F442882

General Info

Members Datasets Scaffolds Average Seq Length
433 229 866 251

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10078151|Ga0307410_100781512
Length 284
Sequence MNCHSPEAAVGSPSEFFDPEYRLARPGSTLRLIMRKPVIAGNWKMYKLLSEAVNTALALKPLVANANHCEVIIAPVFTELKTVADRLEGSNIKIAAQDCAAESAHGAHTGEVAADMLKDVGCRYVVVGHSERRQLYGETDQSVNRKVNSALAAGLTPIVCVGEMLEQREAGVVESVVKTQLSGGLAGLTRADVERIIIAYEPVWAIGTGKTATPQQAQEMHGVIRRAAAESHGEEVANSLRILYGGSVKPDNIATLMDQPDVDGALVGGASLEAETFAKIVNYK

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
171 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
174 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
206 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
207 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.62
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 1.62
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10078151 3300031852 Bacteria 2315
2 JGI24740J21852_10027960 3300001979 Bacteria 1868
3 rootL2_10003120 3300003322 Bacteria 2419
4 JGI25160J50197_1002547 3300003354 Bacteria 8432
5 Ga0065704_10139825 3300005289 Unclassified 1529
6 Ga0065715_10047481 3300005293 Bacteria 1022
7 Ga0065715_10136972 3300005293 Bacteria 1914
8 Ga0070690_100015764 3300005330 Bacteria 4516
9 Ga0070670_100029895 3300005331 Bacteria 4692
10 Ga0070670_100039092 3300005331 Bacteria 4080
11 Ga0070670_100122402 3300005331 Bacteria 2244
12 Ga0068869_100004307 3300005334 Bacteria 8837
13 Ga0070666_10006503 3300005335 Bacteria 7180
14 Ga0068868_100090078 3300005338 Bacteria 2470
15 Ga0068868_100092979 3300005338 Bacteria 2431
16 Ga0070689_100000001 3300005340 Bacteria 1334580
17 Ga0070689_100030588 3300005340 Bacteria 4088
18 Ga0070689_100055157 3300005340 Bacteria 3078
19 Ga0070689_100656391 3300005340 Bacteria 913
20 Ga0070687_100095956 3300005343 Bacteria 1650
21 Ga0070661_100045839 3300005344 Bacteria 3197
22 Ga0070661_100158937 3300005344 Bacteria 1711
23 Ga0070692_10018035 3300005345 Bacteria 3387
24 Ga0070692_10216521 3300005345 Bacteria 1130
25 Ga0070668_100016045 3300005347 Bacteria 5603
26 Ga0070669_100035407 3300005353 Bacteria 3616
27 Ga0070675_100002846 3300005354 Bacteria 13045
28 Ga0070675_100010709 3300005354 Bacteria 7172
29 Ga0070675_100124350 3300005354 Bacteria 2194
30 Ga0070675_100632048 3300005354 Bacteria 972
31 Ga0070671_100027293 3300005355 Bacteria 4698
32 Ga0070673_100004190 3300005364 Bacteria 9093
33 Ga0070688_100340649 3300005365 Bacteria 1095
34 Ga0070659_100045175 3300005366 Bacteria 3450
35 Ga0070659_100144071 3300005366 Bacteria 1941
36 Ga0070659_100215779 3300005366 Bacteria 1582
37 Ga0070667_100030244 3300005367 Bacteria 4516
38 Ga0070701_10043568 3300005438 Bacteria 2297
39 Ga0070705_100447639 3300005440 Bacteria 968
40 Ga0070700_100012079 3300005441 Bacteria 4803
41 Ga0070700_100471932 3300005441 Bacteria 959
42 Ga0070694_100005509 3300005444 Bacteria 7667
43 Ga0070694_100088692 3300005444 Bacteria 2166
44 Ga0070678_100087990 3300005456 Bacteria 2374
45 Ga0070678_100210799 3300005456 Bacteria 1609
46 Ga0070662_100007050 3300005457 Bacteria 7270
47 Ga0070662_100121877 3300005457 Bacteria 2000
48 Ga0070662_100378343 3300005457 Bacteria 1165
49 Ga0070681_10026910 3300005458 Bacteria 5782
50 Ga0068867_100115719 3300005459 Unclassified 2065
51 Ga0068867_100499768 3300005459 Bacteria 1045
52 Ga0070685_10065763 3300005466 Bacteria 2135
53 Ga0070706_100105642 3300005467 Bacteria 2620
54 Ga0070707_100290709 3300005468 Bacteria 1588
55 Ga0070679_100051012 3300005530 Bacteria 4121
56 Ga0070679_100064550 3300005530 Bacteria 3649
57 Ga0070684_100335835 3300005535 Bacteria 1389
58 Ga0068853_100016651 3300005539 Bacteria 6053
59 Ga0068853_100046617 3300005539 Bacteria 3717
60 Ga0070672_100032691 3300005543 Bacteria 3930
61 Ga0070686_100111068 3300005544 Bacteria 1868
62 Ga0070695_100007216 3300005545 Bacteria 6588
63 Ga0070665_100012879 3300005548 Bacteria 8422
64 Ga0070704_100215328 3300005549 Bacteria 1559
65 Ga0070704_100470268 3300005549 Bacteria 1086
66 Ga0068855_100002075 3300005563 Bacteria 24814
67 Ga0070664_100003190 3300005564 Bacteria 13251
68 Ga0070664_100007343 3300005564 Bacteria 8883
69 Ga0070664_100058365 3300005564 Bacteria 3282
70 Ga0068857_100045680 3300005577 Bacteria 3886
71 Ga0068857_100050711 3300005577 Bacteria 3680
72 Ga0068857_100224207 3300005577 Bacteria 1718
73 Ga0068857_100330061 3300005577 Bacteria 1410
74 Ga0068856_100004637 3300005614 Bacteria 13653
75 Ga0070702_100179785 3300005615 Bacteria 1383
76 Ga0068852_100123837 3300005616 Bacteria 2371
77 Ga0068859_100020509 3300005617 Bacteria 6633
78 Ga0068859_100315502 3300005617 Bacteria 1657
79 Ga0068859_100465151 3300005617 Unclassified 1360
80 Ga0068864_100108196 3300005618 Bacteria 2474
81 Ga0068864_100333496 3300005618 Bacteria 1428
82 Ga0068864_100531216 3300005618 Bacteria 1135
83 Ga0068861_100115354 3300005719 Bacteria 2158
84 Ga0068861_100225674 3300005719 Bacteria 1586
85 Ga0068861_100424987 3300005719 Bacteria 1185
86 Ga0068861_100508718 3300005719 Bacteria 1090
87 Ga0068870_10054158 3300005840 Bacteria 2133
88 Ga0068870_10373499 3300005840 Bacteria 921
89 Ga0068863_100003431 3300005841 Bacteria 15619
90 Ga0068863_100045705 3300005841 Bacteria 4156
91 Ga0068863_100302453 3300005841 Bacteria 1552
92 Ga0068858_100118667 3300005842 Bacteria 2473
93 Ga0068860_100027747 3300005843 Bacteria 5452
94 Ga0068860_100205056 3300005843 Bacteria 1912
95 Ga0068862_100002210 3300005844 Bacteria 17455
96 Ga0068862_100004938 3300005844 Bacteria 11228
97 Ga0068862_100133566 3300005844 Bacteria 2197
98 Ga0068862_100154137 3300005844 Bacteria 2047
99 Ga0068862_100316269 3300005844 Bacteria 1440
100 Ga0097621_100088403 3300006237 Bacteria 2589
101 Ga0097621_100597837 3300006237 Bacteria 1008
102 Ga0068871_100067829 3300006358 Bacteria 2928
103 Ga0075428_100010699 3300006844 Bacteria 10196
104 Ga0075428_100023421 3300006844 Bacteria 6833
105 Ga0075428_100038985 3300006844 Bacteria 5229
106 Ga0075428_100043503 3300006844 Bacteria 4937
107 Ga0075428_100329450 3300006844 Bacteria 1640
108 Ga0075430_100017628 3300006846 Bacteria 6081
109 Ga0075430_100039395 3300006846 Bacteria 4001
110 Ga0075430_100054827 3300006846 Bacteria 3353
111 Ga0075430_100174620 3300006846 Bacteria 1788
112 Ga0075431_100000895 3300006847 Bacteria 26293
113 Ga0075431_100051524 3300006847 Bacteria 4244
114 Ga0075433_10123331 3300006852 Bacteria 2302
115 Ga0075433_10275482 3300006852 Bacteria 1491
116 Ga0075434_100282059 3300006871 Bacteria 1681
117 Ga0075429_100004626 3300006880 Bacteria 11835
118 Ga0075429_100023227 3300006880 Bacteria 5379
119 Ga0075429_100225900 3300006880 Bacteria 1640
120 Ga0068865_100179135 3300006881 Bacteria 1631
121 Ga0097620_100020509 3300006931 Bacteria 6633
122 Ga0097620_100315503 3300006931 Bacteria 1657
123 Ga0097620_100465162 3300006931 Unclassified 1360
124 Ga0105250_10057219 3300009092 Bacteria 1565
125 Ga0105240_10000164 3300009093 Bacteria 135111
126 Ga0105240_10160466 3300009093 Bacteria 2671
127 Ga0111539_10004080 3300009094 Bacteria 19165
128 Ga0111539_10174225 3300009094 Bacteria 2513
129 Ga0111539_10285595 3300009094 Bacteria 1920
130 Ga0111539_10298956 3300009094 Bacteria 1873
131 Ga0111539_10312309 3300009094 Bacteria 1830
132 Ga0111539_10333080 3300009094 Bacteria 1767
133 Ga0111539_10532608 3300009094 Bacteria 1368
134 Ga0111539_10641790 3300009094 Bacteria 1236
135 Ga0105245_10010431 3300009098 Bacteria 8090
136 Ga0105247_10030630 3300009101 Bacteria 3261
137 Ga0114129_10019435 3300009147 Bacteria 9672
138 Ga0114129_10066609 3300009147 Bacteria 5023
139 Ga0114129_10195820 3300009147 Bacteria 2741
140 Ga0114129_10553703 3300009147 Bacteria 1495
141 Ga0114129_10571227 3300009147 Bacteria 1468
142 Ga0105248_10023386 3300009177 Bacteria 6865
143 Ga0105248_11028333 3300009177 Bacteria 931
144 Ga0105238_10150114 3300009551 Bacteria 2306
145 Ga0105249_10083339 3300009553 Bacteria 2976
146 Ga0105249_10089616 3300009553 Bacteria 2875
147 Ga0105249_10138746 3300009553 Bacteria 2329
148 Ga0105249_10148420 3300009553 Bacteria 2255
149 Ga0099796_10007870 3300010159 Bacteria 2810
150 Ga0105239_10156389 3300010375 Bacteria 2546
151 Ga0105239_10179943 3300010375 Bacteria 2366
152 Ga0105239_10649085 3300010375 Bacteria 1205
153 Ga0157371_10050028 3300013102 Bacteria 2969
154 Ga0157371_10190856 3300013102 Bacteria 1467
155 Ga0157369_10196256 3300013105 Bacteria 2120
156 Ga0157369_10395534 3300013105 Bacteria 1434
157 Ga0157374_10404264 3300013296 Bacteria 1363
158 Ga0157378_10481134 3300013297 Bacteria 1237
159 Ga0163162_10290249 3300013306 Bacteria 1767
160 Ga0163162_10446574 3300013306 Bacteria 1425
161 Ga0157372_10005609 3300013307 Bacteria 13346
162 Ga0157372_10061957 3300013307 Bacteria 4190
163 Ga0157372_10187443 3300013307 Bacteria 2396
164 Ga0157372_10409740 3300013307 Bacteria 1580
165 Ga0157372_10873525 3300013307 Bacteria 1044
166 Ga0157375_10038060 3300013308 Bacteria 4615
167 Ga0157375_10323205 3300013308 Bacteria 1707
168 Ga0157375_10378814 3300013308 Bacteria 1581
169 Ga0163163_10003482 3300014325 Bacteria 13369
170 Ga0163163_10030757 3300014325 Bacteria 5176
171 Ga0163163_10479735 3300014325 Bacteria 1304
172 Ga0157380_10022934 3300014326 Bacteria 4707
173 Ga0157380_10597027 3300014326 Bacteria 1091
174 Ga0157377_10001560 3300014745 Bacteria 9971
175 Ga0157379_10128225 3300014968 Bacteria 2283
176 Ga0157379_10165946 3300014968 Bacteria 1993
177 Ga0157376_10351250 3300014969 Bacteria 1411
178 Ga0157376_10523060 3300014969 Bacteria 1169
179 Ga0163161_10130590 3300017792 Bacteria 1894
180 Ga0163161_10167403 3300017792 Bacteria 1679
181 Ga0207426_1000019 3300025302 Bacteria 558579
182 Ga0207642_10075405 3300025899 Bacteria 1620
183 Ga0207710_10033543 3300025900 Bacteria 2252
184 Ga0207680_10032707 3300025903 Bacteria 2959
185 Ga0207643_10020898 3300025908 Bacteria 3593
186 Ga0207643_10068179 3300025908 Bacteria 2043
187 Ga0207643_10346382 3300025908 Bacteria 932
188 Ga0207705_10179302 3300025909 Bacteria 1598
189 Ga0207684_10153758 3300025910 Bacteria 1980
190 Ga0207707_10036065 3300025912 Bacteria 4325
191 Ga0207707_10119700 3300025912 Bacteria 2301
192 Ga0207695_10000201 3300025913 Bacteria 165092
193 Ga0207695_10056305 3300025913 Bacteria 4092
194 Ga0207660_10062878 3300025917 Bacteria 2675
195 Ga0207660_10164459 3300025917 Bacteria 1714
196 Ga0207662_10105793 3300025918 Bacteria 1749
197 Ga0207649_10036382 3300025920 Bacteria 2965
198 Ga0207649_10103699 3300025920 Bacteria 1887
199 Ga0207652_10168520 3300025921 Bacteria 1965
200 Ga0207646_10145352 3300025922 Bacteria 2137
201 Ga0207681_10006828 3300025923 Bacteria 7000
202 Ga0207681_10079714 3300025923 Bacteria 2308
203 Ga0207694_10104516 3300025924 Bacteria 2247
204 Ga0207659_10029184 3300025926 Bacteria 3757
205 Ga0207659_10059378 3300025926 Bacteria 2749
206 Ga0207687_10003793 3300025927 Bacteria 10158
207 Ga0207690_10031825 3300025932 Bacteria 3380
208 Ga0207690_10416784 3300025932 Bacteria 1074
209 Ga0207706_10025518 3300025933 Bacteria 5295
210 Ga0207706_10123121 3300025933 Bacteria 2281
211 Ga0207706_10287873 3300025933 Bacteria 1432
212 Ga0207670_10000011 3300025936 Bacteria 266639
213 Ga0207670_10015546 3300025936 Bacteria 4550
214 Ga0207704_10305194 3300025938 Bacteria 1221
215 Ga0207691_10024030 3300025940 Bacteria 5733
216 Ga0207691_10118479 3300025940 Bacteria 2349
217 Ga0207711_10077403 3300025941 Bacteria 2899
218 Ga0207689_10005036 3300025942 Bacteria 11907
219 Ga0207689_10009293 3300025942 Bacteria 8499
220 Ga0207679_10003230 3300025945 Bacteria 10051
221 Ga0207679_10021848 3300025945 Bacteria 4346
222 Ga0207667_10001163 3300025949 Bacteria 33062
223 Ga0207651_10161848 3300025960 Bacteria 1755
224 Ga0207712_10004676 3300025961 Bacteria 8656
225 Ga0207712_10012292 3300025961 Bacteria 5470
226 Ga0207712_10125106 3300025961 Bacteria 1951
227 Ga0207712_10303738 3300025961 Bacteria 1311
228 Ga0207668_10005023 3300025972 Bacteria 7787
229 Ga0207640_10044086 3300025981 Bacteria 2856
230 Ga0207640_10500334 3300025981 Bacteria 1012
231 Ga0207658_10163676 3300025986 Bacteria 1825
232 Ga0207677_10035936 3300026023 Bacteria 3223
233 Ga0207677_10097313 3300026023 Bacteria 2156
234 Ga0207639_10014058 3300026041 Bacteria 5618
235 Ga0207708_10026544 3300026075 Bacteria 4385
236 Ga0207702_10108449 3300026078 Bacteria 2464
237 Ga0207641_10004780 3300026088 Bacteria 11682
238 Ga0207641_10035150 3300026088 Bacteria 4173
239 Ga0207648_10005339 3300026089 Bacteria 12954
240 Ga0207648_10129146 3300026089 Unclassified 2224
241 Ga0207648_10382627 3300026089 Bacteria 1272
242 Ga0207676_10002529 3300026095 Bacteria 13044
243 Ga0207676_10078876 3300026095 Bacteria 2668
244 Ga0207676_10129502 3300026095 Bacteria 2143
245 Ga0207674_10043128 3300026116 Bacteria 4653
246 Ga0207674_10049390 3300026116 Bacteria 4303
247 Ga0207674_10058863 3300026116 Bacteria 3890
248 Ga0207674_10226065 3300026116 Bacteria 1820
249 Ga0207674_10234142 3300026116 Bacteria 1784
250 Ga0207675_100005180 3300026118 Bacteria 12550
251 Ga0207675_100035068 3300026118 Bacteria 4680
252 Ga0207675_100170185 3300026118 Bacteria 2082
253 Ga0207675_100215771 3300026118 Bacteria 1847
254 Ga0207675_100330961 3300026118 Bacteria 1489
255 Ga0207683_10076145 3300026121 Bacteria 2971
256 Ga0207683_10080553 3300026121 Bacteria 2889
257 Ga0207683_10449090 3300026121 Bacteria 1188
258 Ga0207698_10050350 3300026142 Bacteria 3177
259 Ga0207698_10086832 3300026142 Bacteria 2546
260 Ga0207698_10416028 3300026142 Bacteria 1289
261 Ga0207698_10725657 3300026142 Unclassified 991
262 Ga0207428_10002897 3300027907 Bacteria 17005
263 Ga0207428_10007492 3300027907 Bacteria 9946
264 Ga0207428_10036729 3300027907 Bacteria 3993
265 Ga0207428_10113293 3300027907 Bacteria 2085
266 Ga0268266_10253556 3300028379 Bacteria 1628
267 Ga0268265_10000595 3300028380 Bacteria 36375
268 Ga0268265_10001632 3300028380 Bacteria 18447
269 Ga0268264_10042763 3300028381 Bacteria 3751
270 Ga0268264_10116272 3300028381 Bacteria 2351
271 Ga0316182_1145792 3300030745 Bacteria 1350
272 Ga0265325_10046400 3300031241 Bacteria 2254
273 Ga0265340_10006029 3300031247 Bacteria 6690
274 Ga0265331_10013760 3300031250 Bacteria 4338
275 Ga0265327_10000238 3300031251 Bacteria 109943
276 Ga0265327_10041529 3300031251 Bacteria 2478
277 Ga0307408_100015715 3300031548 Bacteria 5043
278 Ga0307408_100033535 3300031548 Bacteria 3588
279 Ga0307408_100069562 3300031548 Bacteria 2596
280 Ga0307408_100187737 3300031548 Bacteria 1663
281 Ga0307508_10443855 3300031616 Bacteria 890
282 Ga0316579_10023445 3300031691 Bacteria 2770
283 Ga0316579_10252703 3300031691 Bacteria 852
284 Ga0316576_10007513 3300031727 Bacteria 6871
285 Ga0316576_10019651 3300031727 Bacteria 4632
286 Ga0316576_10169382 3300031727 Bacteria 1648
287 Ga0316576_10184335 3300031727 Bacteria 1574
288 Ga0316576_10189067 3300031727 Bacteria 1553
289 Ga0316578_10067840 3300031728 Bacteria 2109
290 Ga0316578_10199001 3300031728 Bacteria 1206
291 Ga0307405_10146199 3300031731 Bacteria 1656
292 Ga0316577_10055178 3300031733 Bacteria 2217
293 Ga0316577_10218887 3300031733 Bacteria 1076
294 Ga0307413_10075449 3300031824 Bacteria 2140
295 Ga0307413_10275536 3300031824 Bacteria 1262
296 Ga0307410_10026968 3300031852 Bacteria 3625
297 Ga0307406_10015176 3300031901 Bacteria 4452
298 Ga0307406_10064660 3300031901 Bacteria 2375
299 Ga0307407_10004580 3300031903 Bacteria 5888
300 Ga0307407_10010700 3300031903 Bacteria 4336
301 Ga0307409_100131973 3300031995 Bacteria 2136
302 Ga0307409_100222370 3300031995 Bacteria 1705
303 Ga0307416_100002768 3300032002 Bacteria 10180
304 Ga0307416_100134533 3300032002 Bacteria 2233
305 Ga0307414_10195451 3300032004 Bacteria 1641
306 Ga0307411_10009930 3300032005 Bacteria 5040
307 Ga0307411_10052004 3300032005 Bacteria 2676
308 Ga0307411_10092055 3300032005 Bacteria 2120
309 Ga0307411_10181239 3300032005 Bacteria 1599
310 Ga0307415_100008438 3300032126 Bacteria 5710
311 Ga0307415_100029695 3300032126 Bacteria 3497
312 Ga0307415_100048600 3300032126 Bacteria 2864
313 Ga0307415_100221065 3300032126 Bacteria 1518
314 Ga0307415_100573080 3300032126 Unclassified 1000
315 Ga0316583_10008780 3300032133 Bacteria 3646
316 Ga0316580_10041937 3300032139 Bacteria 1413
317 Ga0316580_10045937 3300032139 Bacteria 1346
318 Ga0316593_10011773 3300032168 Bacteria 2552
319 Ga0316593_10021928 3300032168 Bacteria 2001
320 Ga0316592_1009028 3300033524 Bacteria 1989
321 Ga0316592_1017968 3300033524 Bacteria 1487
322 Ga0316592_1036523 3300033524 Bacteria 1080
323 Ga0316588_1016812 3300033528 Bacteria 1625
324 Ga0316596_1000002 3300033541 Bacteria 24681
325 Ga0316574_0004019 3300035398 Bacteria 7666
326 Ga0316574_0016008 3300035398 Bacteria 4361
327 Ga0316574_0025880 3300035398 Bacteria 3525
328 Ga0316574_0027830 3300035398 Bacteria 3406
329 Ga0316574_0119274 3300035398 Bacteria 1693
330 Ga0316574_0172171 3300035398 Bacteria 1394
331 Ga0316574_0428967 3300035398 Bacteria 830
332 Ga0316582_0004519 3300036647 Bacteria 7044
333 Ga0316582_0208151 3300036647 Bacteria 1336
334 Ga0316582_0265822 3300036647 Bacteria 1176
335 Ga0316584_0002666 3300036712 Bacteria 11391
336 Ga0316584_0031991 3300036712 Bacteria 3892
337 Ga0316584_0168801 3300036712 Bacteria 1624
338 Ga0316584_0272967 3300036712 Bacteria 1230
339 Ga0373925_0117085 3300037068 Bacteria 2065
340 Ga0373925_0139940 3300037068 Bacteria 1893
341 Ga0316581_0025651 3300037588 Bacteria 1754
342 Ga0395901_0640847 3300038443 Bacteria 1067
343 Ga0400490_07976 3300038726 Bacteria 5754
344 Ga0400487_39832 3300039110 Bacteria 22275
345 Ga0439448_0010723 3300042005 Bacteria 2721
346 Ga0450896_004849 3300042133 Bacteria 1831
347 Ga0450902_014841 3300042137 Bacteria 1261
348 Ga0451577_0153241 3300042876 Bacteria 2074
349 Ga0451577_0656756 3300042876 Bacteria 951
350 Ga0466969_0048807 3300044656 Bacteria 2091
351 Ga0466961_0129064 3300044693 Bacteria 1585
352 Ga0451576_0093186 3300045051 Bacteria 3132
353 Ga0495638_0002755 3300046460 Bacteria 14122
354 Ga0495638_0084310 3300046460 Bacteria 1923
355 Ga0495650_0000240 3300046471 Bacteria 109029
356 Ga0495650_0022030 3300046471 Bacteria 3063
357 Ga0495616_0160045 3300046513 Bacteria 1013
358 Ga0495618_0161745 3300046514 Bacteria 1427
359 Ga0495625_0000623 3300046660 Bacteria 51222
360 Ga0495625_0034215 3300046660 Bacteria 3751
361 Ga0496101_0270458 3300048904 Bacteria 1327
362 Ga0496102_0112289 3300048905 Bacteria 2542
363 Ga0496106_0038348 3300048909 Bacteria 3585
364 Ga0496106_0087126 3300048909 Bacteria 2406
365 Ga0496107_0543804 3300048910 Bacteria 860
366 Ga0496110_0161663 3300048913 Bacteria 2030
367 Ga0496116_0017533 3300048919 Bacteria 5552
368 Ga0496118_0280646 3300048921 Bacteria 927
369 Ga0496121_0116854 3300048924 Bacteria 2022
370 Ga0501034_0510490 3300049571 Bacteria 1115
371 Ga0501036_0329783 3300049572 Bacteria 1275
372 Ga0501039_0138727 3300049575 Bacteria 1910
373 Ga0501040_0189457 3300049576 Bacteria 1459
374 Ga0501041_0099767 3300049577 Bacteria 1797
375 Ga0501041_0280751 3300049577 Bacteria 1048
376 Ga0501042_0162413 3300049578 Bacteria 1612
377 Ga0501047_0006822 3300049581 Bacteria 10730
378 Ga0501069_0032068 3300049585 Bacteria 2892
379 Ga0501070_0000052 3300049586 Bacteria 101405
380 Ga0501070_0253518 3300049586 Bacteria 1439
381 Ga0501070_0424402 3300049586 Bacteria 1074
382 Ga0501071_0039756 3300049587 Bacteria 3365
383 Ga0501072_0202120 3300049588 Bacteria 1584
384 Ga0501073_0020809 3300049589 Bacteria 4731
385 Ga0501074_0099957 3300049590 Bacteria 2076
386 Ga0501239_014146 3300049672 Bacteria 920
387 Ga0501242_002352 3300049674 Bacteria 1981
388 Ga0501247_000670 3300049677 Bacteria 2887
389 Ga0501249_001352 3300049679 Bacteria 5093
390 Ga0501079_0101030 3300049741 Bacteria 2236
391 Ga0501079_0214980 3300049741 Bacteria 1502
392 Ga0501080_0073469 3300049742 Bacteria 3182
393 Ga0501080_0185038 3300049742 Bacteria 1915
394 Ga0501081_0091995 3300049743 Bacteria 2134
395 Ga0501083_0218913 3300049744 Bacteria 1240
396 Ga0501035_0029887 3300049822 Bacteria 4969
397 Ga0501044_0032572 3300049823 Bacteria 5478
398 nmdc:mga05p37_218612_c1 3300050507 Bacteria 2300
399 nmdc:mga05p37_252411_c1 3300050507 Bacteria 2115
400 nmdc:mga05p37_41697_c1 3300050507 Bacteria 5637
401 nmdc:mga05p37_82958_c1 3300050507 Bacteria 3949
402 nmdc:mga05p37_93960_c1 3300050507 Bacteria 3695
403 nmdc:mga09592_1625_c1 3300050508 Bacteria 18092
404 nmdc:mga09592_31339_c2 3300050508 Bacteria 3007
405 nmdc:mga09592_31860_c1 3300050508 Bacteria 4395
406 nmdc:mga09592_70111_c1 3300050508 Bacteria 2974
407 nmdc:mga09592_88343_c1 3300050508 Bacteria 2647
408 nmdc:mga0qj67_68988_c1 3300050509 Bacteria 2819
409 nmdc:mga0qj67_8249_c1 3300050509 Bacteria 7723
410 nmdc:mga06r32_112698_c1 3300050510 Bacteria 2677
411 nmdc:mga06r32_193246_c1 3300050510 Bacteria 2022
412 nmdc:mga06r32_2847_c1 3300050510 Bacteria 15521
413 nmdc:mga06r32_407466_c1 3300050510 Bacteria 1341
414 nmdc:mga06r32_7157_c1 3300050510 Bacteria 10052
415 nmdc:mga08y16_100758_c1 3300050511 Bacteria 3007
416 nmdc:mga08y16_10114_c1 3300050511 Bacteria 9904
417 nmdc:mga08y16_102496_c1 3300050511 Bacteria 2980
418 nmdc:mga08y16_138362_c1 3300050511 Bacteria 2532
419 nmdc:mga08y16_146220_c1 3300050511 Bacteria 2457
420 nmdc:mga08y16_160538_c1 3300050511 Bacteria 2336
421 nmdc:mga08y16_524703_c1 3300050511 Bacteria 1201
422 nmdc:mga0n895_286107_c1 3300050512 Bacteria 1671
423 nmdc:mga0n895_664545_c1 3300050512 Bacteria 1040
424 nmdc:mga0a205_394916_c1 3300050515 Bacteria 1247
425 nmdc:mga0a205_79850_c1 3300050515 Bacteria 3161
426 Ga0500595_025560 3300053119 Bacteria 2045
427 Ga0500642_0203854 3300053130 Bacteria 920
428 Ga0500658_0033538 3300053134 Bacteria 2020
429 Ga0501084_0067025 3300054114 Bacteria 3004
430 Ga0590071_045800 3300059421 Bacteria 1056
431 Ga0501082_0004107 3300060353 Bacteria 12717
432 Ga0530510_0171894 3300061734 Bacteria 1605
433 2787437167 2786546517 Bacteria 6614109
434 Ga0307410_10078151
435 JGI24740J21852_10027960
436 rootL2_10003120
437 JGI25160J50197_1002547
438 Ga0065704_10139825
439 Ga0065715_10047481
440 Ga0065715_10136972
441 Ga0070690_100015764
442 Ga0070670_100029895
443 Ga0070670_100039092
444 Ga0070670_100122402
445 Ga0068869_100004307
446 Ga0070666_10006503
447 Ga0068868_100090078
448 Ga0068868_100092979
449 Ga0070689_100000001
450 Ga0070689_100030588
451 Ga0070689_100055157
452 Ga0070689_100656391
453 Ga0070687_100095956
454 Ga0070661_100045839
455 Ga0070661_100158937
456 Ga0070692_10018035
457 Ga0070692_10216521
458 Ga0070668_100016045
459 Ga0070669_100035407
460 Ga0070675_100002846
461 Ga0070675_100010709
462 Ga0070675_100124350
463 Ga0070675_100632048
464 Ga0070671_100027293
465 Ga0070673_100004190
466 Ga0070688_100340649
467 Ga0070659_100045175
468 Ga0070659_100144071
469 Ga0070659_100215779
470 Ga0070667_100030244
471 Ga0070701_10043568
472 Ga0070705_100447639
473 Ga0070700_100012079
474 Ga0070700_100471932
475 Ga0070694_100005509
476 Ga0070694_100088692
477 Ga0070678_100087990
478 Ga0070678_100210799
479 Ga0070662_100007050
480 Ga0070662_100121877
481 Ga0070662_100378343
482 Ga0070681_10026910
483 Ga0068867_100115719
484 Ga0068867_100499768
485 Ga0070685_10065763
486 Ga0070706_100105642
487 Ga0070707_100290709
488 Ga0070679_100051012
489 Ga0070679_100064550
490 Ga0070684_100335835
491 Ga0068853_100016651
492 Ga0068853_100046617
493 Ga0070672_100032691
494 Ga0070686_100111068
495 Ga0070695_100007216
496 Ga0070665_100012879
497 Ga0070704_100215328
498 Ga0070704_100470268
499 Ga0068855_100002075
500 Ga0070664_100003190
501 Ga0070664_100007343
502 Ga0070664_100058365
503 Ga0068857_100045680
504 Ga0068857_100050711
505 Ga0068857_100224207
506 Ga0068857_100330061
507 Ga0068856_100004637
508 Ga0070702_100179785
509 Ga0068852_100123837
510 Ga0068859_100020509
511 Ga0068859_100315502
512 Ga0068859_100465151
513 Ga0068864_100108196
514 Ga0068864_100333496
515 Ga0068864_100531216
516 Ga0068861_100115354
517 Ga0068861_100225674
518 Ga0068861_100424987
519 Ga0068861_100508718
520 Ga0068870_10054158
521 Ga0068870_10373499
522 Ga0068863_100003431
523 Ga0068863_100045705
524 Ga0068863_100302453
525 Ga0068858_100118667
526 Ga0068860_100027747
527 Ga0068860_100205056
528 Ga0068862_100002210
529 Ga0068862_100004938
530 Ga0068862_100133566
531 Ga0068862_100154137
532 Ga0068862_100316269
533 Ga0097621_100088403
534 Ga0097621_100597837
535 Ga0068871_100067829
536 Ga0075428_100010699
537 Ga0075428_100023421
538 Ga0075428_100038985
539 Ga0075428_100043503
540 Ga0075428_100329450
541 Ga0075430_100017628
542 Ga0075430_100039395
543 Ga0075430_100054827
544 Ga0075430_100174620
545 Ga0075431_100000895
546 Ga0075431_100051524
547 Ga0075433_10123331
548 Ga0075433_10275482
549 Ga0075434_100282059
550 Ga0075429_100004626
551 Ga0075429_100023227
552 Ga0075429_100225900
553 Ga0068865_100179135
554 Ga0097620_100020509
555 Ga0097620_100315503
556 Ga0097620_100465162
557 Ga0105250_10057219
558 Ga0105240_10000164
559 Ga0105240_10160466
560 Ga0111539_10004080
561 Ga0111539_10174225
562 Ga0111539_10285595
563 Ga0111539_10298956
564 Ga0111539_10312309
565 Ga0111539_10333080
566 Ga0111539_10532608
567 Ga0111539_10641790
568 Ga0105245_10010431
569 Ga0105247_10030630
570 Ga0114129_10019435
571 Ga0114129_10066609
572 Ga0114129_10195820
573 Ga0114129_10553703
574 Ga0114129_10571227
575 Ga0105248_10023386
576 Ga0105248_11028333
577 Ga0105238_10150114
578 Ga0105249_10083339
579 Ga0105249_10089616
580 Ga0105249_10138746
581 Ga0105249_10148420
582 Ga0099796_10007870
583 Ga0105239_10156389
584 Ga0105239_10179943
585 Ga0105239_10649085
586 Ga0157371_10050028
587 Ga0157371_10190856
588 Ga0157369_10196256
589 Ga0157369_10395534
590 Ga0157374_10404264
591 Ga0157378_10481134
592 Ga0163162_10290249
593 Ga0163162_10446574
594 Ga0157372_10005609
595 Ga0157372_10061957
596 Ga0157372_10187443
597 Ga0157372_10409740
598 Ga0157372_10873525
599 Ga0157375_10038060
600 Ga0157375_10323205
601 Ga0157375_10378814
602 Ga0163163_10003482
603 Ga0163163_10030757
604 Ga0163163_10479735
605 Ga0157380_10022934
606 Ga0157380_10597027
607 Ga0157377_10001560
608 Ga0157379_10128225
609 Ga0157379_10165946
610 Ga0157376_10351250
611 Ga0157376_10523060
612 Ga0163161_10130590
613 Ga0163161_10167403
614 Ga0207426_1000019
615 Ga0207642_10075405
616 Ga0207710_10033543
617 Ga0207680_10032707
618 Ga0207643_10020898
619 Ga0207643_10068179
620 Ga0207643_10346382
621 Ga0207705_10179302
622 Ga0207684_10153758
623 Ga0207707_10036065
624 Ga0207707_10119700
625 Ga0207695_10000201
626 Ga0207695_10056305
627 Ga0207660_10062878
628 Ga0207660_10164459
629 Ga0207662_10105793
630 Ga0207649_10036382
631 Ga0207649_10103699
632 Ga0207652_10168520
633 Ga0207646_10145352
634 Ga0207681_10006828
635 Ga0207681_10079714
636 Ga0207694_10104516
637 Ga0207659_10029184
638 Ga0207659_10059378
639 Ga0207687_10003793
640 Ga0207690_10031825
641 Ga0207690_10416784
642 Ga0207706_10025518
643 Ga0207706_10123121
644 Ga0207706_10287873
645 Ga0207670_10000011
646 Ga0207670_10015546
647 Ga0207704_10305194
648 Ga0207691_10024030
649 Ga0207691_10118479
650 Ga0207711_10077403
651 Ga0207689_10005036
652 Ga0207689_10009293
653 Ga0207679_10003230
654 Ga0207679_10021848
655 Ga0207667_10001163
656 Ga0207651_10161848
657 Ga0207712_10004676
658 Ga0207712_10012292
659 Ga0207712_10125106
660 Ga0207712_10303738
661 Ga0207668_10005023
662 Ga0207640_10044086
663 Ga0207640_10500334
664 Ga0207658_10163676
665 Ga0207677_10035936
666 Ga0207677_10097313
667 Ga0207639_10014058
668 Ga0207708_10026544
669 Ga0207702_10108449
670 Ga0207641_10004780
671 Ga0207641_10035150
672 Ga0207648_10005339
673 Ga0207648_10129146
674 Ga0207648_10382627
675 Ga0207676_10002529
676 Ga0207676_10078876
677 Ga0207676_10129502
678 Ga0207674_10043128
679 Ga0207674_10049390
680 Ga0207674_10058863
681 Ga0207674_10226065
682 Ga0207674_10234142
683 Ga0207675_100005180
684 Ga0207675_100035068
685 Ga0207675_100170185
686 Ga0207675_100215771
687 Ga0207675_100330961
688 Ga0207683_10076145
689 Ga0207683_10080553
690 Ga0207683_10449090
691 Ga0207698_10050350
692 Ga0207698_10086832
693 Ga0207698_10416028
694 Ga0207698_10725657
695 Ga0207428_10002897
696 Ga0207428_10007492
697 Ga0207428_10036729
698 Ga0207428_10113293
699 Ga0268266_10253556
700 Ga0268265_10000595
701 Ga0268265_10001632
702 Ga0268264_10042763
703 Ga0268264_10116272
704 Ga0316182_1145792
705 Ga0265325_10046400
706 Ga0265340_10006029
707 Ga0265331_10013760
708 Ga0265327_10000238
709 Ga0265327_10041529
710 Ga0307408_100015715
711 Ga0307408_100033535
712 Ga0307408_100069562
713 Ga0307408_100187737
714 Ga0307508_10443855
715 Ga0316579_10023445
716 Ga0316579_10252703
717 Ga0316576_10007513
718 Ga0316576_10019651
719 Ga0316576_10169382
720 Ga0316576_10184335
721 Ga0316576_10189067
722 Ga0316578_10067840
723 Ga0316578_10199001
724 Ga0307405_10146199
725 Ga0316577_10055178
726 Ga0316577_10218887
727 Ga0307413_10075449
728 Ga0307413_10275536
729 Ga0307410_10026968
730 Ga0307406_10015176
731 Ga0307406_10064660
732 Ga0307407_10004580
733 Ga0307407_10010700
734 Ga0307409_100131973
735 Ga0307409_100222370
736 Ga0307416_100002768
737 Ga0307416_100134533
738 Ga0307414_10195451
739 Ga0307411_10009930
740 Ga0307411_10052004
741 Ga0307411_10092055
742 Ga0307411_10181239
743 Ga0307415_100008438
744 Ga0307415_100029695
745 Ga0307415_100048600
746 Ga0307415_100221065
747 Ga0307415_100573080
748 Ga0316583_10008780
749 Ga0316580_10041937
750 Ga0316580_10045937
751 Ga0316593_10011773
752 Ga0316593_10021928
753 Ga0316592_1009028
754 Ga0316592_1017968
755 Ga0316592_1036523
756 Ga0316588_1016812
757 Ga0316596_1000002
758 Ga0316574_0004019
759 Ga0316574_0016008
760 Ga0316574_0025880
761 Ga0316574_0027830
762 Ga0316574_0119274
763 Ga0316574_0172171
764 Ga0316574_0428967
765 Ga0316582_0004519
766 Ga0316582_0208151
767 Ga0316582_0265822
768 Ga0316584_0002666
769 Ga0316584_0031991
770 Ga0316584_0168801
771 Ga0316584_0272967
772 Ga0373925_0117085
773 Ga0373925_0139940
774 Ga0316581_0025651
775 Ga0395901_0640847
776 Ga0400490_07976
777 Ga0400487_39832
778 Ga0439448_0010723
779 Ga0450896_004849
780 Ga0450902_014841
781 Ga0451577_0153241
782 Ga0451577_0656756
783 Ga0466969_0048807
784 Ga0466961_0129064
785 Ga0451576_0093186
786 Ga0495638_0002755
787 Ga0495638_0084310
788 Ga0495650_0000240
789 Ga0495650_0022030
790 Ga0495616_0160045
791 Ga0495618_0161745
792 Ga0495625_0000623
793 Ga0495625_0034215
794 Ga0496101_0270458
795 Ga0496102_0112289
796 Ga0496106_0038348
797 Ga0496106_0087126
798 Ga0496107_0543804
799 Ga0496110_0161663
800 Ga0496116_0017533
801 Ga0496118_0280646
802 Ga0496121_0116854
803 Ga0501034_0510490
804 Ga0501036_0329783
805 Ga0501039_0138727
806 Ga0501040_0189457
807 Ga0501041_0099767
808 Ga0501041_0280751
809 Ga0501042_0162413
810 Ga0501047_0006822
811 Ga0501069_0032068
812 Ga0501070_0000052
813 Ga0501070_0253518
814 Ga0501070_0424402
815 Ga0501071_0039756
816 Ga0501072_0202120
817 Ga0501073_0020809
818 Ga0501074_0099957
819 Ga0501239_014146
820 Ga0501242_002352
821 Ga0501247_000670
822 Ga0501249_001352
823 Ga0501079_0101030
824 Ga0501079_0214980
825 Ga0501080_0073469
826 Ga0501080_0185038
827 Ga0501081_0091995
828 Ga0501083_0218913
829 Ga0501035_0029887
830 Ga0501044_0032572
831 nmdc:mga05p37_218612_c1
832 nmdc:mga05p37_252411_c1
833 nmdc:mga05p37_41697_c1
834 nmdc:mga05p37_82958_c1
835 nmdc:mga05p37_93960_c1
836 nmdc:mga09592_1625_c1
837 nmdc:mga09592_31339_c2
838 nmdc:mga09592_31860_c1
839 nmdc:mga09592_70111_c1
840 nmdc:mga09592_88343_c1
841 nmdc:mga0qj67_68988_c1
842 nmdc:mga0qj67_8249_c1
843 nmdc:mga06r32_112698_c1
844 nmdc:mga06r32_193246_c1
845 nmdc:mga06r32_2847_c1
846 nmdc:mga06r32_407466_c1
847 nmdc:mga06r32_7157_c1
848 nmdc:mga08y16_100758_c1
849 nmdc:mga08y16_10114_c1
850 nmdc:mga08y16_102496_c1
851 nmdc:mga08y16_138362_c1
852 nmdc:mga08y16_146220_c1
853 nmdc:mga08y16_160538_c1
854 nmdc:mga08y16_524703_c1
855 nmdc:mga0n895_286107_c1
856 nmdc:mga0n895_664545_c1
857 nmdc:mga0a205_394916_c1
858 nmdc:mga0a205_79850_c1
859 Ga0500595_025560
860 Ga0500642_0203854
861 Ga0500658_0033538
862 Ga0501084_0067025
863 Ga0590071_045800
864 Ga0501082_0004107
865 Ga0530510_0171894
866 2787437167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

37

284

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9747 1 250
5cg7-assembly2.cif.gz_B-3 error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/5cg7 0.9709 2 253
5zg4-assembly2.cif.gz_C crystal structure of triosephosphate isomerase sad deletion mutant from opisthorchis viverrini 0.9687 2 251
6nlh-assembly4.cif.gz_H structure of human triose phosphate isomerase r189a 0.9686 3 253
2vom-assembly2.cif.gz_D structural basis of human triosephosphate isomerase deficiency. mutation e104d and correlation to solvent perturbation. 0.9685 2 249
ID Description Score Start End Superfamily
af_A0A1D6MQG5_2_109_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9805 162 251 3.20.20.70
af_A0A1D6KAX1_115_218_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9778 162 241 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9701 42 251 3.20.20.70
af_Q4DV43_1_251_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9662 2 253 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.966 1 251 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A5J4PGR7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9949 93 253 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A1V9E4G5-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9933 1 253 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A327QFA2-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9928 1 252 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A4Q3W8J7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.992 1 194 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A6J7TMM2-F1-model_v4 Unannotated protein 0.991 84 250 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map