F443140

General Info

Members Datasets Scaffolds Average Seq Length
434 251 868 120

Family's Representative Sequence

Representative Sequence 3300042136|Ga0450900_012674|Ga0450900_012674_120_542
Length 140
Sequence MLYSTKWLNKQAKEAGMSGDRLSQVFAALADPTRRDIVARLSVGDATVSQLAAPYNVSIQAVSKHLKVLEDAGLVSRSHDAQRRPRHLEAEVFDMMTAWIERYRKQAEERYRRLDAVLAAMDDNSEPKINQPPINQGAAS

Samples

Sample ID Description Type Environment
1 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
71 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
72 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
73 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
74 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
75 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
76 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
77 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
152 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2773857933 Frankia sp. BMG5.30 Isolate Nodule
250 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
251 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 2.76
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0.23
Rhizoplane 1.15
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450900_012674 3300042136 Unclassified 1108
2 JGI25406J46586_10033131 3300003203 Bacteria 1912
3 Ga0070658_11212581 3300005327 Bacteria 656
4 Ga0070683_100128447 3300005329 Bacteria 2397
5 Ga0070683_101344139 3300005329 Bacteria 687
6 Ga0068869_100397087 3300005334 Bacteria 1133
7 Ga0070682_100014123 3300005337 Bacteria 4612
8 Ga0068868_100385373 3300005338 Bacteria 1207
9 Ga0068868_100584326 3300005338 Bacteria 988
10 Ga0068868_100815891 3300005338 Unclassified 843
11 Ga0070660_101178503 3300005339 Bacteria 649
12 Ga0070692_10352365 3300005345 Unclassified 915
13 Ga0070668_100054173 3300005347 Bacteria 3093
14 Ga0070669_100464267 3300005353 Bacteria 1045
15 Ga0070674_100139059 3300005356 Bacteria 1820
16 Ga0070659_100047758 3300005366 Bacteria 3360
17 Ga0070659_100524173 3300005366 Bacteria 1012
18 Ga0070713_100305994 3300005436 Bacteria 1464
19 Ga0070701_10381061 3300005438 Bacteria 889
20 Ga0070711_100637654 3300005439 Bacteria 892
21 Ga0070700_101053435 3300005441 Bacteria 672
22 Ga0070663_100626651 3300005455 Unclassified 907
23 Ga0070681_10271904 3300005458 Bacteria 1606
24 Ga0068867_100567110 3300005459 Unclassified 986
25 Ga0070685_10370013 3300005466 Bacteria 985
26 Ga0070679_100299777 3300005530 Bacteria 1558
27 Ga0068853_100446372 3300005539 Bacteria 1216
28 Ga0070693_100442392 3300005547 Bacteria 910
29 Ga0070665_100321611 3300005548 Bacteria 1551
30 Ga0068855_100614607 3300005563 Bacteria 1171
31 Ga0070664_100661015 3300005564 Bacteria 972
32 Ga0068854_100091626 3300005578 Unclassified 2263
33 Ga0068856_101296689 3300005614 Bacteria 744
34 Ga0068856_101517527 3300005614 Bacteria 684
35 Ga0070702_100214782 3300005615 Bacteria 1283
36 Ga0068852_100532068 3300005616 Bacteria 1174
37 Ga0068859_101347435 3300005617 Bacteria 787
38 Ga0068864_100694502 3300005618 Bacteria 994
39 Ga0068866_10024610 3300005718 Bacteria 2819
40 Ga0068861_100054722 3300005719 Bacteria 3041
41 Ga0068861_100802520 3300005719 Bacteria 883
42 Ga0068870_10678431 3300005840 Bacteria 709
43 Ga0068863_100596985 3300005841 Bacteria 1092
44 Ga0068860_100320953 3300005843 Bacteria 1520
45 Ga0068860_100703531 3300005843 Bacteria 1020
46 Ga0068862_100311226 3300005844 Bacteria 1451
47 Ga0081455_10003180 3300005937 Bacteria 19058
48 Ga0081455_10007453 3300005937 Bacteria 11520
49 Ga0081455_10015714 3300005937 Bacteria 7338
50 Ga0081455_10318778 3300005937 Bacteria 1108
51 Ga0081538_10002569 3300005981 Bacteria 17622
52 Ga0081539_10000274 3300005985 Bacteria 117446
53 Ga0081539_10081634 3300005985 Bacteria 1697
54 Ga0070717_10364119 3300006028 Bacteria 1295
55 Ga0070717_10624625 3300006028 Bacteria 977
56 Ga0075363_100139821 3300006048 Bacteria 1363
57 Ga0075364_10022489 3300006051 Bacteria 3982
58 Ga0075432_10001006 3300006058 Bacteria 8925
59 Ga0075432_10005893 3300006058 Bacteria 4170
60 Ga0075367_10341166 3300006178 Bacteria 945
61 Ga0075370_10383589 3300006353 Bacteria 842
62 Ga0075428_100002139 3300006844 Bacteria 21327
63 Ga0075428_100078501 3300006844 Bacteria 3604
64 Ga0075428_100090050 3300006844 Bacteria 3346
65 Ga0075428_100796241 3300006844 Bacteria 1005
66 Ga0075430_100545949 3300006846 Bacteria 956
67 Ga0075431_100121544 3300006847 Bacteria 2695
68 Ga0075433_10002401 3300006852 Bacteria 14249
69 Ga0075433_10215619 3300006852 Bacteria 1705
70 Ga0075434_100003925 3300006871 Bacteria 13324
71 Ga0075434_100013681 3300006871 Bacteria 7735
72 Ga0075429_100003164 3300006880 Bacteria 13990
73 Ga0075429_100150284 3300006880 Bacteria 2039
74 Ga0068865_100173327 3300006881 Unclassified 1656
75 Ga0068865_100194161 3300006881 Unclassified 1572
76 Ga0075436_100000847 3300006914 Bacteria 20328
77 Ga0075436_100020456 3300006914 Bacteria 4543
78 Ga0097620_101347641 3300006931 Bacteria 787
79 Ga0075435_100003337 3300007076 Bacteria 10887
80 Ga0075435_100009183 3300007076 Bacteria 7140
81 Ga0105240_11188972 3300009093 Bacteria 808
82 Ga0105240_12341309 3300009093 Bacteria 553
83 Ga0111539_10005393 3300009094 Bacteria 16537
84 Ga0111539_10020983 3300009094 Bacteria 8043
85 Ga0111539_13179781 3300009094 Bacteria 529
86 Ga0105245_10039775 3300009098 Bacteria 4185
87 Ga0105245_10417327 3300009098 Bacteria 1344
88 Ga0105245_10793550 3300009098 Bacteria 985
89 Ga0114129_10007254 3300009147 Bacteria 15781
90 Ga0114129_10226451 3300009147 Bacteria 2520
91 Ga0114129_10408239 3300009147 Bacteria 1789
92 Ga0105243_10015374 3300009148 Bacteria 5789
93 Ga0105243_10030635 3300009148 Bacteria 4144
94 Ga0105241_10933027 3300009174 Bacteria 808
95 Ga0105242_10139549 3300009176 Bacteria 2102
96 Ga0105242_10186852 3300009176 Bacteria 1832
97 Ga0105242_12758065 3300009176 Bacteria 541
98 Ga0105238_10033113 3300009551 Bacteria 5259
99 Ga0105238_10515888 3300009551 Bacteria 1197
100 Ga0105249_10047217 3300009553 Bacteria 3923
101 Ga0105249_10070930 3300009553 Bacteria 3218
102 Ga0105249_12801194 3300009553 Bacteria 559
103 Ga0105239_10087911 3300010375 Bacteria 3426
104 Ga0105239_10099595 3300010375 Bacteria 3214
105 Ga0105246_10602750 3300011119 Bacteria 949
106 Ga0157340_1009921 3300012473 Unclassified 662
107 Ga0157318_1011949 3300012482 Bacteria 664
108 Ga0157337_1000815 3300012483 Bacteria 1490
109 Ga0157325_1011349 3300012485 Bacteria 669
110 Ga0157321_1012608 3300012487 Unclassified 677
111 Ga0157341_1003674 3300012494 Bacteria 1082
112 Ga0157323_1006880 3300012495 Bacteria 806
113 Ga0157342_1053101 3300012507 Bacteria 575
114 Ga0157371_10680820 3300013102 Bacteria 769
115 Ga0157370_11881679 3300013104 Bacteria 537
116 Ga0157369_10131745 3300013105 Bacteria 2649
117 Ga0157369_10807601 3300013105 Bacteria 964
118 Ga0157369_10895897 3300013105 Bacteria 910
119 Ga0157378_10841671 3300013297 Unclassified 945
120 Ga0163162_10191239 3300013306 Bacteria 2174
121 Ga0163162_10324912 3300013306 Unclassified 1671
122 Ga0157372_10153913 3300013307 Bacteria 2655
123 Ga0157372_10524208 3300013307 Unclassified 1381
124 Ga0157372_12741080 3300013307 Bacteria 565
125 Ga0157375_12450564 3300013308 Bacteria 623
126 Ga0163163_10246288 3300014325 Bacteria 1837
127 Ga0163163_12657050 3300014325 Bacteria 558
128 Ga0157380_10530189 3300014326 Bacteria 1150
129 Ga0182008_10407306 3300014497 Bacteria 732
130 Ga0163161_10089578 3300017792 Bacteria 2276
131 Ga0163161_10247191 3300017792 Bacteria 1389
132 Ga0163161_11662245 3300017792 Bacteria 565
133 Ga0197907_10092597 3300020069 Bacteria 1117
134 Ga0206356_11785843 3300020070 Bacteria 1020
135 Ga0206350_10050845 3300020080 Bacteria 822
136 Ga0206354_10278073 3300020081 Bacteria 529
137 Ga0206354_11237071 3300020081 Bacteria 1248
138 Ga0206354_11531565 3300020081 Bacteria 687
139 Ga0206353_11481815 3300020082 Bacteria 1169
140 Ga0206353_11641439 3300020082 Bacteria 860
141 Ga0206353_11886445 3300020082 Bacteria 728
142 Ga0207688_10003755 3300025901 Bacteria 8290
143 Ga0207688_10311608 3300025901 Bacteria 964
144 Ga0207647_10296787 3300025904 Bacteria 921
145 Ga0207705_10493733 3300025909 Bacteria 950
146 Ga0207671_10802707 3300025914 Bacteria 746
147 Ga0207663_10563256 3300025916 Bacteria 892
148 Ga0207652_10570425 3300025921 Bacteria 1016
149 Ga0207681_10144488 3300025923 Bacteria 1776
150 Ga0207687_10045598 3300025927 Bacteria 3031
151 Ga0207687_10321062 3300025927 Bacteria 1253
152 Ga0207700_10233022 3300025928 Bacteria 1566
153 Ga0207664_10480792 3300025929 Bacteria 1111
154 Ga0207690_10762245 3300025932 Bacteria 798
155 Ga0207706_10106295 3300025933 Bacteria 2470
156 Ga0207706_10176888 3300025933 Bacteria 1875
157 Ga0207706_11149296 3300025933 Unclassified 647
158 Ga0207709_10163710 3300025935 Bacteria 1554
159 Ga0207709_10264517 3300025935 Bacteria 1263
160 Ga0207669_10269983 3300025937 Bacteria 1277
161 Ga0207704_10988550 3300025938 Unclassified 711
162 Ga0207689_10391194 3300025942 Bacteria 1158
163 Ga0207712_10119233 3300025961 Bacteria 1993
164 Ga0207712_10223223 3300025961 Bacteria 1508
165 Ga0207668_10012707 3300025972 Bacteria 5164
166 Ga0207668_10052493 3300025972 Bacteria 2821
167 Ga0207668_10979787 3300025972 Bacteria 755
168 Ga0207677_10331974 3300026023 Bacteria 1267
169 Ga0207639_11002505 3300026041 Bacteria 782
170 Ga0207639_11931814 3300026041 Unclassified 551
171 Ga0207648_11161022 3300026089 Bacteria 725
172 Ga0207676_11713862 3300026095 Bacteria 627
173 Ga0207674_10225571 3300026116 Bacteria 1822
174 Ga0207675_100008232 3300026118 Bacteria 9823
175 Ga0207675_100062945 3300026118 Bacteria 3466
176 Ga0207683_11287498 3300026121 Bacteria 677
177 Ga0207698_10592358 3300026142 Bacteria 1092
178 Ga0207698_11135956 3300026142 Bacteria 794
179 Ga0209813_10138643 3300027866 Bacteria 861
180 Ga0209974_10381922 3300027876 Bacteria 550
181 Ga0207428_10002727 3300027907 Bacteria 17589
182 Ga0207428_10003020 3300027907 Bacteria 16576
183 Ga0268266_10745163 3300028379 Bacteria 945
184 Ga0268265_10315279 3300028380 Bacteria 1414
185 Ga0268264_10081889 3300028381 Bacteria 2760
186 Ga0307513_10000003 3300031456 Bacteria 590921
187 Ga0307408_100034631 3300031548 Bacteria 3538
188 Ga0307408_100079801 3300031548 Bacteria 2443
189 Ga0307408_100274585 3300031548 Bacteria 1401
190 Ga0307408_100392467 3300031548 Bacteria 1190
191 Ga0307408_102221846 3300031548 Bacteria 530
192 Ga0307405_10006634 3300031731 Bacteria 5712
193 Ga0307405_10013580 3300031731 Bacteria 4349
194 Ga0307405_10717327 3300031731 Bacteria 830
195 Ga0307413_10003548 3300031824 Bacteria 6597
196 Ga0307413_10009034 3300031824 Bacteria 4745
197 Ga0307413_10496279 3300031824 Bacteria 979
198 Ga0307413_10825504 3300031824 Bacteria 781
199 Ga0307413_10871360 3300031824 Bacteria 763
200 Ga0307413_12158089 3300031824 Bacteria 504
201 Ga0307410_10000179 3300031852 Bacteria 23280
202 Ga0307410_10061210 3300031852 Bacteria 2575
203 Ga0307410_10136013 3300031852 Bacteria 1812
204 Ga0307410_10178650 3300031852 Bacteria 1605
205 Ga0307410_10354054 3300031852 Bacteria 1174
206 Ga0307410_10638014 3300031852 Bacteria 892
207 Ga0307410_12132711 3300031852 Bacteria 501
208 Ga0326468_10035286 3300031889 Bacteria 686
209 Ga0307406_10000019 3300031901 Bacteria 98555
210 Ga0307406_10001536 3300031901 Bacteria 12735
211 Ga0307406_10005654 3300031901 Bacteria 6836
212 Ga0307406_10291989 3300031901 Bacteria 1248
213 Ga0307406_10383866 3300031901 Bacteria 1108
214 Ga0307406_10551034 3300031901 Bacteria 943
215 Ga0307406_10813072 3300031901 Bacteria 789
216 Ga0307407_10047195 3300031903 Bacteria 2442
217 Ga0307407_10128678 3300031903 Bacteria 1616
218 Ga0307407_10462930 3300031903 Bacteria 922
219 Ga0307407_11339090 3300031903 Bacteria 563
220 Ga0307407_11408135 3300031903 Bacteria 549
221 Ga0307407_11439776 3300031903 Bacteria 544
222 Ga0307412_10005867 3300031911 Bacteria 6916
223 Ga0307412_10065506 3300031911 Bacteria 2459
224 Ga0307412_10069092 3300031911 Bacteria 2404
225 Ga0307412_10100883 3300031911 Bacteria 2041
226 Ga0307409_100000712 3300031995 Bacteria 14835
227 Ga0307409_100036827 3300031995 Bacteria 3600
228 Ga0307409_100045502 3300031995 Bacteria 3313
229 Ga0307409_100446544 3300031995 Bacteria 1247
230 Ga0307409_100554074 3300031995 Bacteria 1129
231 Ga0307409_100704119 3300031995 Bacteria 1009
232 Ga0307409_100851661 3300031995 Bacteria 922
233 Ga0307409_100912191 3300031995 Bacteria 893
234 Ga0307409_101170802 3300031995 Bacteria 791
235 Ga0307409_101264870 3300031995 Bacteria 762
236 Ga0307409_101808823 3300031995 Bacteria 640
237 Ga0307416_100000040 3300032002 Bacteria 132572
238 Ga0307416_100009473 3300032002 Bacteria 6377
239 Ga0307416_100117273 3300032002 Bacteria 2363
240 Ga0307416_100123286 3300032002 Bacteria 2315
241 Ga0307416_100178411 3300032002 Bacteria 1988
242 Ga0307416_100308225 3300032002 Bacteria 1578
243 Ga0307416_100551891 3300032002 Bacteria 1226
244 Ga0307416_100571495 3300032002 Bacteria 1206
245 Ga0307416_100884640 3300032002 Bacteria 992
246 Ga0307416_100921922 3300032002 Bacteria 974
247 Ga0307416_101062947 3300032002 Bacteria 913
248 Ga0307416_103133368 3300032002 Bacteria 553
249 Ga0307414_10018791 3300032004 Bacteria 4266
250 Ga0307414_10033765 3300032004 Bacteria 3385
251 Ga0307414_10810435 3300032004 Bacteria 854
252 Ga0307411_10022455 3300032005 Bacteria 3715
253 Ga0307411_10035710 3300032005 Bacteria 3107
254 Ga0307411_10464936 3300032005 Bacteria 1061
255 Ga0307415_100000218 3300032126 Bacteria 25082
256 Ga0307415_100014834 3300032126 Bacteria 4595
257 Ga0307415_100036558 3300032126 Bacteria 3219
258 Ga0307415_100319834 3300032126 Bacteria 1293
259 Ga0307415_100629979 3300032126 Bacteria 958
260 Ga0307415_101033687 3300032126 Bacteria 765
261 Ga0307415_101796164 3300032126 Bacteria 593
262 Ga0373924_0297115 3300035410 Bacteria 717
263 Ga0373931_0484356 3300035691 Bacteria 796
264 Ga0373935_0479962 3300035692 Bacteria 901
265 Ga0373925_0155230 3300037068 Bacteria 1800
266 Ga0439461_0043562 3300041410 Bacteria 976
267 Ga0451789_0908642 3300041443 Bacteria 546
268 Ga0451797_1465644 3300041453 Bacteria 588
269 Ga0451837_1040030 3300041494 Bacteria 927
270 Ga0451853_0436167 3300041512 Bacteria 840
271 Ga0439448_0003069 3300042005 Bacteria 4594
272 Ga0439448_0057739 3300042005 Bacteria 1279
273 Ga0439448_0315256 3300042005 Bacteria 556
274 Ga0439455_0057625 3300042012 Bacteria 1025
275 Ga0439455_0067966 3300042012 Bacteria 954
276 Ga0439463_000556 3300042016 Bacteria 10455
277 Ga0439463_015096 3300042016 Bacteria 1909
278 Ga0439463_067160 3300042016 Bacteria 918
279 Ga0439463_104120 3300042016 Bacteria 732
280 Ga0450905_039404 3300042142 Bacteria 748
281 Ga0439435_0007016 3300042436 Bacteria 2560
282 Ga0439444_0026671 3300042437 Bacteria 1059
283 Ga0439459_0021231 3300042438 Bacteria 1245
284 Ga0439459_0117398 3300042438 Bacteria 667
285 Ga0439464_0037279 3300042439 Bacteria 1379
286 Ga0439464_0154134 3300042439 Bacteria 720
287 Ga0439460_0049119 3300042461 Bacteria 1261
288 Ga0439440_0001428 3300042993 Bacteria 4333
289 Ga0439440_0010128 3300042993 Bacteria 1964
290 Ga0439440_0086606 3300042993 Unclassified 835
291 Ga0439440_0185130 3300042993 Bacteria 612
292 Ga0466969_0004631 3300044656 Bacteria 7327
293 Ga0466972_0379859 3300044658 Bacteria 662
294 Ga0466961_0709149 3300044693 Bacteria 603
295 Ga0466957_0419609 3300044842 Bacteria 918
296 Ga0466960_0034383 3300044901 Bacteria 2362
297 Ga0466960_0077785 3300044901 Bacteria 1665
298 Ga0466960_0171584 3300044901 Bacteria 1171
299 Ga0466959_0155916 3300045049 Bacteria 1607
300 Ga0466967_0474315 3300045976 Bacteria 1225
301 Ga0466967_1077836 3300045976 Bacteria 800
302 Ga0495653_0658981 3300046463 Bacteria 639
303 Ga0495585_0376693 3300046492 Bacteria 686
304 Ga0495596_0168709 3300046500 Bacteria 851
305 Ga0495616_0129838 3300046513 Bacteria 1156
306 Ga0495620_0107580 3300046515 Bacteria 1107
307 Ga0495630_0160473 3300046517 Bacteria 1712
308 Ga0495637_0163504 3300046520 Bacteria 834
309 Ga0495644_0122140 3300046523 Bacteria 991
310 Ga0495663_0116873 3300046525 Bacteria 890
311 Ga0495665_0533145 3300046531 Bacteria 590
312 Ga0495586_0203512 3300046535 Bacteria 1123
313 Ga0495597_0388210 3300046542 Bacteria 532
314 Ga0495656_0142795 3300046615 Bacteria 1150
315 Ga0495656_0386419 3300046615 Bacteria 730
316 Ga0495670_0591959 3300046691 Bacteria 604
317 Ga0495589_0263814 3300046794 Bacteria 803
318 Ga0495589_0342022 3300046794 Bacteria 690
319 Ga0495660_0165985 3300046810 Bacteria 1079
320 Ga0495581_0558456 3300047315 Bacteria 664
321 Ga0495626_0299497 3300048091 Bacteria 636
322 Ga0496108_0842763 3300048911 Bacteria 789
323 Ga0496109_0055416 3300048912 Bacteria 3617
324 Ga0496111_0652881 3300048914 Bacteria 767
325 Ga0501031_0014667 3300049568 Bacteria 5092
326 Ga0501031_0287674 3300049568 Bacteria 1066
327 Ga0501032_0007894 3300049569 Bacteria 7748
328 Ga0501033_0196241 3300049570 Bacteria 1443
329 Ga0501033_0298009 3300049570 Bacteria 1135
330 Ga0501034_0109551 3300049571 Bacteria 2753
331 Ga0501036_0014121 3300049572 Bacteria 6641
332 Ga0501036_0291832 3300049572 Bacteria 1364
333 Ga0501036_0324792 3300049572 Bacteria 1286
334 Ga0501036_0573888 3300049572 Bacteria 937
335 Ga0501036_0642695 3300049572 Bacteria 879
336 Ga0501037_0149302 3300049573 Bacteria 1671
337 Ga0501038_0000902 3300049574 Bacteria 26327
338 Ga0501038_0094177 3300049574 Bacteria 2504
339 Ga0501039_0055722 3300049575 Bacteria 3062
340 Ga0501039_0359385 3300049575 Bacteria 1144
341 Ga0501040_0057306 3300049576 Bacteria 2674
342 Ga0501041_0197849 3300049577 Bacteria 1259
343 Ga0501041_0402873 3300049577 Bacteria 867
344 Ga0501042_0061034 3300049578 Bacteria 2693
345 Ga0501043_0013025 3300049579 Bacteria 6501
346 Ga0501043_0976498 3300049579 Bacteria 604
347 Ga0501046_0372272 3300049580 Bacteria 1035
348 Ga0501046_0514329 3300049580 Bacteria 856
349 Ga0501047_0004022 3300049581 Bacteria 13822
350 Ga0501048_0000038 3300049582 Bacteria 63639
351 Ga0501048_0047472 3300049582 Bacteria 3064
352 Ga0501067_0655492 3300049583 Bacteria 589
353 Ga0501068_0092060 3300049584 Bacteria 1871
354 Ga0501069_0113484 3300049585 Bacteria 1545
355 Ga0501069_0534393 3300049585 Bacteria 701
356 Ga0501070_0009639 3300049586 Bacteria 8162
357 Ga0501070_0861102 3300049586 Bacteria 709
358 Ga0501070_0961442 3300049586 Bacteria 664
359 Ga0501071_0209785 3300049587 Bacteria 1464
360 Ga0501071_1296735 3300049587 Bacteria 562
361 Ga0501072_0086183 3300049588 Bacteria 2492
362 Ga0501073_0467176 3300049589 Bacteria 872
363 Ga0501074_0039033 3300049590 Bacteria 3439
364 Ga0501074_0199328 3300049590 Bacteria 1427
365 Ga0501075_0100089 3300049591 Bacteria 2201
366 Ga0501076_0201680 3300049592 Bacteria 1624
367 Ga0501076_0315226 3300049592 Bacteria 1283
368 Ga0501076_1107860 3300049592 Bacteria 652
369 Ga0501077_0083385 3300049593 Bacteria 2025
370 Ga0501214_038807 3300049659 Bacteria 684
371 Ga0501217_080724 3300049661 Bacteria 900
372 Ga0501235_224850 3300049669 Bacteria 516
373 Ga0501243_009911 3300049675 Bacteria 1483
374 Ga0501260_032893 3300049689 Bacteria 604
375 Ga0501079_0102497 3300049741 Bacteria 2219
376 Ga0501079_0576106 3300049741 Bacteria 885
377 Ga0501079_1595694 3300049741 Bacteria 513
378 Ga0501080_0507039 3300049742 Bacteria 1078
379 Ga0501080_0610702 3300049742 Bacteria 967
380 Ga0501081_0095347 3300049743 Bacteria 2097
381 Ga0501081_0449938 3300049743 Bacteria 957
382 Ga0501271_023561 3300049768 Bacteria 726
383 Ga0501035_0035347 3300049822 Bacteria 4535
384 Ga0501035_0190145 3300049822 Bacteria 1765
385 Ga0501035_0393934 3300049822 Bacteria 1153
386 Ga0501044_0189826 3300049823 Bacteria 2018
387 Ga0501044_0293107 3300049823 Bacteria 1558
388 Ga0501044_0755545 3300049823 Bacteria 854
389 Ga0501045_0144474 3300049824 Bacteria 1769
390 nmdc:mga03n38_184285_c1 3300050490 Bacteria 1071
391 nmdc:mga03n38_333413_c1 3300050490 Bacteria 822
392 nmdc:mga03n38_344391_c1 3300050490 Bacteria 810
393 nmdc:mga00v17_141498_c1 3300050491 Bacteria 1543
394 nmdc:mga00v17_283093_c1 3300050491 Bacteria 1076
395 nmdc:mga00v17_474711_c1 3300050491 Bacteria 811
396 nmdc:mga0yw44_223840_c1 3300050492 Bacteria 1248
397 nmdc:mga06z11_506173_c1 3300050494 Bacteria 732
398 nmdc:mga04h51_133696_c1 3300050495 Bacteria 935
399 nmdc:mga05p37_3239_c1 3300050507 Bacteria 18964
400 nmdc:mga09592_48826_c1 3300050508 Bacteria 3568
401 nmdc:mga0qj67_467035_c1 3300050509 Bacteria 1016
402 nmdc:mga06r32_33931_c1 3300050510 Bacteria 4809
403 nmdc:mga06r32_782666_c1 3300050510 Bacteria 915
404 nmdc:mga08y16_29686_c1 3300050511 Bacteria 5759
405 nmdc:mga08y16_4777_c1 3300050511 Bacteria 14136
406 nmdc:mga0n895_2070_c1 3300050512 Bacteria 15441
407 nmdc:mga0n895_34766_c1 3300050512 Bacteria 4854
408 nmdc:mga0rr50_32908_c1 3300050513 Bacteria 3700
409 nmdc:mga0rr50_6958_c1 3300050513 Bacteria 6935
410 nmdc:mga08x19_152621_c1 3300050514 Bacteria 1565
411 nmdc:mga08x19_50035_c1 3300050514 Bacteria 2681
412 nmdc:mga0a205_1482484_c1 3300050515 Bacteria 526
413 nmdc:mga0a205_40624_c1 3300050515 Bacteria 4479
414 nmdc:mga0a205_9395_c1 3300050515 Bacteria 8937
415 Ga0495655_0118748 3300053083 Bacteria 803
416 Ga0495655_0135234 3300053083 Bacteria 763
417 Ga0495595_0296012 3300053084 Bacteria 814
418 Ga0501084_0290241 3300054114 Bacteria 1381
419 Ga0590075_039188 3300059424 Bacteria 1209
420 Ga0587073_0062339 3300059492 Bacteria 878
421 Ga0587069_116791 3300059642 Bacteria 561
422 Ga0587071_054420 3300060344 Bacteria 836
423 Ga0501082_0032176 3300060353 Bacteria 4524
424 Ga0501082_0591780 3300060353 Bacteria 971
425 Ga0501082_1081472 3300060353 Bacteria 701
426 Ga0501082_1645816 3300060353 Bacteria 560
427 Ga0466962_0291852 3300061719 Bacteria 806
428 Ga0530510_0011007 3300061734 Bacteria 6344
429 Ga0530510_0021411 3300061734 Bacteria 4600
430 Ga0530510_0557307 3300061734 Bacteria 870
431 Ga0530510_1154340 3300061734 Bacteria 594
432 2774905111 2773857933 Bacteria 5818019
433 2895662480 2895660088 Bacteria 3782833
434 2990088218 2990088156 Bacteria 6657676
435 Ga0450900_012674
436 JGI25406J46586_10033131
437 Ga0070658_11212581
438 Ga0070683_100128447
439 Ga0070683_101344139
440 Ga0068869_100397087
441 Ga0070682_100014123
442 Ga0068868_100385373
443 Ga0068868_100584326
444 Ga0068868_100815891
445 Ga0070660_101178503
446 Ga0070692_10352365
447 Ga0070668_100054173
448 Ga0070669_100464267
449 Ga0070674_100139059
450 Ga0070659_100047758
451 Ga0070659_100524173
452 Ga0070713_100305994
453 Ga0070701_10381061
454 Ga0070711_100637654
455 Ga0070700_101053435
456 Ga0070663_100626651
457 Ga0070681_10271904
458 Ga0068867_100567110
459 Ga0070685_10370013
460 Ga0070679_100299777
461 Ga0068853_100446372
462 Ga0070693_100442392
463 Ga0070665_100321611
464 Ga0068855_100614607
465 Ga0070664_100661015
466 Ga0068854_100091626
467 Ga0068856_101296689
468 Ga0068856_101517527
469 Ga0070702_100214782
470 Ga0068852_100532068
471 Ga0068859_101347435
472 Ga0068864_100694502
473 Ga0068866_10024610
474 Ga0068861_100054722
475 Ga0068861_100802520
476 Ga0068870_10678431
477 Ga0068863_100596985
478 Ga0068860_100320953
479 Ga0068860_100703531
480 Ga0068862_100311226
481 Ga0081455_10003180
482 Ga0081455_10007453
483 Ga0081455_10015714
484 Ga0081455_10318778
485 Ga0081538_10002569
486 Ga0081539_10000274
487 Ga0081539_10081634
488 Ga0070717_10364119
489 Ga0070717_10624625
490 Ga0075363_100139821
491 Ga0075364_10022489
492 Ga0075432_10001006
493 Ga0075432_10005893
494 Ga0075367_10341166
495 Ga0075370_10383589
496 Ga0075428_100002139
497 Ga0075428_100078501
498 Ga0075428_100090050
499 Ga0075428_100796241
500 Ga0075430_100545949
501 Ga0075431_100121544
502 Ga0075433_10002401
503 Ga0075433_10215619
504 Ga0075434_100003925
505 Ga0075434_100013681
506 Ga0075429_100003164
507 Ga0075429_100150284
508 Ga0068865_100173327
509 Ga0068865_100194161
510 Ga0075436_100000847
511 Ga0075436_100020456
512 Ga0097620_101347641
513 Ga0075435_100003337
514 Ga0075435_100009183
515 Ga0105240_11188972
516 Ga0105240_12341309
517 Ga0111539_10005393
518 Ga0111539_10020983
519 Ga0111539_13179781
520 Ga0105245_10039775
521 Ga0105245_10417327
522 Ga0105245_10793550
523 Ga0114129_10007254
524 Ga0114129_10226451
525 Ga0114129_10408239
526 Ga0105243_10015374
527 Ga0105243_10030635
528 Ga0105241_10933027
529 Ga0105242_10139549
530 Ga0105242_10186852
531 Ga0105242_12758065
532 Ga0105238_10033113
533 Ga0105238_10515888
534 Ga0105249_10047217
535 Ga0105249_10070930
536 Ga0105249_12801194
537 Ga0105239_10087911
538 Ga0105239_10099595
539 Ga0105246_10602750
540 Ga0157340_1009921
541 Ga0157318_1011949
542 Ga0157337_1000815
543 Ga0157325_1011349
544 Ga0157321_1012608
545 Ga0157341_1003674
546 Ga0157323_1006880
547 Ga0157342_1053101
548 Ga0157371_10680820
549 Ga0157370_11881679
550 Ga0157369_10131745
551 Ga0157369_10807601
552 Ga0157369_10895897
553 Ga0157378_10841671
554 Ga0163162_10191239
555 Ga0163162_10324912
556 Ga0157372_10153913
557 Ga0157372_10524208
558 Ga0157372_12741080
559 Ga0157375_12450564
560 Ga0163163_10246288
561 Ga0163163_12657050
562 Ga0157380_10530189
563 Ga0182008_10407306
564 Ga0163161_10089578
565 Ga0163161_10247191
566 Ga0163161_11662245
567 Ga0197907_10092597
568 Ga0206356_11785843
569 Ga0206350_10050845
570 Ga0206354_10278073
571 Ga0206354_11237071
572 Ga0206354_11531565
573 Ga0206353_11481815
574 Ga0206353_11641439
575 Ga0206353_11886445
576 Ga0207688_10003755
577 Ga0207688_10311608
578 Ga0207647_10296787
579 Ga0207705_10493733
580 Ga0207671_10802707
581 Ga0207663_10563256
582 Ga0207652_10570425
583 Ga0207681_10144488
584 Ga0207687_10045598
585 Ga0207687_10321062
586 Ga0207700_10233022
587 Ga0207664_10480792
588 Ga0207690_10762245
589 Ga0207706_10106295
590 Ga0207706_10176888
591 Ga0207706_11149296
592 Ga0207709_10163710
593 Ga0207709_10264517
594 Ga0207669_10269983
595 Ga0207704_10988550
596 Ga0207689_10391194
597 Ga0207712_10119233
598 Ga0207712_10223223
599 Ga0207668_10012707
600 Ga0207668_10052493
601 Ga0207668_10979787
602 Ga0207677_10331974
603 Ga0207639_11002505
604 Ga0207639_11931814
605 Ga0207648_11161022
606 Ga0207676_11713862
607 Ga0207674_10225571
608 Ga0207675_100008232
609 Ga0207675_100062945
610 Ga0207683_11287498
611 Ga0207698_10592358
612 Ga0207698_11135956
613 Ga0209813_10138643
614 Ga0209974_10381922
615 Ga0207428_10002727
616 Ga0207428_10003020
617 Ga0268266_10745163
618 Ga0268265_10315279
619 Ga0268264_10081889
620 Ga0307513_10000003
621 Ga0307408_100034631
622 Ga0307408_100079801
623 Ga0307408_100274585
624 Ga0307408_100392467
625 Ga0307408_102221846
626 Ga0307405_10006634
627 Ga0307405_10013580
628 Ga0307405_10717327
629 Ga0307413_10003548
630 Ga0307413_10009034
631 Ga0307413_10496279
632 Ga0307413_10825504
633 Ga0307413_10871360
634 Ga0307413_12158089
635 Ga0307410_10000179
636 Ga0307410_10061210
637 Ga0307410_10136013
638 Ga0307410_10178650
639 Ga0307410_10354054
640 Ga0307410_10638014
641 Ga0307410_12132711
642 Ga0326468_10035286
643 Ga0307406_10000019
644 Ga0307406_10001536
645 Ga0307406_10005654
646 Ga0307406_10291989
647 Ga0307406_10383866
648 Ga0307406_10551034
649 Ga0307406_10813072
650 Ga0307407_10047195
651 Ga0307407_10128678
652 Ga0307407_10462930
653 Ga0307407_11339090
654 Ga0307407_11408135
655 Ga0307407_11439776
656 Ga0307412_10005867
657 Ga0307412_10065506
658 Ga0307412_10069092
659 Ga0307412_10100883
660 Ga0307409_100000712
661 Ga0307409_100036827
662 Ga0307409_100045502
663 Ga0307409_100446544
664 Ga0307409_100554074
665 Ga0307409_100704119
666 Ga0307409_100851661
667 Ga0307409_100912191
668 Ga0307409_101170802
669 Ga0307409_101264870
670 Ga0307409_101808823
671 Ga0307416_100000040
672 Ga0307416_100009473
673 Ga0307416_100117273
674 Ga0307416_100123286
675 Ga0307416_100178411
676 Ga0307416_100308225
677 Ga0307416_100551891
678 Ga0307416_100571495
679 Ga0307416_100884640
680 Ga0307416_100921922
681 Ga0307416_101062947
682 Ga0307416_103133368
683 Ga0307414_10018791
684 Ga0307414_10033765
685 Ga0307414_10810435
686 Ga0307411_10022455
687 Ga0307411_10035710
688 Ga0307411_10464936
689 Ga0307415_100000218
690 Ga0307415_100014834
691 Ga0307415_100036558
692 Ga0307415_100319834
693 Ga0307415_100629979
694 Ga0307415_101033687
695 Ga0307415_101796164
696 Ga0373924_0297115
697 Ga0373931_0484356
698 Ga0373935_0479962
699 Ga0373925_0155230
700 Ga0439461_0043562
701 Ga0451789_0908642
702 Ga0451797_1465644
703 Ga0451837_1040030
704 Ga0451853_0436167
705 Ga0439448_0003069
706 Ga0439448_0057739
707 Ga0439448_0315256
708 Ga0439455_0057625
709 Ga0439455_0067966
710 Ga0439463_000556
711 Ga0439463_015096
712 Ga0439463_067160
713 Ga0439463_104120
714 Ga0450905_039404
715 Ga0439435_0007016
716 Ga0439444_0026671
717 Ga0439459_0021231
718 Ga0439459_0117398
719 Ga0439464_0037279
720 Ga0439464_0154134
721 Ga0439460_0049119
722 Ga0439440_0001428
723 Ga0439440_0010128
724 Ga0439440_0086606
725 Ga0439440_0185130
726 Ga0466969_0004631
727 Ga0466972_0379859
728 Ga0466961_0709149
729 Ga0466957_0419609
730 Ga0466960_0034383
731 Ga0466960_0077785
732 Ga0466960_0171584
733 Ga0466959_0155916
734 Ga0466967_0474315
735 Ga0466967_1077836
736 Ga0495653_0658981
737 Ga0495585_0376693
738 Ga0495596_0168709
739 Ga0495616_0129838
740 Ga0495620_0107580
741 Ga0495630_0160473
742 Ga0495637_0163504
743 Ga0495644_0122140
744 Ga0495663_0116873
745 Ga0495665_0533145
746 Ga0495586_0203512
747 Ga0495597_0388210
748 Ga0495656_0142795
749 Ga0495656_0386419
750 Ga0495670_0591959
751 Ga0495589_0263814
752 Ga0495589_0342022
753 Ga0495660_0165985
754 Ga0495581_0558456
755 Ga0495626_0299497
756 Ga0496108_0842763
757 Ga0496109_0055416
758 Ga0496111_0652881
759 Ga0501031_0014667
760 Ga0501031_0287674
761 Ga0501032_0007894
762 Ga0501033_0196241
763 Ga0501033_0298009
764 Ga0501034_0109551
765 Ga0501036_0014121
766 Ga0501036_0291832
767 Ga0501036_0324792
768 Ga0501036_0573888
769 Ga0501036_0642695
770 Ga0501037_0149302
771 Ga0501038_0000902
772 Ga0501038_0094177
773 Ga0501039_0055722
774 Ga0501039_0359385
775 Ga0501040_0057306
776 Ga0501041_0197849
777 Ga0501041_0402873
778 Ga0501042_0061034
779 Ga0501043_0013025
780 Ga0501043_0976498
781 Ga0501046_0372272
782 Ga0501046_0514329
783 Ga0501047_0004022
784 Ga0501048_0000038
785 Ga0501048_0047472
786 Ga0501067_0655492
787 Ga0501068_0092060
788 Ga0501069_0113484
789 Ga0501069_0534393
790 Ga0501070_0009639
791 Ga0501070_0861102
792 Ga0501070_0961442
793 Ga0501071_0209785
794 Ga0501071_1296735
795 Ga0501072_0086183
796 Ga0501073_0467176
797 Ga0501074_0039033
798 Ga0501074_0199328
799 Ga0501075_0100089
800 Ga0501076_0201680
801 Ga0501076_0315226
802 Ga0501076_1107860
803 Ga0501077_0083385
804 Ga0501214_038807
805 Ga0501217_080724
806 Ga0501235_224850
807 Ga0501243_009911
808 Ga0501260_032893
809 Ga0501079_0102497
810 Ga0501079_0576106
811 Ga0501079_1595694
812 Ga0501080_0507039
813 Ga0501080_0610702
814 Ga0501081_0095347
815 Ga0501081_0449938
816 Ga0501271_023561
817 Ga0501035_0035347
818 Ga0501035_0190145
819 Ga0501035_0393934
820 Ga0501044_0189826
821 Ga0501044_0293107
822 Ga0501044_0755545
823 Ga0501045_0144474
824 nmdc:mga03n38_184285_c1
825 nmdc:mga03n38_333413_c1
826 nmdc:mga03n38_344391_c1
827 nmdc:mga00v17_141498_c1
828 nmdc:mga00v17_283093_c1
829 nmdc:mga00v17_474711_c1
830 nmdc:mga0yw44_223840_c1
831 nmdc:mga06z11_506173_c1
832 nmdc:mga04h51_133696_c1
833 nmdc:mga05p37_3239_c1
834 nmdc:mga09592_48826_c1
835 nmdc:mga0qj67_467035_c1
836 nmdc:mga06r32_33931_c1
837 nmdc:mga06r32_782666_c1
838 nmdc:mga08y16_29686_c1
839 nmdc:mga08y16_4777_c1
840 nmdc:mga0n895_2070_c1
841 nmdc:mga0n895_34766_c1
842 nmdc:mga0rr50_32908_c1
843 nmdc:mga0rr50_6958_c1
844 nmdc:mga08x19_152621_c1
845 nmdc:mga08x19_50035_c1
846 nmdc:mga0a205_1482484_c1
847 nmdc:mga0a205_40624_c1
848 nmdc:mga0a205_9395_c1
849 Ga0495655_0118748
850 Ga0495655_0135234
851 Ga0495595_0296012
852 Ga0501084_0290241
853 Ga0590075_039188
854 Ga0587073_0062339
855 Ga0587069_116791
856 Ga0587071_054420
857 Ga0501082_0032176
858 Ga0501082_0591780
859 Ga0501082_1081472
860 Ga0501082_1645816
861 Ga0466962_0291852
862 Ga0530510_0011007
863 Ga0530510_0021411
864 Ga0530510_0557307
865 Ga0530510_1154340
866 2774905111
867 2895662480
868 2990088218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

31

77

0.98

PF12840

HTH_20

Helix-turn-helix domain

29

77

0.98

PF01047

MarR

MarR family

42

84

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9239 5 92
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9179 1 79
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9102 4 104
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9083 4 84
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9074 3 92
ID Description Score Start End Superfamily
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9341 17 72 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9239 5 92 1.10.10.10
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9166 7 104 1.10.10.10
2oqgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9139 4 101 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.908 13 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A238YGB1-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9756 5 102 GO:0003677
GO:0003700
GO:0016810
AF-A0A1I1J6I2-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9735 5 108 GO:0003677
GO:0003700
AF-A0A2M8HG34-F1-model_v4 Transcriptional regulator 0.9727 2 89 GO:0003700
AF-A0A1I6KUT9-F1-model_v4 Transcriptional regulator, ArsR family 0.9704 3 103 GO:0003700
AF-A0A7Y9RBM1-F1-model_v4 deleted 0.9692 2 102

Map