383 Ga0501083_0014480 3300049744 Bacteria 5515
384 Ga0501035_0000297 3300049822 Bacteria 58749
385 Ga0501035_0052523 3300049822 Bacteria 3647
386 Ga0501035_0125150 3300049822 Bacteria 2244
387 Ga0501044_0002434 3300049823 Bacteria 21234
388 Ga0501044_0006808 3300049823 Bacteria 12594
389 Ga0501044_0008906 3300049823 Bacteria 10968
390 Ga0501044_0141134 3300049823 Bacteria 2397
391 Ga0501045_0003777 3300049824 Bacteria 10412
392 Ga0501045_0005096 3300049824 Bacteria 9094
393 Ga0501045_0054358 3300049824 Bacteria 2927
394 Ga0501045_0103653 3300049824 Bacteria 2107
395 nmdc:mga03n38_84888_c1 3300050490 Bacteria 1496
396 nmdc:mga00v17_107644_c1 3300050491 Bacteria 1766
397 nmdc:mga00v17_66853_c1 3300050491 Bacteria 2220
398 nmdc:mga00v17_7334_c1 3300050491 Bacteria 5878
399 nmdc:mga0yw44_113082_c1 3300050492 Bacteria 1742
400 nmdc:mga0yw44_31784_c1 3300050492 Bacteria 3072
401 nmdc:mga0yw44_42326_c1 3300050492 Bacteria 2716
402 nmdc:mga04h51_30016_c1 3300050495 Bacteria 1708
403 nmdc:mga05p37_16158_c1 3300050507 Bacteria 8986
404 nmdc:mga05p37_365417_c1 3300050507 Bacteria 1695
405 nmdc:mga09592_10485_c1 3300050508 Bacteria 7541
406 nmdc:mga06r32_225755_c1 3300050510 Bacteria 1861
407 nmdc:mga06r32_336973_c1 3300050510 Bacteria 1493
408 nmdc:mga08y16_37034_c1 3300050511 Bacteria 5123
409 nmdc:mga08y16_523771_c1 3300050511 Bacteria 1202
410 nmdc:mga08y16_5412_c1 3300050511 Bacteria 13347
411 nmdc:mga0a205_86592_c1 3300050515 Bacteria 3026
412 Ga0500616_0000960 3300053153 Bacteria 31268
413 Ga0501084_0000537 3300054114 Bacteria 28931
414 Ga0501084_0011228 3300054114 Bacteria 7416
415 Ga0501084_0011521 3300054114 Bacteria 7322
416 Ga0501084_0042023 3300054114 Bacteria 3823
417 Ga0501084_0044728 3300054114 Bacteria 3707
418 Ga0501084_0101663 3300054114 Bacteria 2414
419 Ga0590077_009851 3300059426 Bacteria 1964
420 Ga0501082_0005062 3300060353 Bacteria 11490
421 Ga0501082_0007583 3300060353 Bacteria 9361
422 Ga0501082_0049885 3300060353 Bacteria 3609
423 Ga0501082_0113029 3300060353 Bacteria 2351
424 Ga0530510_0002990 3300061734 Bacteria 11592
425 Ga0530510_0008159 3300061734 Bacteria 7305
426 Ga0530510_0018623 3300061734 Bacteria 4923
427 Ga0530510_0026348 3300061734 Bacteria 4161
428 Ga0530510_0027665 3300061734 Bacteria 4063
429 Ga0530510_0086552 3300061734 Bacteria 2283
430 2548699661 2547132424 Bacteria 8348532
431 2644517915 2643221692 Bacteria 7282860
432 2739731862 2739367700 Bacteria 4747630
433 2915361381 2915358134 Bacteria 6050864
434 8054478182 8054472261 Bacteria 7464355
435 nmdc:mga06z11_94440_c1
436 Ga0070658_10045419
437 Ga0070683_100061834
438 Ga0070683_100101085
439 Ga0070680_100023937
440 Ga0068868_100011240
441 Ga0070692_10004568
442 Ga0070668_100038673
443 Ga0070675_100339721
444 Ga0070671_100001807
445 Ga0070671_100006081
446 Ga0070659_100006640
447 Ga0070659_100234345
448 Ga0070667_100170015
449 Ga0070714_100006514
450 Ga0070713_100310211
451 Ga0070701_10011059
452 Ga0070700_100000905
453 Ga0070694_100103720
454 Ga0070708_100013534
455 Ga0070662_100024826
456 Ga0070662_100326167
457 Ga0070681_10021700
458 Ga0070681_10153536
459 Ga0068867_100138996
460 Ga0070679_100006472
461 Ga0070679_100102999
462 Ga0070684_100154672
463 Ga0070684_100181538
464 Ga0068853_100222629
465 Ga0070695_100001613
466 Ga0070695_100002384
467 Ga0070696_100002164
468 Ga0070693_100051200
469 Ga0070665_100005066
470 Ga0070704_100004175
471 Ga0068855_100343845
472 Ga0068857_100007483
473 Ga0068857_100235804
474 Ga0068859_100001348
475 Ga0068859_100388664
476 Ga0068864_100090428
477 Ga0068861_100340182
478 Ga0068860_100003791
479 Ga0068860_100078561
480 Ga0068862_100000857
481 Ga0081455_10005251
482 Ga0081538_10002653
483 Ga0081538_10006298
484 Ga0081538_10008161
485 Ga0081538_10032120
486 Ga0081540_1026541
487 Ga0081539_10030876
488 Ga0075365_10028261
489 Ga0075363_100068733
490 Ga0075364_10009629
491 Ga0075364_10029585
492 Ga0075364_10119525
493 Ga0075432_10039065
494 Ga0070712_100000166
495 Ga0075367_10033396
496 Ga0075369_10092378
497 Ga0097621_100090018
498 Ga0068871_100108987
499 Ga0075428_100033770
500 Ga0075431_100276086
501 Ga0075429_100034779
502 Ga0068865_100096598
503 Ga0097620_100001348
504 Ga0097620_100388686
505 Ga0105240_10021393
506 Ga0111539_10115992
507 Ga0111539_10199506
508 Ga0105245_10013354
509 Ga0105245_10061854
510 Ga0105245_10253108
511 Ga0105245_10414192
512 Ga0114129_10063287
513 Ga0114129_10201962
514 Ga0105248_10224640
515 Ga0105249_10000689
516 Ga0105249_10023074
517 Ga0105239_10050058
518 Ga0105239_10103787
519 Ga0105246_10077926
520 Ga0157373_10033415
521 Ga0157371_10293409
522 Ga0157369_10006567
523 Ga0163162_10041190
524 Ga0157372_10018223
525 Ga0157372_10300456
526 Ga0163163_10002512
527 Ga0157377_10012433
528 Ga0157379_10051750
529 Ga0157379_10198329
530 Ga0163161_10244340
531 Ga0206353_10738461
532 Ga0213876_10000006
533 Ga0207710_10000075
534 Ga0207688_10009792
535 Ga0207707_10318769
536 Ga0207693_10000568
537 Ga0207660_10003438
538 Ga0207660_10410627
539 Ga0207652_10016668
540 Ga0207652_10019417
541 Ga0207652_10090987
542 Ga0207652_10182707
543 Ga0207681_10131571
544 Ga0207687_10040244
545 Ga0207644_10000715
546 Ga0207690_10035209
547 Ga0207690_10063945
548 Ga0207706_10033120
549 Ga0207706_10109510
550 Ga0207669_10034654
551 Ga0207704_10034807
552 Ga0207691_10024313
553 Ga0207711_10003152
554 Ga0207661_10034492
555 Ga0207667_10118603
556 Ga0207667_10379127
557 Ga0207651_10134747
558 Ga0207712_10000968
559 Ga0207712_10105774
560 Ga0207668_10360280
561 Ga0207677_10028144
562 Ga0207639_10173179
563 Ga0207678_10007443
564 Ga0207708_10002109
565 Ga0207641_10223755
566 Ga0207648_10038173
567 Ga0207676_10263723
568 Ga0207674_10006620
569 Ga0207675_100003257
570 Ga0207675_100263777
571 Ga0209971_1004463
572 Ga0209998_10000642
573 Ga0209813_10014109
574 Ga0209974_10006069
575 Ga0207428_10008731
576 Ga0268266_10007788
577 Ga0268265_10000953
578 Ga0268264_10029231
579 Ga0268264_10091493
580 Ga0265337_1000773
581 Ga0265334_10039480
582 Ga0265338_10006913
583 Ga0265338_10024317
584 Ga0265330_10000334
585 Ga0265330_10116419
586 Ga0265332_10000011
587 Ga0265320_10000112
588 Ga0265325_10004351
589 Ga0265340_10029952
590 Ga0265327_10002260
591 Ga0307508_10018086
592 Ga0316579_10014802
593 Ga0265314_10000026
594 Ga0265314_10015998
595 Ga0316578_10044451
596 Ga0316578_10073047
597 Ga0307405_10009033
598 Ga0307405_10068022
599 Ga0307410_10103768
600 Ga0307406_10054646
601 Ga0307406_10074429
602 Ga0307407_10173547
603 Ga0307412_10135156
604 Ga0307412_10164645
605 Ga0307412_10208893
606 Ga0307409_100002536
607 Ga0307409_100006733
608 Ga0307409_100007311
609 Ga0307409_100144240
610 Ga0307416_100007237
611 Ga0307416_100030743
612 Ga0307416_100252178
613 Ga0307411_10188716
614 Ga0307415_100000408
615 Ga0307415_100053379
616 Ga0307415_100122832
617 Ga0307415_100192256
618 Ga0373923_0046122
619 Ga0373939_0057082
620 Ga0373957_0021606
621 Ga0373955_0005682
622 Ga0373924_0059384
623 Ga0373931_0004827
624 Ga0373933_0030727
625 Ga0373933_0043322
626 Ga0373933_0181537
627 Ga0373937_0007086
628 Ga0373937_0013759
629 Ga0316582_0056047
630 Ga0395898_0034173
631 Ga0395901_0005805
632 Ga0436365_0695157
633 Ga0436361_0719257
634 Ga0451791_0601961
635 Ga0439445_0020970
636 Ga0439450_000239
637 Ga0439454_002916
638 Ga0439454_003959
639 Ga0439455_0016417
640 Ga0439463_003650
641 Ga0450913_000570
642 Ga0450914_000018
643 Ga0450900_000024
644 Ga0450902_011412
645 Ga0450905_006030
646 Ga0450906_006789
647 Ga0439464_0000011
648 Ga0439460_0000304
649 Ga0439460_0026604
650 Ga0451577_0001248
651 Ga0439440_0000047
652 Ga0466972_0044203
653 Ga0453684_0013114
654 Ga0466970_0022748
655 Ga0466960_0002291
656 Ga0466967_0069873
657 Ga0466967_0291584
658 Ga0495603_0043807
659 Ga0495596_0079654
660 Ga0495652_0126877
661 Ga0495586_0039760
662 Ga0495587_0040405
663 Ga0495621_0031938
664 Ga0495645_0104401
665 Ga0495667_0017038
666 Ga0495661_0059452
667 Ga0495588_0100877
668 Ga0495657_0003529
669 Ga0495623_0010251
670 Ga0495623_0076282
671 Ga0495600_0012159
672 Ga0495604_0062499
673 Ga0495604_0133123
674 Ga0495604_0166138
675 Ga0495674_0057900
676 Ga0495680_0003435
677 Ga0495677_0055770
678 Ga0495602_0089710
679 Ga0496101_0302785
680 Ga0496102_0007192
681 Ga0496102_0016252
682 Ga0496104_0176809
683 Ga0496105_0055659
684 Ga0496106_0002017
685 Ga0496107_0000548
686 Ga0496108_0041889
687 Ga0496109_0100151
688 Ga0496110_0001283
689 Ga0496110_0088882
690 Ga0496111_0032530
691 Ga0496111_0047167
692 Ga0496114_0145530
693 Ga0496114_0244696
694 Ga0496115_0037181
695 Ga0496119_0002598
696 Ga0496120_0000784
697 Ga0495682_0008035
698 Ga0501031_0001615
699 Ga0501031_0020481
700 Ga0501031_0047613
701 Ga0501031_0071940
702 Ga0501031_0125413
703 Ga0501032_0000399
704 Ga0501032_0009061
705 Ga0501033_0000076
706 Ga0501033_0063150
707 Ga0501033_0117247
708 Ga0501034_0000408
709 Ga0501034_0019794
710 Ga0501034_0029785
711 Ga0501034_0099854
712 Ga0501036_0000732
713 Ga0501036_0004136
714 Ga0501036_0008383
715 Ga0501036_0065059
716 Ga0501036_0184411
717 Ga0501036_0454822
718 Ga0501037_0001237
719 Ga0501037_0011560
720 Ga0501038_0000327
721 Ga0501038_0018426
722 Ga0501038_0077535
723 Ga0501038_0120811
724 Ga0501039_0000038
725 Ga0501039_0001634
726 Ga0501039_0012032
727 Ga0501039_0020593
728 Ga0501039_0046812
729 Ga0501039_0092456
730 Ga0501039_0156029
731 Ga0501040_0000644
732 Ga0501040_0006750
733 Ga0501040_0011470
734 Ga0501040_0019445
735 Ga0501040_0023149
736 Ga0501040_0123171
737 Ga0501041_0000041
738 Ga0501041_0018700
739 Ga0501041_0205262
740 Ga0501042_0004710
741 Ga0501042_0096304
742 Ga0501043_0000043
743 Ga0501043_0039334
744 Ga0501043_0065479
745 Ga0501043_0140568
746 Ga0501043_0236176
747 Ga0501046_0005202
748 Ga0501046_0039669
749 Ga0501046_0050621
750 Ga0501046_0440655
751 Ga0501047_0403029
752 Ga0501048_0003684
753 Ga0501048_0008033
754 Ga0501048_0018650
755 Ga0501048_0021566
756 Ga0501048_0028936
757 Ga0501068_0014912
758 Ga0501068_0050017
759 Ga0501068_0066091
760 Ga0501068_0097067
761 Ga0501069_0016689
762 Ga0501069_0042773
763 Ga0501070_0003803
764 Ga0501070_0017371
765 Ga0501070_0022548
766 Ga0501070_0052488
767 Ga0501070_0130267
768 Ga0501070_0429868
769 Ga0501071_0002147
770 Ga0501071_0020088
771 Ga0501071_0028574
772 Ga0501071_0109389
773 Ga0501071_0143522
774 Ga0501071_0249642
775 Ga0501072_0004310
776 Ga0501072_0004987
777 Ga0501072_0009228
778 Ga0501072_0054446
779 Ga0501072_0071405
780 Ga0501072_0115259
781 Ga0501072_0194415
782 Ga0501072_0246035
783 Ga0501073_0025063
784 Ga0501073_0192654
785 Ga0501074_0091986
786 Ga0501074_0096150
787 Ga0501074_0104748
788 Ga0501075_0004593
789 Ga0501075_0030436
790 Ga0501075_0042203
791 Ga0501075_0050870
792 Ga0501075_0072902
793 Ga0501076_0000358
794 Ga0501076_0002210
795 Ga0501076_0010999
796 Ga0501076_0042829
797 Ga0501076_0052442
798 Ga0501076_0096494
799 Ga0501077_0001327
800 Ga0501077_0015170
801 Ga0501077_0028765
802 Ga0501077_0154474
803 Ga0501079_0005335
804 Ga0501079_0010368
805 Ga0501079_0020344
806 Ga0501079_0033238
807 Ga0501079_0062452
808 Ga0501080_0029601
809 Ga0501080_0058206
810 Ga0501080_0184913
811 Ga0501080_0406198
812 Ga0501081_0001548
813 Ga0501081_0002779
814 Ga0501081_0020348
815 Ga0501081_0033882
816 Ga0501081_0048971
817 Ga0501083_0014480
818 Ga0501035_0000297
819 Ga0501035_0052523
820 Ga0501035_0125150
821 Ga0501044_0002434
822 Ga0501044_0006808
823 Ga0501044_0008906
824 Ga0501044_0141134
825 Ga0501045_0003777
826 Ga0501045_0005096
827 Ga0501045_0054358
828 Ga0501045_0103653
829 nmdc:mga03n38_84888_c1
830 nmdc:mga00v17_107644_c1
831 nmdc:mga00v17_66853_c1
832 nmdc:mga00v17_7334_c1
833 nmdc:mga0yw44_113082_c1
834 nmdc:mga0yw44_31784_c1
835 nmdc:mga0yw44_42326_c1
836 nmdc:mga04h51_30016_c1
837 nmdc:mga05p37_16158_c1
838 nmdc:mga05p37_365417_c1
839 nmdc:mga09592_10485_c1
840 nmdc:mga06r32_225755_c1
841 nmdc:mga06r32_336973_c1
842 nmdc:mga08y16_37034_c1
843 nmdc:mga08y16_523771_c1
844 nmdc:mga08y16_5412_c1
845 nmdc:mga0a205_86592_c1
846 Ga0500616_0000960
847 Ga0501084_0000537
848 Ga0501084_0011228
849 Ga0501084_0011521
850 Ga0501084_0042023
851 Ga0501084_0044728
852 Ga0501084_0101663
853 Ga0590077_009851
854 Ga0501082_0005062
855 Ga0501082_0007583
856 Ga0501082_0049885
857 Ga0501082_0113029
858 Ga0530510_0002990
859 Ga0530510_0008159
860 Ga0530510_0018623
861 Ga0530510_0026348
862 Ga0530510_0027665
863 Ga0530510_0086552
864 2548699661
865 2644517915
866 2739731862
867 2915361381
868 8054478182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

158

0.96

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

184

222

0.89

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

229

336

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9393 1 31
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.9345 2 31
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9336 2 31
7zca-assembly1.cif.gz_A-2 crystal structure of the f191m/f201a variant of variovorax paradoxus indole monooxygenase (vpinda1) in complex with benzyl phenyl sulfoxide 0.9335 1 32
2bra-assembly1.cif.gz_A structure of n-terminal fad binding motif of mouse mical 0.9334 2 31
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 2 168 3.40.50.720
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9497 2 167 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9463 1 137 3.40.50.720
3qhaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 2 162 3.40.50.720
af_O65404_36_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9347 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9966 1 115 GO:0004616
GO:0050661
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9962 1 88 GO:0004616
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.996 1 153 GO:0004616
GO:0050661
AF-A0A0L0LZ89-F1-model_v4 deleted 0.995 1 115
AF-A0A521XLA1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9925 1 144 GO:0004616
GO:0050661

Map