F442283

General Info

Members Datasets Scaffolds Average Seq Length
431 211 862 188

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10001353|JGI24751J29686_100013531
Length 228
Sequence MPYFGSMAYYTQSQRQIVQKPPVGSILVNLTFAHNPEKMTKKDMAEKESVTPENDKGIDINTDENVGGTTHLTEPFTEESELEKLRAEIAEVKDKLLRKTAEFDNFRKRNAKERLELIVTAGREVITDLLEVLDDCDRAQKQFENSNDVKELKEGVTLIFNKLRNKLQARGLKPMETINTEFNPDMHEAITEIPAPDDTLKGKVIDEVEKGYYLNDKIIRFAKVVVGK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
184 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
187 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
188 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
194 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
195 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
196 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
197 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2818991444 Filimonas endophytica 3197 Isolate Unclassified
209 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
210 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
211 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001353 3300002459 Bacteria 5156
2 JGI25406J46586_10019537 3300003203 Bacteria 2757
3 rootL2_10091097 3300003322 Bacteria 1285
4 rootH1_10134819 3300003323 Bacteria 2990
5 Ga0065714_10073174 3300005288 Bacteria 3233
6 Ga0065704_10000188 3300005289 Bacteria 267216
7 Ga0065712_10185068 3300005290 Bacteria 1174
8 Ga0065715_10646633 3300005293 Unclassified 681
9 Ga0070658_10189982 3300005327 Bacteria 1731
10 Ga0070683_100014614 3300005329 Bacteria 6874
11 Ga0070670_100012713 3300005331 Bacteria 7204
12 Ga0070670_100064596 3300005331 Unclassified 3140
13 Ga0070670_100081278 3300005331 Bacteria 2785
14 Ga0070670_100096201 3300005331 Bacteria 2547
15 Ga0070670_100129705 3300005331 Bacteria 2177
16 Ga0070670_100370775 3300005331 Bacteria 1260
17 Ga0070670_100420997 3300005331 Bacteria 1181
18 Ga0070677_10047884 3300005333 Bacteria 1715
19 Ga0070677_10070614 3300005333 Bacteria 1468
20 Ga0068869_100083350 3300005334 Bacteria 2391
21 Ga0070666_10000165 3300005335 Bacteria 45323
22 Ga0070666_10439740 3300005335 Bacteria 941
23 Ga0070680_100127355 3300005336 Bacteria 2128
24 Ga0070680_100337661 3300005336 Unclassified 1280
25 Ga0070682_100009232 3300005337 Bacteria 5578
26 Ga0070682_100206331 3300005337 Bacteria 1390
27 Ga0070682_100288521 3300005337 Bacteria 1199
28 Ga0070682_100378372 3300005337 Bacteria 1064
29 Ga0068868_100000661 3300005338 Bacteria 23185
30 Ga0068868_100465160 3300005338 Bacteria 1102
31 Ga0070660_100051462 3300005339 Bacteria 3172
32 Ga0070689_100077632 3300005340 Bacteria 2603
33 Ga0070689_100180706 3300005340 Bacteria 1713
34 Ga0070661_100132780 3300005344 Bacteria 1871
35 Ga0070661_100460263 3300005344 Unclassified 1013
36 Ga0070668_100621391 3300005347 Bacteria 947
37 Ga0070669_100064372 3300005353 Bacteria 2700
38 Ga0070669_100541987 3300005353 Bacteria 969
39 Ga0070669_100543956 3300005353 Unclassified 967
40 Ga0070669_100826703 3300005353 Bacteria 788
41 Ga0070675_100429149 3300005354 Bacteria 1183
42 Ga0070675_100505640 3300005354 Bacteria 1089
43 Ga0070671_100379561 3300005355 Bacteria 1208
44 Ga0070674_100046421 3300005356 Bacteria 2971
45 Ga0070674_100922304 3300005356 Unclassified 762
46 Ga0070673_100046776 3300005364 Bacteria 3363
47 Ga0070673_100060291 3300005364 Bacteria 3006
48 Ga0070673_100097882 3300005364 Bacteria 2410
49 Ga0070673_100253456 3300005364 Bacteria 1535
50 Ga0070688_100242311 3300005365 Bacteria 1280
51 Ga0070659_100002804 3300005366 Bacteria 12414
52 Ga0070659_100027598 3300005366 Bacteria 4377
53 Ga0070659_100797054 3300005366 Bacteria 821
54 Ga0070667_100085934 3300005367 Bacteria 2698
55 Ga0070678_100008645 3300005456 Bacteria 6105
56 Ga0070678_100309846 3300005456 Bacteria 1345
57 Ga0070678_101476437 3300005456 Unclassified 636
58 Ga0070662_100934037 3300005457 Unclassified 741
59 Ga0068867_100320947 3300005459 Bacteria 1283
60 Ga0070685_10084523 3300005466 Bacteria 1909
61 Ga0070707_100060474 3300005468 Bacteria 3633
62 Ga0070698_100000965 3300005471 Bacteria 31529
63 Ga0070698_100019250 3300005471 Bacteria 7172
64 Ga0070699_100642987 3300005518 Bacteria 968
65 Ga0070679_100053206 3300005530 Bacteria 4030
66 Ga0070679_100096780 3300005530 Bacteria 2939
67 Ga0070679_100189569 3300005530 Bacteria 2026
68 Ga0070679_100355430 3300005530 Bacteria 1413
69 Ga0070684_100160720 3300005535 Bacteria 2038
70 Ga0070684_100191719 3300005535 Unclassified 1860
71 Ga0068853_100012594 3300005539 Bacteria 6881
72 Ga0068853_100023262 3300005539 Bacteria 5184
73 Ga0068853_100377042 3300005539 Bacteria 1324
74 Ga0068853_100511084 3300005539 Bacteria 1135
75 Ga0068853_100907346 3300005539 Bacteria 846
76 Ga0070672_100138307 3300005543 Bacteria 2007
77 Ga0070672_100271457 3300005543 Bacteria 1432
78 Ga0070672_100312672 3300005543 Bacteria 1334
79 Ga0070686_101067633 3300005544 Bacteria 665
80 Ga0070665_100455437 3300005548 Bacteria 1289
81 Ga0068855_100006715 3300005563 Bacteria 13965
82 Ga0068855_100122370 3300005563 Bacteria 2977
83 Ga0068855_100292719 3300005563 Bacteria 1805
84 Ga0070664_100002699 3300005564 Bacteria 14319
85 Ga0070664_100008472 3300005564 Bacteria 8314
86 Ga0070664_100212018 3300005564 Bacteria 1731
87 Ga0070664_100426201 3300005564 Bacteria 1216
88 Ga0070664_100561498 3300005564 Bacteria 1056
89 Ga0070664_100764938 3300005564 Bacteria 902
90 Ga0068857_100035155 3300005577 Bacteria 4435
91 Ga0068857_100175963 3300005577 Bacteria 1946
92 Ga0068857_100178582 3300005577 Bacteria 1932
93 Ga0068857_100419495 3300005577 Bacteria 1247
94 Ga0068857_100534005 3300005577 Bacteria 1104
95 Ga0068857_101401755 3300005577 Bacteria 680
96 Ga0068854_100019863 3300005578 Bacteria 4535
97 Ga0068856_100185662 3300005614 Bacteria 2093
98 Ga0068856_100222545 3300005614 Unclassified 1903
99 Ga0070702_100741041 3300005615 Bacteria 753
100 Ga0068852_100003784 3300005616 Bacteria 10609
101 Ga0068852_100074235 3300005616 Bacteria 2994
102 Ga0068852_100357947 3300005616 Bacteria 1427
103 Ga0068852_100386926 3300005616 Bacteria 1373
104 Ga0068852_100392195 3300005616 Bacteria 1364
105 Ga0068852_100612596 3300005616 Unclassified 1094
106 Ga0068859_100000163 3300005617 Bacteria 64401
107 Ga0068859_100046568 3300005617 Bacteria 4355
108 Ga0068864_100006105 3300005618 Bacteria 9881
109 Ga0068864_100007506 3300005618 Bacteria 8983
110 Ga0068864_100045908 3300005618 Bacteria 3748
111 Ga0068864_100164589 3300005618 Bacteria 2018
112 Ga0068864_100992837 3300005618 Bacteria 832
113 Ga0068866_10130621 3300005718 Bacteria 1428
114 Ga0068861_101045315 3300005719 Bacteria 782
115 Ga0068851_10030739 3300005834 Bacteria 2665
116 Ga0068851_10070209 3300005834 Bacteria 1811
117 Ga0068870_10343084 3300005840 Bacteria 956
118 Ga0068863_100261110 3300005841 Bacteria 1674
119 Ga0068863_100680944 3300005841 Bacteria 1021
120 Ga0068858_100005029 3300005842 Bacteria 12960
121 Ga0068860_100005091 3300005843 Bacteria 13370
122 Ga0068860_100026878 3300005843 Bacteria 5546
123 Ga0068860_100163394 3300005843 Bacteria 2148
124 Ga0068860_100414311 3300005843 Bacteria 1335
125 Ga0068862_100573332 3300005844 Bacteria 1080
126 Ga0081539_10005842 3300005985 Bacteria 12212
127 Ga0097621_100008445 3300006237 Bacteria 7418
128 Ga0097621_100009424 3300006237 Bacteria 7083
129 Ga0068871_100014821 3300006358 Bacteria 5822
130 Ga0068871_100064196 3300006358 Bacteria 3006
131 Ga0068871_100110626 3300006358 Bacteria 2310
132 Ga0068871_100171752 3300006358 Bacteria 1859
133 Ga0075428_100007787 3300006844 Bacteria 11871
134 Ga0075428_100007967 3300006844 Bacteria 11752
135 Ga0075428_100386350 3300006844 Bacteria 1501
136 Ga0075430_100026651 3300006846 Bacteria 4915
137 Ga0075431_100009298 3300006847 Bacteria 9860
138 Ga0075431_100035492 3300006847 Bacteria 5134
139 Ga0075431_100090130 3300006847 Bacteria 3165
140 Ga0068865_100362296 3300006881 Bacteria 1178
141 Ga0068865_100387813 3300006881 Bacteria 1141
142 Ga0097620_100000163 3300006931 Bacteria 64401
143 Ga0097620_100046567 3300006931 Bacteria 4355
144 Ga0097620_100782508 3300006931 Bacteria 1042
145 Ga0105240_10165966 3300009093 Bacteria 2619
146 Ga0111539_10071674 3300009094 Bacteria 4088
147 Ga0105247_10006998 3300009101 Bacteria 6942
148 Ga0105247_10591318 3300009101 Unclassified 822
149 Ga0114129_10115391 3300009147 Bacteria 3702
150 Ga0114129_10446583 3300009147 Bacteria 1696
151 Ga0105241_10003275 3300009174 Bacteria 12047
152 Ga0105241_10033005 3300009174 Bacteria 3884
153 Ga0105241_10375882 3300009174 Bacteria 1240
154 Ga0105242_10361264 3300009176 Bacteria 1344
155 Ga0105242_10415186 3300009176 Bacteria 1259
156 Ga0105237_10001797 3300009545 Bacteria 27696
157 Ga0105237_10007696 3300009545 Bacteria 11768
158 Ga0105237_10040607 3300009545 Bacteria 4692
159 Ga0105237_10058904 3300009545 Bacteria 3844
160 Ga0105237_10221691 3300009545 Bacteria 1891
161 Ga0105249_10001253 3300009553 Bacteria 22260
162 Ga0105249_10003249 3300009553 Bacteria 14079
163 Ga0105249_10025965 3300009553 Bacteria 5275
164 Ga0105239_10107960 3300010375 Bacteria 3084
165 Ga0105239_10119255 3300010375 Bacteria 2928
166 Ga0105239_10333956 3300010375 Unclassified 1710
167 Ga0105239_11112708 3300010375 Bacteria 909
168 Ga0157373_10355810 3300013100 Bacteria 1045
169 Ga0157371_10034380 3300013102 Bacteria 3636
170 Ga0157371_10172470 3300013102 Unclassified 1546
171 Ga0157371_10243539 3300013102 Bacteria 1294
172 Ga0157371_10272891 3300013102 Bacteria 1221
173 Ga0157370_10137787 3300013104 Bacteria 2274
174 Ga0157369_10040833 3300013105 Bacteria 5064
175 Ga0157369_10058216 3300013105 Bacteria 4168
176 Ga0157369_10058933 3300013105 Bacteria 4141
177 Ga0157369_10160988 3300013105 Unclassified 2369
178 Ga0157369_10403223 3300013105 Bacteria 1419
179 Ga0157374_10072367 3300013296 Bacteria 3252
180 Ga0157374_10134651 3300013296 Bacteria 2394
181 Ga0157374_10220182 3300013296 Unclassified 1862
182 Ga0157374_10235804 3300013296 Bacteria 1798
183 Ga0157374_10241320 3300013296 Bacteria 1777
184 Ga0157374_11029937 3300013296 Unclassified 843
185 Ga0157378_10108657 3300013297 Bacteria 2540
186 Ga0157378_10225381 3300013297 Bacteria 1784
187 Ga0157378_10502428 3300013297 Bacteria 1211
188 Ga0163162_10000785 3300013306 Bacteria 29535
189 Ga0163162_10003791 3300013306 Bacteria 14497
190 Ga0163162_10088723 3300013306 Bacteria 3172
191 Ga0163162_10313008 3300013306 Bacteria 1703
192 Ga0163162_10329520 3300013306 Bacteria 1659
193 Ga0163162_10392559 3300013306 Bacteria 1520
194 Ga0163162_10729088 3300013306 Bacteria 1111
195 Ga0157372_10039967 3300013307 Bacteria 5180
196 Ga0157372_10070439 3300013307 Unclassified 3934
197 Ga0157372_10077061 3300013307 Bacteria 3765
198 Ga0157372_10110095 3300013307 Bacteria 3154
199 Ga0157372_10216695 3300013307 Bacteria 2219
200 Ga0157372_10242985 3300013307 Bacteria 2089
201 Ga0157372_10269008 3300013307 Bacteria 1980
202 Ga0157372_10535585 3300013307 Bacteria 1365
203 Ga0157372_10538315 3300013307 Bacteria 1361
204 Ga0157372_10753487 3300013307 Bacteria 1132
205 Ga0157372_11303166 3300013307 Bacteria 838
206 Ga0157372_11638059 3300013307 Bacteria 741
207 Ga0157375_10015969 3300013308 Bacteria 6734
208 Ga0157375_10039867 3300013308 Bacteria 4523
209 Ga0157375_10070994 3300013308 Bacteria 3494
210 Ga0157375_10170470 3300013308 Bacteria 2324
211 Ga0157375_10230613 3300013308 Bacteria 2011
212 Ga0163163_10000281 3300014325 Bacteria 50719
213 Ga0163163_10003228 3300014325 Bacteria 13824
214 Ga0163163_10077908 3300014325 Bacteria 3310
215 Ga0163163_10261128 3300014325 Bacteria 1783
216 Ga0163163_10390497 3300014325 Bacteria 1450
217 Ga0163163_11070295 3300014325 Bacteria 869
218 Ga0157380_10021577 3300014326 Bacteria 4832
219 Ga0157380_10204759 3300014326 Bacteria 1753
220 Ga0157380_10240072 3300014326 Bacteria 1633
221 Ga0157377_10049592 3300014745 Bacteria 2360
222 Ga0157377_10110315 3300014745 Bacteria 1653
223 Ga0157377_10236338 3300014745 Bacteria 1177
224 Ga0157379_10036121 3300014968 Bacteria 4406
225 Ga0157379_10113523 3300014968 Bacteria 2435
226 Ga0157379_10329415 3300014968 Bacteria 1395
227 Ga0157376_10002516 3300014969 Bacteria 12416
228 Ga0157376_10661802 3300014969 Bacteria 1046
229 Ga0163161_10055548 3300017792 Bacteria 2875
230 Ga0163161_10162479 3300017792 Bacteria 1703
231 Ga0163161_10546121 3300017792 Bacteria 949
232 Ga0163161_10644341 3300017792 Bacteria 877
233 Ga0207656_10045468 3300025321 Bacteria 1879
234 Ga0207680_10000068 3300025903 Bacteria 45911
235 Ga0207680_10245470 3300025903 Bacteria 1235
236 Ga0207647_10000403 3300025904 Bacteria 35357
237 Ga0207647_10074816 3300025904 Bacteria 2039
238 Ga0207645_10417126 3300025907 Unclassified 904
239 Ga0207645_10820621 3300025907 Bacteria 632
240 Ga0207705_10392563 3300025909 Bacteria 1073
241 Ga0207705_10633086 3300025909 Unclassified 832
242 Ga0207654_10277504 3300025911 Unclassified 1132
243 Ga0207654_10460821 3300025911 Bacteria 893
244 Ga0207695_10140024 3300025913 Unclassified 2369
245 Ga0207671_10001122 3300025914 Bacteria 32272
246 Ga0207671_10036027 3300025914 Bacteria 3669
247 Ga0207671_10037604 3300025914 Bacteria 3588
248 Ga0207662_10040350 3300025918 Bacteria 2743
249 Ga0207662_10405337 3300025918 Bacteria 925
250 Ga0207657_10031254 3300025919 Bacteria 4826
251 Ga0207649_10097679 3300025920 Bacteria 1937
252 Ga0207649_10324884 3300025920 Bacteria 1131
253 Ga0207652_10071896 3300025921 Bacteria 3007
254 Ga0207681_10503126 3300025923 Bacteria 992
255 Ga0207681_10521785 3300025923 Bacteria 975
256 Ga0207681_10559460 3300025923 Bacteria 942
257 Ga0207650_10014963 3300025925 Bacteria 5396
258 Ga0207650_10029194 3300025925 Bacteria 3962
259 Ga0207650_10033002 3300025925 Unclassified 3747
260 Ga0207650_10184389 3300025925 Bacteria 1665
261 Ga0207650_10276929 3300025925 Bacteria 1365
262 Ga0207659_10036520 3300025926 Bacteria 3404
263 Ga0207644_10361408 3300025931 Unclassified 1181
264 Ga0207644_10703607 3300025931 Bacteria 843
265 Ga0207690_10138106 3300025932 Bacteria 1792
266 Ga0207690_11030915 3300025932 Bacteria 685
267 Ga0207706_10008847 3300025933 Bacteria 9267
268 Ga0207706_10860571 3300025933 Unclassified 767
269 Ga0207686_10128399 3300025934 Bacteria 1735
270 Ga0207670_10153174 3300025936 Bacteria 1713
271 Ga0207669_10080242 3300025937 Bacteria 2086
272 Ga0207691_10039333 3300025940 Unclassified 4375
273 Ga0207691_10068474 3300025940 Bacteria 3207
274 Ga0207691_10213357 3300025940 Bacteria 1676
275 Ga0207691_10266415 3300025940 Bacteria 1476
276 Ga0207691_10649518 3300025940 Unclassified 891
277 Ga0207689_10001942 3300025942 Bacteria 19584
278 Ga0207689_10233234 3300025942 Bacteria 1521
279 Ga0207661_10164963 3300025944 Bacteria 1924
280 Ga0207661_10424942 3300025944 Bacteria 1207
281 Ga0207661_10721198 3300025944 Unclassified 917
282 Ga0207679_10004049 3300025945 Bacteria 9104
283 Ga0207679_10018879 3300025945 Bacteria 4626
284 Ga0207679_10322556 3300025945 Bacteria 1338
285 Ga0207679_10488273 3300025945 Bacteria 1097
286 Ga0207679_10595609 3300025945 Unclassified 996
287 Ga0207679_10660534 3300025945 Bacteria 946
288 Ga0207667_10021922 3300025949 Bacteria 7071
289 Ga0207667_10142986 3300025949 Unclassified 2463
290 Ga0207651_10261581 3300025960 Bacteria 1421
291 Ga0207651_10301394 3300025960 Bacteria 1333
292 Ga0207651_10653133 3300025960 Bacteria 923
293 Ga0207712_10003627 3300025961 Bacteria 9733
294 Ga0207712_10110144 3300025961 Bacteria 2064
295 Ga0207668_10056934 3300025972 Bacteria 2725
296 Ga0207668_10544849 3300025972 Bacteria 1004
297 Ga0207658_10073054 3300025986 Bacteria 2602
298 Ga0207677_10035755 3300026023 Bacteria 3229
299 Ga0207703_10002716 3300026035 Bacteria 15157
300 Ga0207639_10027347 3300026041 Bacteria 4155
301 Ga0207639_10034841 3300026041 Bacteria 3723
302 Ga0207678_10068681 3300026067 Bacteria 3040
303 Ga0207641_10000176 3300026088 Bacteria 88863
304 Ga0207641_10242898 3300026088 Bacteria 1679
305 Ga0207641_10661233 3300026088 Bacteria 1027
306 Ga0207641_10926145 3300026088 Bacteria 866
307 Ga0207648_10135351 3300026089 Bacteria 2170
308 Ga0207676_10013352 3300026095 Bacteria 5900
309 Ga0207676_10013878 3300026095 Bacteria 5784
310 Ga0207676_10035931 3300026095 Bacteria 3766
311 Ga0207676_10070526 3300026095 Bacteria 2803
312 Ga0207676_10076300 3300026095 Bacteria 2708
313 Ga0207676_10157831 3300026095 Bacteria 1962
314 Ga0207674_10057613 3300026116 Bacteria 3938
315 Ga0207674_10062602 3300026116 Bacteria 3758
316 Ga0207674_10080083 3300026116 Bacteria 3270
317 Ga0207674_10210062 3300026116 Bacteria 1896
318 Ga0207674_10380057 3300026116 Bacteria 1365
319 Ga0207674_10387879 3300026116 Bacteria 1350
320 Ga0207683_10050202 3300026121 Bacteria 3653
321 Ga0207683_10071043 3300026121 Bacteria 3077
322 Ga0207683_10999040 3300026121 Unclassified 777
323 Ga0207698_10020829 3300026142 Bacteria 4522
324 Ga0207698_10132963 3300026142 Bacteria 2129
325 Ga0207698_10683070 3300026142 Bacteria 1020
326 Ga0207698_11352007 3300026142 Unclassified 727
327 Ga0207428_10274529 3300027907 Bacteria 1252
328 Ga0268266_10349626 3300028379 Bacteria 1389
329 Ga0268265_11953729 3300028380 Bacteria 594
330 Ga0268264_10002016 3300028381 Bacteria 18236
331 Ga0268264_10018028 3300028381 Bacteria 5773
332 Ga0268264_10349020 3300028381 Bacteria 1408
333 Ga0265336_10011748 3300028666 Bacteria 2965
334 Ga0307515_10000107 3300028794 Bacteria 197046
335 Ga0265338_10266882 3300028800 Bacteria 1256
336 Ga0316177_1012614 3300030731 Bacteria 2754
337 Ga0316176_1009249 3300030732 Bacteria 17896
338 Ga0314311_1182981 3300030733 Bacteria 742
339 Ga0316183_1174733 3300030742 Bacteria 32145
340 Ga0265327_10000051 3300031251 Bacteria 257963
341 Ga0265327_10043032 3300031251 Bacteria 2420
342 Ga0307513_10329737 3300031456 Bacteria 1281
343 Ga0307509_10110413 3300031507 Unclassified 2756
344 Ga0307508_10329451 3300031616 Bacteria 1119
345 Ga0307413_10194309 3300031824 Bacteria 1460
346 Ga0307413_10253348 3300031824 Bacteria 1307
347 Ga0307413_11048887 3300031824 Bacteria 701
348 Ga0307410_10230776 3300031852 Bacteria 1429
349 Ga0307416_100438685 3300032002 Bacteria 1355
350 Ga0307414_10061126 3300032004 Bacteria 2667
351 Ga0307411_10347512 3300032005 Bacteria 1208
352 Ga0373937_0577160 3300036401 Bacteria 1068
353 Ga0395900_0039629 3300037418 Bacteria 4854
354 Ga0395898_0191354 3300037466 Bacteria 1954
355 Ga0395905_0041264 3300037471 Bacteria 4330
356 Ga0395905_0043180 3300037471 Bacteria 4230
357 Ga0395901_0165516 3300038443 Bacteria 2322
358 Ga0395901_0971845 3300038443 Unclassified 827
359 Ga0436365_0834351 3300039437 Bacteria 1025
360 Ga0436363_0270134 3300039450 Unclassified 992
361 Ga0439431_0002907 3300041997 Bacteria 3766
362 Ga0439431_0051453 3300041997 Bacteria 1069
363 Ga0439445_0038724 3300042004 Bacteria 1261
364 Ga0439444_0037592 3300042437 Bacteria 937
365 Ga0466972_0000058 3300044658 Bacteria 110716
366 Ga0453683_0253758 3300044673 Bacteria 1121
367 Ga0466961_0204503 3300044693 Bacteria 1220
368 Ga0453684_0020993 3300044712 Bacteria 9792
369 Ga0453684_0024168 3300044712 Bacteria 8898
370 Ga0453684_0037418 3300044712 Bacteria 6661
371 Ga0453684_0151158 3300044712 Bacteria 2759
372 Ga0466970_0002535 3300044765 Bacteria 8816
373 Ga0466959_0632080 3300045049 Unclassified 719
374 Ga0451576_0084333 3300045051 Bacteria 3305
375 Ga0466967_0550401 3300045976 Bacteria 1136
376 Ga0495621_0293967 3300046539 Unclassified 672
377 Ga0496104_1002645 3300048907 Unclassified 739
378 Ga0496108_0138265 3300048911 Bacteria 2098
379 Ga0501298_014148 3300049521 Bacteria 1422
380 Ga0501032_0002044 3300049569 Bacteria 15933
381 Ga0501033_0125101 3300049570 Bacteria 1864
382 Ga0501034_0009033 3300049571 Bacteria 10466
383 Ga0501034_0101915 3300049571 Bacteria 2864
384 Ga0501036_0029147 3300049572 Bacteria 4666
385 Ga0501038_0037782 3300049574 Bacteria 4233
386 Ga0501043_0005780 3300049579 Bacteria 9957
387 Ga0501043_0013881 3300049579 Bacteria 6303
388 Ga0501047_0005535 3300049581 Bacteria 11888
389 Ga0501198_006895 3300049649 Bacteria 1627
390 Ga0501198_018586 3300049649 Bacteria 1089
391 Ga0501202_012512 3300049652 Bacteria 1602
392 Ga0501202_056726 3300049652 Bacteria 878
393 Ga0501202_072239 3300049652 Bacteria 797
394 Ga0501207_036207 3300049654 Bacteria 846
395 Ga0501209_059238 3300049656 Bacteria 1064
396 Ga0501217_001330 3300049661 Bacteria 4599
397 Ga0501222_028167 3300049662 Unclassified 766
398 Ga0501227_011012 3300049665 Bacteria 1967
399 Ga0501228_025121 3300049666 Unclassified 698
400 Ga0501233_000552 3300049668 Bacteria 6058
401 Ga0501235_002920 3300049669 Bacteria 3680
402 Ga0501243_005657 3300049675 Bacteria 1881
403 Ga0501243_006225 3300049675 Bacteria 1807
404 Ga0501249_032027 3300049679 Bacteria 1175
405 Ga0501250_013760 3300049680 Bacteria 974
406 Ga0501250_025962 3300049680 Bacteria 788
407 Ga0501259_004077 3300049688 Bacteria 2324
408 Ga0501260_004667 3300049689 Bacteria 1272
409 Ga0501221_000286 3300049704 Bacteria 7527
410 Ga0501225_0002836 3300049705 Bacteria 5323
411 Ga0501225_0048713 3300049705 Unclassified 1177
412 Ga0501080_0335836 3300049742 Bacteria 1366
413 Ga0501080_0335897 3300049742 Bacteria 1366
414 Ga0501268_073426 3300049765 Bacteria 695
415 Ga0501035_0001510 3300049822 Bacteria 23798
416 Ga0501044_0002356 3300049823 Bacteria 21549
417 Ga0501044_0188424 3300049823 Bacteria 2026
418 nmdc:mga05p37_50621_c1 3300050507 Bacteria 5109
419 nmdc:mga09592_15988_c1 3300050508 Bacteria 6132
420 nmdc:mga09592_180014_c1 3300050508 Bacteria 1829
421 nmdc:mga0qj67_119010_c1 3300050509 Bacteria 2136
422 nmdc:mga06r32_24090_c1 3300050510 Bacteria 5644
423 nmdc:mga06r32_251101_c1 3300050510 Bacteria 1756
424 nmdc:mga06r32_328357_c1 3300050510 Unclassified 1515
425 nmdc:mga08y16_53571_c1 3300050511 Bacteria 4218
426 nmdc:mga08y16_79560_c1 3300050511 Bacteria 3416
427 Ga0466962_0095424 3300061719 Bacteria 1426
428 2819588106 2818991444 Bacteria 6968812
429 2842906794 2842903701 Bacteria 6986368
430 2883073125 2883068021 Bacteria 6192739
431 2896087457 2896085136 Bacteria 6129793
432 JGI24751J29686_10001353
433 JGI25406J46586_10019537
434 rootL2_10091097
435 rootH1_10134819
436 Ga0065714_10073174
437 Ga0065704_10000188
438 Ga0065712_10185068
439 Ga0065715_10646633
440 Ga0070658_10189982
441 Ga0070683_100014614
442 Ga0070670_100012713
443 Ga0070670_100064596
444 Ga0070670_100081278
445 Ga0070670_100096201
446 Ga0070670_100129705
447 Ga0070670_100370775
448 Ga0070670_100420997
449 Ga0070677_10047884
450 Ga0070677_10070614
451 Ga0068869_100083350
452 Ga0070666_10000165
453 Ga0070666_10439740
454 Ga0070680_100127355
455 Ga0070680_100337661
456 Ga0070682_100009232
457 Ga0070682_100206331
458 Ga0070682_100288521
459 Ga0070682_100378372
460 Ga0068868_100000661
461 Ga0068868_100465160
462 Ga0070660_100051462
463 Ga0070689_100077632
464 Ga0070689_100180706
465 Ga0070661_100132780
466 Ga0070661_100460263
467 Ga0070668_100621391
468 Ga0070669_100064372
469 Ga0070669_100541987
470 Ga0070669_100543956
471 Ga0070669_100826703
472 Ga0070675_100429149
473 Ga0070675_100505640
474 Ga0070671_100379561
475 Ga0070674_100046421
476 Ga0070674_100922304
477 Ga0070673_100046776
478 Ga0070673_100060291
479 Ga0070673_100097882
480 Ga0070673_100253456
481 Ga0070688_100242311
482 Ga0070659_100002804
483 Ga0070659_100027598
484 Ga0070659_100797054
485 Ga0070667_100085934
486 Ga0070678_100008645
487 Ga0070678_100309846
488 Ga0070678_101476437
489 Ga0070662_100934037
490 Ga0068867_100320947
491 Ga0070685_10084523
492 Ga0070707_100060474
493 Ga0070698_100000965
494 Ga0070698_100019250
495 Ga0070699_100642987
496 Ga0070679_100053206
497 Ga0070679_100096780
498 Ga0070679_100189569
499 Ga0070679_100355430
500 Ga0070684_100160720
501 Ga0070684_100191719
502 Ga0068853_100012594
503 Ga0068853_100023262
504 Ga0068853_100377042
505 Ga0068853_100511084
506 Ga0068853_100907346
507 Ga0070672_100138307
508 Ga0070672_100271457
509 Ga0070672_100312672
510 Ga0070686_101067633
511 Ga0070665_100455437
512 Ga0068855_100006715
513 Ga0068855_100122370
514 Ga0068855_100292719
515 Ga0070664_100002699
516 Ga0070664_100008472
517 Ga0070664_100212018
518 Ga0070664_100426201
519 Ga0070664_100561498
520 Ga0070664_100764938
521 Ga0068857_100035155
522 Ga0068857_100175963
523 Ga0068857_100178582
524 Ga0068857_100419495
525 Ga0068857_100534005
526 Ga0068857_101401755
527 Ga0068854_100019863
528 Ga0068856_100185662
529 Ga0068856_100222545
530 Ga0070702_100741041
531 Ga0068852_100003784
532 Ga0068852_100074235
533 Ga0068852_100357947
534 Ga0068852_100386926
535 Ga0068852_100392195
536 Ga0068852_100612596
537 Ga0068859_100000163
538 Ga0068859_100046568
539 Ga0068864_100006105
540 Ga0068864_100007506
541 Ga0068864_100045908
542 Ga0068864_100164589
543 Ga0068864_100992837
544 Ga0068866_10130621
545 Ga0068861_101045315
546 Ga0068851_10030739
547 Ga0068851_10070209
548 Ga0068870_10343084
549 Ga0068863_100261110
550 Ga0068863_100680944
551 Ga0068858_100005029
552 Ga0068860_100005091
553 Ga0068860_100026878
554 Ga0068860_100163394
555 Ga0068860_100414311
556 Ga0068862_100573332
557 Ga0081539_10005842
558 Ga0097621_100008445
559 Ga0097621_100009424
560 Ga0068871_100014821
561 Ga0068871_100064196
562 Ga0068871_100110626
563 Ga0068871_100171752
564 Ga0075428_100007787
565 Ga0075428_100007967
566 Ga0075428_100386350
567 Ga0075430_100026651
568 Ga0075431_100009298
569 Ga0075431_100035492
570 Ga0075431_100090130
571 Ga0068865_100362296
572 Ga0068865_100387813
573 Ga0097620_100000163
574 Ga0097620_100046567
575 Ga0097620_100782508
576 Ga0105240_10165966
577 Ga0111539_10071674
578 Ga0105247_10006998
579 Ga0105247_10591318
580 Ga0114129_10115391
581 Ga0114129_10446583
582 Ga0105241_10003275
583 Ga0105241_10033005
584 Ga0105241_10375882
585 Ga0105242_10361264
586 Ga0105242_10415186
587 Ga0105237_10001797
588 Ga0105237_10007696
589 Ga0105237_10040607
590 Ga0105237_10058904
591 Ga0105237_10221691
592 Ga0105249_10001253
593 Ga0105249_10003249
594 Ga0105249_10025965
595 Ga0105239_10107960
596 Ga0105239_10119255
597 Ga0105239_10333956
598 Ga0105239_11112708
599 Ga0157373_10355810
600 Ga0157371_10034380
601 Ga0157371_10172470
602 Ga0157371_10243539
603 Ga0157371_10272891
604 Ga0157370_10137787
605 Ga0157369_10040833
606 Ga0157369_10058216
607 Ga0157369_10058933
608 Ga0157369_10160988
609 Ga0157369_10403223
610 Ga0157374_10072367
611 Ga0157374_10134651
612 Ga0157374_10220182
613 Ga0157374_10235804
614 Ga0157374_10241320
615 Ga0157374_11029937
616 Ga0157378_10108657
617 Ga0157378_10225381
618 Ga0157378_10502428
619 Ga0163162_10000785
620 Ga0163162_10003791
621 Ga0163162_10088723
622 Ga0163162_10313008
623 Ga0163162_10329520
624 Ga0163162_10392559
625 Ga0163162_10729088
626 Ga0157372_10039967
627 Ga0157372_10070439
628 Ga0157372_10077061
629 Ga0157372_10110095
630 Ga0157372_10216695
631 Ga0157372_10242985
632 Ga0157372_10269008
633 Ga0157372_10535585
634 Ga0157372_10538315
635 Ga0157372_10753487
636 Ga0157372_11303166
637 Ga0157372_11638059
638 Ga0157375_10015969
639 Ga0157375_10039867
640 Ga0157375_10070994
641 Ga0157375_10170470
642 Ga0157375_10230613
643 Ga0163163_10000281
644 Ga0163163_10003228
645 Ga0163163_10077908
646 Ga0163163_10261128
647 Ga0163163_10390497
648 Ga0163163_11070295
649 Ga0157380_10021577
650 Ga0157380_10204759
651 Ga0157380_10240072
652 Ga0157377_10049592
653 Ga0157377_10110315
654 Ga0157377_10236338
655 Ga0157379_10036121
656 Ga0157379_10113523
657 Ga0157379_10329415
658 Ga0157376_10002516
659 Ga0157376_10661802
660 Ga0163161_10055548
661 Ga0163161_10162479
662 Ga0163161_10546121
663 Ga0163161_10644341
664 Ga0207656_10045468
665 Ga0207680_10000068
666 Ga0207680_10245470
667 Ga0207647_10000403
668 Ga0207647_10074816
669 Ga0207645_10417126
670 Ga0207645_10820621
671 Ga0207705_10392563
672 Ga0207705_10633086
673 Ga0207654_10277504
674 Ga0207654_10460821
675 Ga0207695_10140024
676 Ga0207671_10001122
677 Ga0207671_10036027
678 Ga0207671_10037604
679 Ga0207662_10040350
680 Ga0207662_10405337
681 Ga0207657_10031254
682 Ga0207649_10097679
683 Ga0207649_10324884
684 Ga0207652_10071896
685 Ga0207681_10503126
686 Ga0207681_10521785
687 Ga0207681_10559460
688 Ga0207650_10014963
689 Ga0207650_10029194
690 Ga0207650_10033002
691 Ga0207650_10184389
692 Ga0207650_10276929
693 Ga0207659_10036520
694 Ga0207644_10361408
695 Ga0207644_10703607
696 Ga0207690_10138106
697 Ga0207690_11030915
698 Ga0207706_10008847
699 Ga0207706_10860571
700 Ga0207686_10128399
701 Ga0207670_10153174
702 Ga0207669_10080242
703 Ga0207691_10039333
704 Ga0207691_10068474
705 Ga0207691_10213357
706 Ga0207691_10266415
707 Ga0207691_10649518
708 Ga0207689_10001942
709 Ga0207689_10233234
710 Ga0207661_10164963
711 Ga0207661_10424942
712 Ga0207661_10721198
713 Ga0207679_10004049
714 Ga0207679_10018879
715 Ga0207679_10322556
716 Ga0207679_10488273
717 Ga0207679_10595609
718 Ga0207679_10660534
719 Ga0207667_10021922
720 Ga0207667_10142986
721 Ga0207651_10261581
722 Ga0207651_10301394
723 Ga0207651_10653133
724 Ga0207712_10003627
725 Ga0207712_10110144
726 Ga0207668_10056934
727 Ga0207668_10544849
728 Ga0207658_10073054
729 Ga0207677_10035755
730 Ga0207703_10002716
731 Ga0207639_10027347
732 Ga0207639_10034841
733 Ga0207678_10068681
734 Ga0207641_10000176
735 Ga0207641_10242898
736 Ga0207641_10661233
737 Ga0207641_10926145
738 Ga0207648_10135351
739 Ga0207676_10013352
740 Ga0207676_10013878
741 Ga0207676_10035931
742 Ga0207676_10070526
743 Ga0207676_10076300
744 Ga0207676_10157831
745 Ga0207674_10057613
746 Ga0207674_10062602
747 Ga0207674_10080083
748 Ga0207674_10210062
749 Ga0207674_10380057
750 Ga0207674_10387879
751 Ga0207683_10050202
752 Ga0207683_10071043
753 Ga0207683_10999040
754 Ga0207698_10020829
755 Ga0207698_10132963
756 Ga0207698_10683070
757 Ga0207698_11352007
758 Ga0207428_10274529
759 Ga0268266_10349626
760 Ga0268265_11953729
761 Ga0268264_10002016
762 Ga0268264_10018028
763 Ga0268264_10349020
764 Ga0265336_10011748
765 Ga0307515_10000107
766 Ga0265338_10266882
767 Ga0316177_1012614
768 Ga0316176_1009249
769 Ga0314311_1182981
770 Ga0316183_1174733
771 Ga0265327_10000051
772 Ga0265327_10043032
773 Ga0307513_10329737
774 Ga0307509_10110413
775 Ga0307508_10329451
776 Ga0307413_10194309
777 Ga0307413_10253348
778 Ga0307413_11048887
779 Ga0307410_10230776
780 Ga0307416_100438685
781 Ga0307414_10061126
782 Ga0307411_10347512
783 Ga0373937_0577160
784 Ga0395900_0039629
785 Ga0395898_0191354
786 Ga0395905_0041264
787 Ga0395905_0043180
788 Ga0395901_0165516
789 Ga0395901_0971845
790 Ga0436365_0834351
791 Ga0436363_0270134
792 Ga0439431_0002907
793 Ga0439431_0051453
794 Ga0439445_0038724
795 Ga0439444_0037592
796 Ga0466972_0000058
797 Ga0453683_0253758
798 Ga0466961_0204503
799 Ga0453684_0020993
800 Ga0453684_0024168
801 Ga0453684_0037418
802 Ga0453684_0151158
803 Ga0466970_0002535
804 Ga0466959_0632080
805 Ga0451576_0084333
806 Ga0466967_0550401
807 Ga0495621_0293967
808 Ga0496104_1002645
809 Ga0496108_0138265
810 Ga0501298_014148
811 Ga0501032_0002044
812 Ga0501033_0125101
813 Ga0501034_0009033
814 Ga0501034_0101915
815 Ga0501036_0029147
816 Ga0501038_0037782
817 Ga0501043_0005780
818 Ga0501043_0013881
819 Ga0501047_0005535
820 Ga0501198_006895
821 Ga0501198_018586
822 Ga0501202_012512
823 Ga0501202_056726
824 Ga0501202_072239
825 Ga0501207_036207
826 Ga0501209_059238
827 Ga0501217_001330
828 Ga0501222_028167
829 Ga0501227_011012
830 Ga0501228_025121
831 Ga0501233_000552
832 Ga0501235_002920
833 Ga0501243_005657
834 Ga0501243_006225
835 Ga0501249_032027
836 Ga0501250_013760
837 Ga0501250_025962
838 Ga0501259_004077
839 Ga0501260_004667
840 Ga0501221_000286
841 Ga0501225_0002836
842 Ga0501225_0048713
843 Ga0501080_0335836
844 Ga0501080_0335897
845 Ga0501268_073426
846 Ga0501035_0001510
847 Ga0501044_0002356
848 Ga0501044_0188424
849 nmdc:mga05p37_50621_c1
850 nmdc:mga09592_15988_c1
851 nmdc:mga09592_180014_c1
852 nmdc:mga0qj67_119010_c1
853 nmdc:mga06r32_24090_c1
854 nmdc:mga06r32_251101_c1
855 nmdc:mga06r32_328357_c1
856 nmdc:mga08y16_53571_c1
857 nmdc:mga08y16_79560_c1
858 Ga0466962_0095424
859 2819588106
860 2842906794
861 2883073125
862 2896087457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

70

228

0.98

Map