F442126

General Info

Members Datasets Scaffolds Average Seq Length
430 243 860 168

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10680021|Ga0105241_106800212
Length 188
Sequence MKSNGAGLEAGHERRRKAMYYEVISQCVQSLGNLETCLAKAERFAEAKRIDVGVLLNASLAPDMRNFIYQVQSACDYVKAAAAWLSGQVPPKHEDTEKTIDELRARIRKTVAFAESVPQSQYDCASEQLIRLSWAPGKVIGDEDYLLQMTVPNTFFHLAMAYGILRHNGVGVGKMDFLGPINLVDDPG

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
239 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
240 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
241 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
242 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
243 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.23
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.23
Rhizoplane 1.16
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10680021 3300009174 Bacteria 937
2 JGI24736J21556_1002410 3300001904 Bacteria 3302
3 JGI24741J21665_1021332 3300001915 Unclassified 1012
4 JGI24740J21852_10024393 3300001979 Bacteria 2052
5 JGI24739J22299_10015914 3300001989 Bacteria 2729
6 JGI24737J22298_10034509 3300001990 Bacteria 1568
7 JGI24735J21928_10002974 3300002067 Bacteria 5836
8 JGI24738J21930_10001076 3300002075 Bacteria 7749
9 JGI25156J39149_1000017 3300002705 Bacteria 171827
10 JGI25165J46597_1005149 3300003214 Unclassified 2588
11 JGI25160J50197_1034173 3300003354 Bacteria 1266
12 Ga0055530_10000020 3300003791 Bacteria 139957
13 Ga0055543_1010535 3300004625 Bacteria 1933
14 Ga0065165_1000662 3300005262 Bacteria 49679
15 Ga0065707_10177023 3300005295 Bacteria 1444
16 Ga0070683_100741851 3300005329 Unclassified 941
17 Ga0070670_100560011 3300005331 Bacteria 1020
18 Ga0068869_100000731 3300005334 Bacteria 18675
19 Ga0068869_101353492 3300005334 Bacteria 629
20 Ga0068868_100000014 3300005338 Bacteria 108275
21 Ga0070660_100518421 3300005339 Unclassified 992
22 Ga0070661_100123536 3300005344 Bacteria 1940
23 Ga0070661_100223774 3300005344 Bacteria 1444
24 Ga0070675_100916762 3300005354 Bacteria 803
25 Ga0070673_100000004 3300005364 Bacteria 199809
26 Ga0070659_100242675 3300005366 Bacteria 1491
27 Ga0070667_100000265 3300005367 Bacteria 59228
28 Ga0070709_10008974 3300005434 Bacteria 5506
29 Ga0070709_10022124 3300005434 Bacteria 3714
30 Ga0070709_10039297 3300005434 Bacteria 2902
31 Ga0070709_10791621 3300005434 Unclassified 743
32 Ga0070714_100036358 3300005435 Bacteria 4130
33 Ga0070714_100203101 3300005435 Bacteria 1813
34 Ga0070714_100376173 3300005435 Bacteria 1338
35 Ga0070713_100044420 3300005436 Bacteria 3637
36 Ga0070713_100207571 3300005436 Bacteria 1772
37 Ga0070713_100469656 3300005436 Unclassified 1184
38 Ga0070713_100633428 3300005436 Bacteria 1017
39 Ga0070713_100753584 3300005436 Bacteria 932
40 Ga0070713_100802171 3300005436 Bacteria 902
41 Ga0070710_10002501 3300005437 Bacteria 8710
42 Ga0070710_10012357 3300005437 Bacteria 4238
43 Ga0070711_100005244 3300005439 Bacteria 7733
44 Ga0070711_100012532 3300005439 Bacteria 5299
45 Ga0070711_100110714 3300005439 Bacteria 2015
46 Ga0070711_100565372 3300005439 Bacteria 945
47 Ga0070711_100962560 3300005439 Bacteria 731
48 Ga0070705_100162913 3300005440 Bacteria 1493
49 Ga0070705_100329480 3300005440 Bacteria 1105
50 Ga0070705_100781788 3300005440 Bacteria 758
51 Ga0070700_101466119 3300005441 Bacteria 579
52 Ga0070694_100238052 3300005444 Bacteria 1372
53 Ga0070694_100565008 3300005444 Bacteria 912
54 Ga0070708_100054887 3300005445 Bacteria 3541
55 Ga0070708_100058680 3300005445 Bacteria 3429
56 Ga0070708_100211911 3300005445 Bacteria 1815
57 Ga0070708_100213074 3300005445 Bacteria 1810
58 Ga0070708_100225344 3300005445 Bacteria 1759
59 Ga0070708_100246964 3300005445 Bacteria 1676
60 Ga0070708_100549405 3300005445 Bacteria 1089
61 Ga0070708_100815100 3300005445 Bacteria 877
62 Ga0070663_100672017 3300005455 Unclassified 878
63 Ga0070662_100087016 3300005457 Bacteria 2338
64 Ga0068867_100066968 3300005459 Bacteria 2676
65 Ga0070706_100064474 3300005467 Bacteria 3386
66 Ga0070706_100091560 3300005467 Bacteria 2820
67 Ga0070706_100153785 3300005467 Bacteria 2147
68 Ga0070706_100187296 3300005467 Bacteria 1934
69 Ga0070706_100188690 3300005467 Bacteria 1926
70 Ga0070706_100606039 3300005467 Bacteria 1017
71 Ga0070706_100858658 3300005467 Bacteria 839
72 Ga0070707_100013973 3300005468 Bacteria 7524
73 Ga0070707_100064250 3300005468 Bacteria 3524
74 Ga0070707_100074918 3300005468 Bacteria 3264
75 Ga0070707_100163801 3300005468 Unclassified 2167
76 Ga0070707_100243600 3300005468 Bacteria 1750
77 Ga0070707_100257030 3300005468 Bacteria 1700
78 Ga0070707_100298205 3300005468 Bacteria 1566
79 Ga0070707_100502612 3300005468 Bacteria 1174
80 Ga0070707_100896416 3300005468 Bacteria 851
81 Ga0070698_100009379 3300005471 Bacteria 10497
82 Ga0070698_100028133 3300005471 Bacteria 5842
83 Ga0070698_100047056 3300005471 Bacteria 4410
84 Ga0070698_100125739 3300005471 Bacteria 2521
85 Ga0070698_100186658 3300005471 Bacteria 2011
86 Ga0070698_100251172 3300005471 Bacteria 1701
87 Ga0070698_100536757 3300005471 Bacteria 1109
88 Ga0070698_100643578 3300005471 Bacteria 1001
89 Ga0070699_100044207 3300005518 Bacteria 3857
90 Ga0070699_100119369 3300005518 Bacteria 2318
91 Ga0070699_100167171 3300005518 Bacteria 1948
92 Ga0070699_100229957 3300005518 Bacteria 1653
93 Ga0070699_100233040 3300005518 Bacteria 1642
94 Ga0070699_100447271 3300005518 Bacteria 1171
95 Ga0070684_100243928 3300005535 Bacteria 1642
96 Ga0070684_100872634 3300005535 Unclassified 842
97 Ga0070697_100030177 3300005536 Bacteria 4354
98 Ga0070697_100092830 3300005536 Bacteria 2498
99 Ga0070697_100106799 3300005536 Unclassified 2329
100 Ga0070697_100151250 3300005536 Unclassified 1956
101 Ga0070697_100379262 3300005536 Bacteria 1225
102 Ga0070697_100813769 3300005536 Bacteria 827
103 Ga0070697_101350860 3300005536 Bacteria 636
104 Ga0068853_101021061 3300005539 Unclassified 796
105 Ga0070672_100775832 3300005543 Bacteria 842
106 Ga0070696_100008828 3300005546 Bacteria 6742
107 Ga0070696_100685058 3300005546 Bacteria 834
108 Ga0070665_100133884 3300005548 Bacteria 2480
109 Ga0070704_100761615 3300005549 Unclassified 863
110 Ga0068855_100204784 3300005563 Bacteria 2220
111 Ga0068855_101391154 3300005563 Unclassified 723
112 Ga0070664_100102929 3300005564 Bacteria 2485
113 Ga0068857_100648447 3300005577 Unclassified 1000
114 Ga0068854_100079763 3300005578 Bacteria 2414
115 Ga0068851_10025282 3300005834 Bacteria 2912
116 Ga0068858_100458262 3300005842 Bacteria 1229
117 Ga0068858_101657539 3300005842 Bacteria 631
118 Ga0068860_100060863 3300005843 Bacteria 3587
119 Ga0081540_1008847 3300005983 Bacteria 6990
120 Ga0070717_10220022 3300006028 Bacteria 1669
121 Ga0070717_10255090 3300006028 Bacteria 1550
122 Ga0070717_10309363 3300006028 Bacteria 1406
123 Ga0070717_10357035 3300006028 Bacteria 1307
124 Ga0070717_10444861 3300006028 Bacteria 1167
125 Ga0070717_11265085 3300006028 Unclassified 671
126 Ga0075368_10056329 3300006042 Bacteria 1568
127 Ga0070715_10021181 3300006163 Bacteria 2518
128 Ga0070715_10036001 3300006163 Bacteria 2039
129 Ga0070715_10039481 3300006163 Bacteria 1966
130 Ga0070715_10587530 3300006163 Bacteria 651
131 Ga0070716_100002137 3300006173 Bacteria 9083
132 Ga0070716_100022039 3300006173 Bacteria 3363
133 Ga0070716_100023955 3300006173 Bacteria 3244
134 Ga0070712_100010832 3300006175 Bacteria 5765
135 Ga0070712_100029778 3300006175 Bacteria 3662
136 Ga0070712_100133670 3300006175 Bacteria 1883
137 Ga0070712_100516186 3300006175 Bacteria 1003
138 Ga0070712_100716276 3300006175 Bacteria 854
139 Ga0070712_100810378 3300006175 Bacteria 804
140 Ga0075367_10020962 3300006178 Bacteria 3647
141 Ga0075366_10184383 3300006195 Bacteria 1268
142 Ga0075370_10029297 3300006353 Bacteria 3066
143 Ga0075431_100136461 3300006847 Bacteria 2529
144 Ga0075431_100605035 3300006847 Bacteria 1080
145 Ga0075431_100774532 3300006847 Unclassified 934
146 Ga0075433_10348068 3300006852 Bacteria 1310
147 Ga0075433_10403787 3300006852 Bacteria 1205
148 Ga0075433_10493835 3300006852 Bacteria 1078
149 Ga0075433_10717099 3300006852 Bacteria 875
150 Ga0075434_100009721 3300006871 Bacteria 8988
151 Ga0075434_100479661 3300006871 Bacteria 1265
152 Ga0075434_100625399 3300006871 Bacteria 1095
153 Ga0075434_101549696 3300006871 Bacteria 671
154 Ga0075429_100633585 3300006880 Bacteria 937
155 Ga0068865_100000006 3300006881 Bacteria 201186
156 Ga0075436_100048695 3300006914 Bacteria 2924
157 Ga0075436_100551861 3300006914 Bacteria 846
158 Ga0075436_100618619 3300006914 Bacteria 799
159 Ga0075435_101142693 3300007076 Bacteria 681
160 Ga0099794_10009440 3300007265 Bacteria 4101
161 Ga0099794_10023250 3300007265 Bacteria 2833
162 Ga0099794_10037851 3300007265 Bacteria 2284
163 Ga0099794_10465734 3300007265 Bacteria 663
164 Ga0099795_10001540 3300007788 Bacteria 5057
165 Ga0099795_10007613 3300007788 Bacteria 3034
166 Ga0099795_10079013 3300007788 Bacteria 1255
167 Ga0099795_10184606 3300007788 Bacteria 873
168 Ga0099795_10230670 3300007788 Bacteria 791
169 Ga0105240_10126877 3300009093 Bacteria 3065
170 Ga0105240_11207882 3300009093 Unclassified 800
171 Ga0111539_10049240 3300009094 Bacteria 5026
172 Ga0111539_10332147 3300009094 Bacteria 1769
173 Ga0105245_10029521 3300009098 Bacteria 4845
174 Ga0114129_10077066 3300009147 Bacteria 4639
175 Ga0114129_10251230 3300009147 Bacteria 2374
176 Ga0114129_10265825 3300009147 Bacteria 2297
177 Ga0114129_10414768 3300009147 Bacteria 1772
178 Ga0114129_10449866 3300009147 Bacteria 1689
179 Ga0114129_10565769 3300009147 Bacteria 1476
180 Ga0105243_10000055 3300009148 Bacteria 136180
181 Ga0105243_10128300 3300009148 Bacteria 2148
182 Ga0105243_10168504 3300009148 Unclassified 1895
183 Ga0105241_10171264 3300009174 Bacteria 1793
184 Ga0105241_10633842 3300009174 Bacteria 969
185 Ga0105242_10000283 3300009176 Bacteria 40594
186 Ga0105248_11309034 3300009177 Bacteria 820
187 Ga0105237_10273791 3300009545 Bacteria 1691
188 Ga0105237_10331864 3300009545 Bacteria 1525
189 Ga0105237_10348197 3300009545 Bacteria 1486
190 Ga0105238_10001467 3300009551 Bacteria 23687
191 Ga0105238_10025559 3300009551 Bacteria 6021
192 Ga0105238_10213378 3300009551 Bacteria 1907
193 Ga0105238_11089139 3300009551 Unclassified 821
194 Ga0105249_10169775 3300009553 Bacteria 2114
195 Ga0099796_10021343 3300010159 Bacteria 1992
196 Ga0099796_10040008 3300010159 Bacteria 1581
197 Ga0099796_10045660 3300010159 Bacteria 1501
198 Ga0099796_10087572 3300010159 Bacteria 1152
199 Ga0099796_10203444 3300010159 Bacteria 804
200 Ga0105239_10000734 3300010375 Bacteria 46586
201 Ga0105239_10255441 3300010375 Bacteria 1969
202 Ga0105239_11201520 3300010375 Unclassified 874
203 Ga0105246_10058371 3300011119 Plasmid 2673
204 Ga0105246_10786887 3300011119 Bacteria 843
205 Ga0157373_10154883 3300013100 Bacteria 1612
206 Ga0157373_10492189 3300013100 Bacteria 885
207 Ga0157370_10000034 3300013104 Bacteria 137749
208 Ga0157370_10409799 3300013104 Bacteria 1247
209 Ga0157369_10070419 3300013105 Bacteria 3757
210 Ga0157369_11495394 3300013105 Unclassified 687
211 Ga0157374_10166445 3300013296 Bacteria 2148
212 Ga0157374_10406433 3300013296 Bacteria 1359
213 Ga0157378_10000050 3300013297 Bacteria 102138
214 Ga0157378_10565115 3300013297 Bacteria 1145
215 Ga0163162_10000389 3300013306 Bacteria 40197
216 Ga0157372_10388690 3300013307 Bacteria 1626
217 Ga0157375_10000290 3300013308 Bacteria 45533
218 Ga0157375_10449943 3300013308 Unclassified 1453
219 Ga0157380_11395573 3300014326 Bacteria 751
220 Ga0182008_10685754 3300014497 Unclassified 584
221 Ga0157379_10116010 3300014968 Bacteria 2408
222 Ga0157376_10008928 3300014969 Bacteria 7259
223 Ga0182007_10003928 3300015262 Bacteria 6882
224 Ga0182005_1012774 3300015265 Unclassified 2367
225 Ga0182005_1021683 3300015265 Bacteria 1761
226 Ga0182005_1030339 3300015265 Unclassified 1473
227 Ga0163161_10176965 3300017792 Bacteria 1634
228 Ga0209437_103555 3300025233 Plasmid 2805
229 Ga0209677_100891 3300025253 Bacteria 14608
230 Ga0209759_1000002 3300025256 Bacteria 1027596
231 Ga0209233_1000361 3300025261 Bacteria 41432
232 Ga0209233_1000405 3300025261 Bacteria 34803
233 Ga0209758_1000747 3300025297 Bacteria 47306
234 Ga0209050_1000186 3300025298 Bacteria 139998
235 Ga0207426_1001581 3300025302 Bacteria 18301
236 Ga0209257_1000211 3300025304 Bacteria 139998
237 Ga0207656_10018343 3300025321 Bacteria 2754
238 Ga0207653_10130134 3300025885 Unclassified 913
239 Ga0207692_10005829 3300025898 Bacteria 4965
240 Ga0207692_10006090 3300025898 Bacteria 4879
241 Ga0207647_10380982 3300025904 Unclassified 796
242 Ga0207685_10022769 3300025905 Bacteria 2123
243 Ga0207685_10055300 3300025905 Bacteria 1549
244 Ga0207685_10104479 3300025905 Bacteria 1217
245 Ga0207685_10399356 3300025905 Bacteria 704
246 Ga0207699_10001091 3300025906 Bacteria 12814
247 Ga0207699_10034607 3300025906 Bacteria 2867
248 Ga0207699_10163587 3300025906 Bacteria 1483
249 Ga0207699_10444012 3300025906 Bacteria 930
250 Ga0207645_10005162 3300025907 Bacteria 9543
251 Ga0207705_10113059 3300025909 Bacteria 2008
252 Ga0207684_10028031 3300025910 Bacteria 4797
253 Ga0207684_10037683 3300025910 Bacteria 4102
254 Ga0207684_10058006 3300025910 Bacteria 3285
255 Ga0207684_10220170 3300025910 Bacteria 1638
256 Ga0207684_10769250 3300025910 Bacteria 815
257 Ga0207684_10782724 3300025910 Bacteria 807
258 Ga0207654_10009459 3300025911 Bacteria 4949
259 Ga0207695_10082033 3300025913 Bacteria 3262
260 Ga0207695_10087979 3300025913 Plasmid 3128
261 Ga0207695_10144272 3300025913 Bacteria 2327
262 Ga0207671_10005672 3300025914 Bacteria 11413
263 Ga0207671_10261192 3300025914 Bacteria 1363
264 Ga0207693_10066428 3300025915 Bacteria 2823
265 Ga0207693_10082382 3300025915 Bacteria 2519
266 Ga0207693_10149074 3300025915 Bacteria 1839
267 Ga0207693_10182657 3300025915 Bacteria 1651
268 Ga0207663_10016339 3300025916 Bacteria 4113
269 Ga0207663_10040502 3300025916 Bacteria 2832
270 Ga0207663_10072474 3300025916 Bacteria 2226
271 Ga0207657_10028613 3300025919 Bacteria 5080
272 Ga0207649_10438159 3300025920 Unclassified 984
273 Ga0207649_10506454 3300025920 Unclassified 919
274 Ga0207646_10016545 3300025922 Bacteria 6920
275 Ga0207646_10076953 3300025922 Bacteria 2982
276 Ga0207646_10133827 3300025922 Bacteria 2232
277 Ga0207646_10279140 3300025922 Bacteria 1510
278 Ga0207646_10725671 3300025922 Bacteria 888
279 Ga0207646_10761273 3300025922 Bacteria 864
280 Ga0207646_10989841 3300025922 Unclassified 743
281 Ga0207694_10000907 3300025924 Bacteria 26215
282 Ga0207694_10013815 3300025924 Bacteria 6086
283 Ga0207694_10229662 3300025924 Bacteria 1515
284 Ga0207687_10023076 3300025927 Bacteria 4144
285 Ga0207700_10035464 3300025928 Bacteria 3593
286 Ga0207700_10117365 3300025928 Bacteria 2152
287 Ga0207700_10274864 3300025928 Unclassified 1447
288 Ga0207700_10387939 3300025928 Bacteria 1222
289 Ga0207700_10986879 3300025928 Bacteria 754
290 Ga0207664_10059673 3300025929 Bacteria 3039
291 Ga0207664_10136371 3300025929 Bacteria 2071
292 Ga0207706_10038103 3300025933 Bacteria 4265
293 Ga0207686_10000308 3300025934 Bacteria 35349
294 Ga0207709_10000098 3300025935 Bacteria 136213
295 Ga0207709_10065679 3300025935 Bacteria 2283
296 Ga0207704_10000085 3300025938 Bacteria 55325
297 Ga0207665_10023115 3300025939 Bacteria 4095
298 Ga0207665_10024597 3300025939 Bacteria 3972
299 Ga0207665_10025212 3300025939 Bacteria 3922
300 Ga0207665_10099785 3300025939 Bacteria 2025
301 Ga0207665_10235532 3300025939 Bacteria 1347
302 Ga0207665_10739961 3300025939 Bacteria 775
303 Ga0207691_10272524 3300025940 Bacteria 1457
304 Ga0207711_10676483 3300025941 Bacteria 963
305 Ga0207689_10007771 3300025942 Bacteria 9383
306 Ga0207689_11316643 3300025942 Bacteria 607
307 Ga0207661_10276528 3300025944 Bacteria 1500
308 Ga0207661_10634225 3300025944 Bacteria 982
309 Ga0207679_10423937 3300025945 Unclassified 1175
310 Ga0207667_10053430 3300025949 Bacteria 4251
311 Ga0207667_10208413 3300025949 Bacteria 2004
312 Ga0207651_10000009 3300025960 Bacteria 199913
313 Ga0207712_10107879 3300025961 Bacteria 2083
314 Ga0207640_10347631 3300025981 Unclassified 1190
315 Ga0207658_10000703 3300025986 Bacteria 29036
316 Ga0207677_10000056 3300026023 Bacteria 97763
317 Ga0207703_10177001 3300026035 Bacteria 1880
318 Ga0207639_10491097 3300026041 Bacteria 1120
319 Ga0207678_10158838 3300026067 Bacteria 1930
320 Ga0207648_10012897 3300026089 Bacteria 7804
321 Ga0207676_10644227 3300026095 Bacteria 1022
322 Ga0207674_10362425 3300026116 Bacteria 1401
323 Ga0207698_10045011 3300026142 Bacteria 3321
324 Ga0209588_1069476 3300027671 Bacteria 1138
325 Ga0209588_1185807 3300027671 Bacteria 651
326 Ga0268266_10463618 3300028379 Bacteria 1206
327 Ga0268264_10110405 3300028381 Bacteria 2408
328 Ga0265760_10015542 3300031090 Bacteria 2181
329 Ga0265325_10102350 3300031241 Bacteria 1401
330 Ga0265313_10100535 3300031595 Bacteria 1284
331 Ga0373938_0070663 3300034957 Bacteria 834
332 Ga0373934_0026848 3300035086 Bacteria 2235
333 Ga0373923_0007612 3300035111 Bacteria 3819
334 Ga0373936_0420504 3300035113 Unclassified 615
335 Ga0373953_0116350 3300035117 Bacteria 1133
336 Ga0373954_0037492 3300035118 Unclassified 2253
337 Ga0373954_0299083 3300035118 Bacteria 794
338 Ga0373956_0055388 3300035119 Unclassified 1788
339 Ga0373957_0210819 3300035120 Bacteria 811
340 Ga0373960_0137494 3300035121 Bacteria 825
341 Ga0373955_0083807 3300035172 Bacteria 1806
342 Ga0373961_0298429 3300035241 Bacteria 595
343 Ga0373962_0037668 3300035242 Bacteria 1351
344 Ga0373924_0031583 3300035410 Bacteria 2130
345 Ga0373927_0428990 3300035695 Bacteria 873
346 Ga0373933_0026923 3300035724 Bacteria 3307
347 Ga0373933_0077143 3300035724 Bacteria 2036
348 Ga0373933_0473294 3300035724 Bacteria 820
349 Ga0373937_0015040 3300036401 Bacteria 6835
350 Ga0373937_0457215 3300036401 Unclassified 1212
351 Ga0373925_0072616 3300037068 Bacteria 2603
352 Ga0395900_0279613 3300037418 Unclassified 1661
353 Ga0395898_0214001 3300037466 Bacteria 1838
354 Ga0395901_0258987 3300038443 Unclassified 1811
355 Ga0242420_032276 3300038996 Bacteria 975
356 Ga0436360_1142238 3300039438 Bacteria 1283
357 Ga0436361_0790332 3300039447 Bacteria 2647
358 Ga0436362_0496513 3300039453 Bacteria 1474
359 Ga0453683_0023961 3300044673 Bacteria 3887
360 Ga0495592_0108968 3300046454 Bacteria 1962
361 Ga0495651_0029534 3300046462 Bacteria 4276
362 Ga0495653_0083607 3300046463 Bacteria 2353
363 Ga0495580_0006740 3300046472 Bacteria 9321
364 Ga0495580_0261110 3300046472 Unclassified 1184
365 Ga0495662_0326011 3300046476 Unclassified 755
366 Ga0495664_0430999 3300046477 Unclassified 790
367 Ga0495594_0699478 3300046499 Unclassified 573
368 Ga0495608_0133802 3300046511 Bacteria 1585
369 Ga0495628_0049889 3300046516 Bacteria 3312
370 Ga0495652_0029501 3300046529 Bacteria 4819
371 Ga0495665_0616877 3300046531 Unclassified 541
372 Ga0495640_0095520 3300046533 Unclassified 1956
373 Ga0495587_0133656 3300046536 Bacteria 1417
374 Ga0495645_0000921 3300046543 Bacteria 20014
375 Ga0495667_0021510 3300046559 Bacteria 4353
376 Ga0495657_0073416 3300046675 Bacteria 2228
377 Ga0495599_0003845 3300046678 Bacteria 8824
378 Ga0495623_0134667 3300046679 Unclassified 1475
379 Ga0495646_0349871 3300046680 Unclassified 774
380 Ga0495600_0038190 3300046809 Bacteria 3124
381 Ga0495604_0013363 3300047317 Bacteria 6538
382 Ga0495674_0132316 3300047319 Unclassified 2101
383 Ga0495680_0004422 3300047322 Bacteria 13434
384 Ga0495675_0179559 3300047444 Unclassified 1296
385 Ga0495673_0213421 3300047469 Bacteria 717
386 Ga0495684_0114490 3300047471 Bacteria 2033
387 Ga0495602_0072823 3300048088 Bacteria 2927
388 Ga0496103_0776039 3300048906 Bacteria 605
389 Ga0496110_0326229 3300048913 Bacteria 1398
390 Ga0496110_0363423 3300048913 Bacteria 1319
391 Ga0496112_0184872 3300048915 Bacteria 2048
392 Ga0496113_0952083 3300048916 Bacteria 678
393 Ga0496119_0163796 3300048922 Unclassified 1179
394 Ga0496121_0115253 3300048924 Bacteria 2041
395 Ga0496122_0016575 3300048925 Bacteria 6958
396 Ga0496123_0081848 3300048926 Bacteria 1960
397 Ga0496124_0108283 3300048927 Bacteria 2241
398 Ga0496126_0000485 3300048929 Bacteria 78597
399 nmdc:mga00v17_772847_c1 3300050491 Bacteria 613
400 nmdc:mga0k408_67857_c1 3300050493 Bacteria 1330
401 nmdc:mga06z11_127463_c1 3300050494 Bacteria 1426
402 nmdc:mga07m45_31769_c1 3300050496 Bacteria 2926
403 nmdc:mga05p37_115537_c1 3300050507 Bacteria 3299
404 nmdc:mga05p37_468195_c1 3300050507 Bacteria 1455
405 nmdc:mga09592_485483_c1 3300050508 Bacteria 1064
406 nmdc:mga06r32_608397_c1 3300050510 Unclassified 1063
407 nmdc:mga06r32_935488_c1 3300050510 Bacteria 822
408 nmdc:mga08y16_545677_c1 3300050511 Bacteria 1174
409 nmdc:mga0n895_325718_c1 3300050512 Bacteria 1557
410 nmdc:mga0n895_730687_c1 3300050512 Bacteria 984
411 nmdc:mga0n895_73412_c1 3300050512 Bacteria 3396
412 nmdc:mga0rr50_799046_c1 3300050513 Bacteria 805
413 nmdc:mga08x19_216979_c1 3300050514 Archaea 1314
414 nmdc:mga08x19_248003_c1 3300050514 Unclassified 1229
415 nmdc:mga08x19_309390_c1 3300050514 Bacteria 1098
416 nmdc:mga08x19_41343_c1 3300050514 Bacteria 2936
417 nmdc:mga08x19_423448_c1 3300050514 Bacteria 935
418 nmdc:mga08x19_481997_c1 3300050514 Unclassified 875
419 nmdc:mga0a205_273782_c1 3300050515 Bacteria 1565
420 nmdc:mga0a205_881924_c1 3300050515 Bacteria 742
421 Ga0495601_0001498 3300053077 Bacteria 12880
422 Ga0495612_0000361 3300053078 Bacteria 18344
423 Ga0495595_0072539 3300053084 Bacteria 1629
424 Ga0495619_0029038 3300053085 Unclassified 3571
425 Ga0500614_013477 3300053123 Bacteria 1797
426 Ga0500620_147317 3300053155 Unclassified 820
427 2585533043 2585427527 Bacteria 7273426
428 2616551661 2615840698 Bacteria 7319877
429 2885383029 2885374607 Bacteria 8927485
430 2889038601 2889033259 Bacteria 9099371
431 Ga0105241_10680021
432 JGI24736J21556_1002410
433 JGI24741J21665_1021332
434 JGI24740J21852_10024393
435 JGI24739J22299_10015914
436 JGI24737J22298_10034509
437 JGI24735J21928_10002974
438 JGI24738J21930_10001076
439 JGI25156J39149_1000017
440 JGI25165J46597_1005149
441 JGI25160J50197_1034173
442 Ga0055530_10000020
443 Ga0055543_1010535
444 Ga0065165_1000662
445 Ga0065707_10177023
446 Ga0070683_100741851
447 Ga0070670_100560011
448 Ga0068869_100000731
449 Ga0068869_101353492
450 Ga0068868_100000014
451 Ga0070660_100518421
452 Ga0070661_100123536
453 Ga0070661_100223774
454 Ga0070675_100916762
455 Ga0070673_100000004
456 Ga0070659_100242675
457 Ga0070667_100000265
458 Ga0070709_10008974
459 Ga0070709_10022124
460 Ga0070709_10039297
461 Ga0070709_10791621
462 Ga0070714_100036358
463 Ga0070714_100203101
464 Ga0070714_100376173
465 Ga0070713_100044420
466 Ga0070713_100207571
467 Ga0070713_100469656
468 Ga0070713_100633428
469 Ga0070713_100753584
470 Ga0070713_100802171
471 Ga0070710_10002501
472 Ga0070710_10012357
473 Ga0070711_100005244
474 Ga0070711_100012532
475 Ga0070711_100110714
476 Ga0070711_100565372
477 Ga0070711_100962560
478 Ga0070705_100162913
479 Ga0070705_100329480
480 Ga0070705_100781788
481 Ga0070700_101466119
482 Ga0070694_100238052
483 Ga0070694_100565008
484 Ga0070708_100054887
485 Ga0070708_100058680
486 Ga0070708_100211911
487 Ga0070708_100213074
488 Ga0070708_100225344
489 Ga0070708_100246964
490 Ga0070708_100549405
491 Ga0070708_100815100
492 Ga0070663_100672017
493 Ga0070662_100087016
494 Ga0068867_100066968
495 Ga0070706_100064474
496 Ga0070706_100091560
497 Ga0070706_100153785
498 Ga0070706_100187296
499 Ga0070706_100188690
500 Ga0070706_100606039
501 Ga0070706_100858658
502 Ga0070707_100013973
503 Ga0070707_100064250
504 Ga0070707_100074918
505 Ga0070707_100163801
506 Ga0070707_100243600
507 Ga0070707_100257030
508 Ga0070707_100298205
509 Ga0070707_100502612
510 Ga0070707_100896416
511 Ga0070698_100009379
512 Ga0070698_100028133
513 Ga0070698_100047056
514 Ga0070698_100125739
515 Ga0070698_100186658
516 Ga0070698_100251172
517 Ga0070698_100536757
518 Ga0070698_100643578
519 Ga0070699_100044207
520 Ga0070699_100119369
521 Ga0070699_100167171
522 Ga0070699_100229957
523 Ga0070699_100233040
524 Ga0070699_100447271
525 Ga0070684_100243928
526 Ga0070684_100872634
527 Ga0070697_100030177
528 Ga0070697_100092830
529 Ga0070697_100106799
530 Ga0070697_100151250
531 Ga0070697_100379262
532 Ga0070697_100813769
533 Ga0070697_101350860
534 Ga0068853_101021061
535 Ga0070672_100775832
536 Ga0070696_100008828
537 Ga0070696_100685058
538 Ga0070665_100133884
539 Ga0070704_100761615
540 Ga0068855_100204784
541 Ga0068855_101391154
542 Ga0070664_100102929
543 Ga0068857_100648447
544 Ga0068854_100079763
545 Ga0068851_10025282
546 Ga0068858_100458262
547 Ga0068858_101657539
548 Ga0068860_100060863
549 Ga0081540_1008847
550 Ga0070717_10220022
551 Ga0070717_10255090
552 Ga0070717_10309363
553 Ga0070717_10357035
554 Ga0070717_10444861
555 Ga0070717_11265085
556 Ga0075368_10056329
557 Ga0070715_10021181
558 Ga0070715_10036001
559 Ga0070715_10039481
560 Ga0070715_10587530
561 Ga0070716_100002137
562 Ga0070716_100022039
563 Ga0070716_100023955
564 Ga0070712_100010832
565 Ga0070712_100029778
566 Ga0070712_100133670
567 Ga0070712_100516186
568 Ga0070712_100716276
569 Ga0070712_100810378
570 Ga0075367_10020962
571 Ga0075366_10184383
572 Ga0075370_10029297
573 Ga0075431_100136461
574 Ga0075431_100605035
575 Ga0075431_100774532
576 Ga0075433_10348068
577 Ga0075433_10403787
578 Ga0075433_10493835
579 Ga0075433_10717099
580 Ga0075434_100009721
581 Ga0075434_100479661
582 Ga0075434_100625399
583 Ga0075434_101549696
584 Ga0075429_100633585
585 Ga0068865_100000006
586 Ga0075436_100048695
587 Ga0075436_100551861
588 Ga0075436_100618619
589 Ga0075435_101142693
590 Ga0099794_10009440
591 Ga0099794_10023250
592 Ga0099794_10037851
593 Ga0099794_10465734
594 Ga0099795_10001540
595 Ga0099795_10007613
596 Ga0099795_10079013
597 Ga0099795_10184606
598 Ga0099795_10230670
599 Ga0105240_10126877
600 Ga0105240_11207882
601 Ga0111539_10049240
602 Ga0111539_10332147
603 Ga0105245_10029521
604 Ga0114129_10077066
605 Ga0114129_10251230
606 Ga0114129_10265825
607 Ga0114129_10414768
608 Ga0114129_10449866
609 Ga0114129_10565769
610 Ga0105243_10000055
611 Ga0105243_10128300
612 Ga0105243_10168504
613 Ga0105241_10171264
614 Ga0105241_10633842
615 Ga0105242_10000283
616 Ga0105248_11309034
617 Ga0105237_10273791
618 Ga0105237_10331864
619 Ga0105237_10348197
620 Ga0105238_10001467
621 Ga0105238_10025559
622 Ga0105238_10213378
623 Ga0105238_11089139
624 Ga0105249_10169775
625 Ga0099796_10021343
626 Ga0099796_10040008
627 Ga0099796_10045660
628 Ga0099796_10087572
629 Ga0099796_10203444
630 Ga0105239_10000734
631 Ga0105239_10255441
632 Ga0105239_11201520
633 Ga0105246_10058371
634 Ga0105246_10786887
635 Ga0157373_10154883
636 Ga0157373_10492189
637 Ga0157370_10000034
638 Ga0157370_10409799
639 Ga0157369_10070419
640 Ga0157369_11495394
641 Ga0157374_10166445
642 Ga0157374_10406433
643 Ga0157378_10000050
644 Ga0157378_10565115
645 Ga0163162_10000389
646 Ga0157372_10388690
647 Ga0157375_10000290
648 Ga0157375_10449943
649 Ga0157380_11395573
650 Ga0182008_10685754
651 Ga0157379_10116010
652 Ga0157376_10008928
653 Ga0182007_10003928
654 Ga0182005_1012774
655 Ga0182005_1021683
656 Ga0182005_1030339
657 Ga0163161_10176965
658 Ga0209437_103555
659 Ga0209677_100891
660 Ga0209759_1000002
661 Ga0209233_1000361
662 Ga0209233_1000405
663 Ga0209758_1000747
664 Ga0209050_1000186
665 Ga0207426_1001581
666 Ga0209257_1000211
667 Ga0207656_10018343
668 Ga0207653_10130134
669 Ga0207692_10005829
670 Ga0207692_10006090
671 Ga0207647_10380982
672 Ga0207685_10022769
673 Ga0207685_10055300
674 Ga0207685_10104479
675 Ga0207685_10399356
676 Ga0207699_10001091
677 Ga0207699_10034607
678 Ga0207699_10163587
679 Ga0207699_10444012
680 Ga0207645_10005162
681 Ga0207705_10113059
682 Ga0207684_10028031
683 Ga0207684_10037683
684 Ga0207684_10058006
685 Ga0207684_10220170
686 Ga0207684_10769250
687 Ga0207684_10782724
688 Ga0207654_10009459
689 Ga0207695_10082033
690 Ga0207695_10087979
691 Ga0207695_10144272
692 Ga0207671_10005672
693 Ga0207671_10261192
694 Ga0207693_10066428
695 Ga0207693_10082382
696 Ga0207693_10149074
697 Ga0207693_10182657
698 Ga0207663_10016339
699 Ga0207663_10040502
700 Ga0207663_10072474
701 Ga0207657_10028613
702 Ga0207649_10438159
703 Ga0207649_10506454
704 Ga0207646_10016545
705 Ga0207646_10076953
706 Ga0207646_10133827
707 Ga0207646_10279140
708 Ga0207646_10725671
709 Ga0207646_10761273
710 Ga0207646_10989841
711 Ga0207694_10000907
712 Ga0207694_10013815
713 Ga0207694_10229662
714 Ga0207687_10023076
715 Ga0207700_10035464
716 Ga0207700_10117365
717 Ga0207700_10274864
718 Ga0207700_10387939
719 Ga0207700_10986879
720 Ga0207664_10059673
721 Ga0207664_10136371
722 Ga0207706_10038103
723 Ga0207686_10000308
724 Ga0207709_10000098
725 Ga0207709_10065679
726 Ga0207704_10000085
727 Ga0207665_10023115
728 Ga0207665_10024597
729 Ga0207665_10025212
730 Ga0207665_10099785
731 Ga0207665_10235532
732 Ga0207665_10739961
733 Ga0207691_10272524
734 Ga0207711_10676483
735 Ga0207689_10007771
736 Ga0207689_11316643
737 Ga0207661_10276528
738 Ga0207661_10634225
739 Ga0207679_10423937
740 Ga0207667_10053430
741 Ga0207667_10208413
742 Ga0207651_10000009
743 Ga0207712_10107879
744 Ga0207640_10347631
745 Ga0207658_10000703
746 Ga0207677_10000056
747 Ga0207703_10177001
748 Ga0207639_10491097
749 Ga0207678_10158838
750 Ga0207648_10012897
751 Ga0207676_10644227
752 Ga0207674_10362425
753 Ga0207698_10045011
754 Ga0209588_1069476
755 Ga0209588_1185807
756 Ga0268266_10463618
757 Ga0268264_10110405
758 Ga0265760_10015542
759 Ga0265325_10102350
760 Ga0265313_10100535
761 Ga0373938_0070663
762 Ga0373934_0026848
763 Ga0373923_0007612
764 Ga0373936_0420504
765 Ga0373953_0116350
766 Ga0373954_0037492
767 Ga0373954_0299083
768 Ga0373956_0055388
769 Ga0373957_0210819
770 Ga0373960_0137494
771 Ga0373955_0083807
772 Ga0373961_0298429
773 Ga0373962_0037668
774 Ga0373924_0031583
775 Ga0373927_0428990
776 Ga0373933_0026923
777 Ga0373933_0077143
778 Ga0373933_0473294
779 Ga0373937_0015040
780 Ga0373937_0457215
781 Ga0373925_0072616
782 Ga0395900_0279613
783 Ga0395898_0214001
784 Ga0395901_0258987
785 Ga0242420_032276
786 Ga0436360_1142238
787 Ga0436361_0790332
788 Ga0436362_0496513
789 Ga0453683_0023961
790 Ga0495592_0108968
791 Ga0495651_0029534
792 Ga0495653_0083607
793 Ga0495580_0006740
794 Ga0495580_0261110
795 Ga0495662_0326011
796 Ga0495664_0430999
797 Ga0495594_0699478
798 Ga0495608_0133802
799 Ga0495628_0049889
800 Ga0495652_0029501
801 Ga0495665_0616877
802 Ga0495640_0095520
803 Ga0495587_0133656
804 Ga0495645_0000921
805 Ga0495667_0021510
806 Ga0495657_0073416
807 Ga0495599_0003845
808 Ga0495623_0134667
809 Ga0495646_0349871
810 Ga0495600_0038190
811 Ga0495604_0013363
812 Ga0495674_0132316
813 Ga0495680_0004422
814 Ga0495675_0179559
815 Ga0495673_0213421
816 Ga0495684_0114490
817 Ga0495602_0072823
818 Ga0496103_0776039
819 Ga0496110_0326229
820 Ga0496110_0363423
821 Ga0496112_0184872
822 Ga0496113_0952083
823 Ga0496119_0163796
824 Ga0496121_0115253
825 Ga0496122_0016575
826 Ga0496123_0081848
827 Ga0496124_0108283
828 Ga0496126_0000485
829 nmdc:mga00v17_772847_c1
830 nmdc:mga0k408_67857_c1
831 nmdc:mga06z11_127463_c1
832 nmdc:mga07m45_31769_c1
833 nmdc:mga05p37_115537_c1
834 nmdc:mga05p37_468195_c1
835 nmdc:mga09592_485483_c1
836 nmdc:mga06r32_608397_c1
837 nmdc:mga06r32_935488_c1
838 nmdc:mga08y16_545677_c1
839 nmdc:mga0n895_325718_c1
840 nmdc:mga0n895_730687_c1
841 nmdc:mga0n895_73412_c1
842 nmdc:mga0rr50_799046_c1
843 nmdc:mga08x19_216979_c1
844 nmdc:mga08x19_248003_c1
845 nmdc:mga08x19_309390_c1
846 nmdc:mga08x19_41343_c1
847 nmdc:mga08x19_423448_c1
848 nmdc:mga08x19_481997_c1
849 nmdc:mga0a205_273782_c1
850 nmdc:mga0a205_881924_c1
851 Ga0495601_0001498
852 Ga0495612_0000361
853 Ga0495595_0072539
854 Ga0495619_0029038
855 Ga0500614_013477
856 Ga0500620_147317
857 2585533043
858 2616551661
859 2885383029
860 2889038601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

19

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9635 3 168
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9468 3 168
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8254 2 167
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8101 2 167
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.7786 2 167
ID Description Score Start End Superfamily
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9598 1 161 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9207 1 161 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8048 2 167 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.753 2 167 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6863 1 162 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1M5P8K8-F1-model_v4 DUF1993 domain-containing protein 0.9898 1 168
AF-A0A4R6EVC0-F1-model_v4 DUF1993 domain-containing protein 0.9851 1 165
AF-M3G7Y1-F1-model_v4 PF09351 domain protein 0.9823 1 158
AF-A0A2S4HHM6-F1-model_v4 DUF1993 domain-containing protein 0.9798 1 167
AF-A0A1M3MWN8-F1-model_v4 DUF1993 domain-containing protein 0.9791 1 168

Map