F441803

General Info

Members Datasets Scaffolds Average Seq Length
428 238 856 137

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2917736166|2917736257
Length 133
Sequence LNPYISFAGNAREAMEYYHDVFGGDLALNTFGESGAPAGADYADSIMHAMLEGDNGFTLMAADVPPGTEHKPGTNISISLSGDDGDLLRRCWEKLTDGGTVAVPLEKQMWGDEFGACTDRFGISWMVNIGQPG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
145 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
223 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
224 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
225 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
226 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
227 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
228 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
229 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
230 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
231 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
232 2922554459 Rhodococcus sp. 66b Isolate Unclassified
233 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
234 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
235 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
236 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
237 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
238 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 1.87
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0.23
Rhizoplane 7.24
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000525 3300003373 Bacteria 7724
2 JGI25407J50210_10048604 3300003373 Bacteria 1077
3 JGI25407J50210_10068706 3300003373 Bacteria 885
4 JGI25407J50210_10178452 3300003373 Bacteria 524
5 Ga0070683_100285233 3300005329 Bacteria 1571
6 Ga0070683_100456122 3300005329 Bacteria 1220
7 Ga0070670_100747503 3300005331 Bacteria 881
8 Ga0068869_100364272 3300005334 Bacteria 1181
9 Ga0068868_100244057 3300005338 Bacteria 1510
10 Ga0068868_100256197 3300005338 Bacteria 1474
11 Ga0070661_101103899 3300005344 Bacteria 661
12 Ga0070692_10464601 3300005345 Bacteria 813
13 Ga0070669_100580876 3300005353 Bacteria 937
14 Ga0070675_101249422 3300005354 Bacteria 684
15 Ga0070674_100098523 3300005356 Bacteria 2125
16 Ga0070674_101535557 3300005356 Bacteria 599
17 Ga0070688_100460622 3300005365 Bacteria 952
18 Ga0070659_100287409 3300005366 Bacteria 1369
19 Ga0070714_100296813 3300005435 Bacteria 1505
20 Ga0070701_10385391 3300005438 Bacteria 884
21 Ga0070701_10388037 3300005438 Bacteria 882
22 Ga0070700_100647288 3300005441 Bacteria 834
23 Ga0070681_10107799 3300005458 Bacteria 2726
24 Ga0068867_101494077 3300005459 Bacteria 629
25 Ga0070706_100502042 3300005467 Bacteria 1129
26 Ga0070698_100995825 3300005471 Bacteria 785
27 Ga0070679_100090039 3300005530 Bacteria 3056
28 Ga0070672_100919864 3300005543 Bacteria 773
29 Ga0070686_100678622 3300005544 Bacteria 820
30 Ga0070686_101127089 3300005544 Bacteria 649
31 Ga0070696_101936781 3300005546 Bacteria 511
32 Ga0070665_100159814 3300005548 Bacteria 2255
33 Ga0070665_102173777 3300005548 Bacteria 559
34 Ga0068855_100647513 3300005563 Bacteria 1135
35 Ga0070664_101439250 3300005564 Bacteria 652
36 Ga0070664_101823351 3300005564 Bacteria 577
37 Ga0068857_100409455 3300005577 Bacteria 1263
38 Ga0068854_100040582 3300005578 Bacteria 3284
39 Ga0070702_100029129 3300005615 Bacteria 2999
40 Ga0070702_100213113 3300005615 Bacteria 1287
41 Ga0070702_100662512 3300005615 Bacteria 791
42 Ga0068852_100176274 3300005616 Bacteria 2007
43 Ga0068852_100337498 3300005616 Bacteria 1468
44 Ga0068859_100090377 3300005617 Bacteria 3113
45 Ga0068859_100188472 3300005617 Bacteria 2147
46 Ga0068859_100922992 3300005617 Bacteria 957
47 Ga0068859_101229600 3300005617 Bacteria 825
48 Ga0068864_100115372 3300005618 Bacteria 2396
49 Ga0068866_10083644 3300005718 Bacteria 1720
50 Ga0068861_100271033 3300005719 Bacteria 1457
51 Ga0068851_10799227 3300005834 Bacteria 586
52 Ga0068863_100013256 3300005841 Bacteria 7952
53 Ga0068863_100038314 3300005841 Bacteria 4561
54 Ga0068860_101005427 3300005843 Bacteria 852
55 Ga0068860_101142978 3300005843 Bacteria 798
56 Ga0068860_102022146 3300005843 Bacteria 598
57 Ga0081455_10000005 3300005937 Bacteria 327136
58 Ga0081455_10157634 3300005937 Bacteria 1743
59 Ga0081455_10279272 3300005937 Bacteria 1207
60 Ga0081538_10000298 3300005981 Bacteria 57143
61 Ga0081538_10001065 3300005981 Bacteria 29204
62 Ga0081538_10003870 3300005981 Bacteria 13985
63 Ga0081538_10006672 3300005981 Bacteria 10113
64 Ga0081538_10011941 3300005981 Bacteria 7005
65 Ga0081538_10172881 3300005981 Bacteria 939
66 Ga0081538_10336671 3300005981 Bacteria 548
67 Ga0075364_10023721 3300006051 Bacteria 3887
68 Ga0075367_10678764 3300006178 Bacteria 655
69 Ga0097621_100358185 3300006237 Bacteria 1299
70 Ga0075370_10019692 3300006353 Bacteria 3678
71 Ga0075370_10019719 3300006353 Bacteria 3675
72 Ga0075370_10719266 3300006353 Bacteria 607
73 Ga0075428_102044751 3300006844 Bacteria 593
74 Ga0075430_100005439 3300006846 Bacteria 10761
75 Ga0075430_100464928 3300006846 Bacteria 1044
76 Ga0075431_100797470 3300006847 Bacteria 918
77 Ga0075431_101091638 3300006847 Bacteria 763
78 Ga0075429_100184855 3300006880 Bacteria 1826
79 Ga0068865_102149331 3300006881 Bacteria 508
80 Ga0097620_100090378 3300006931 Bacteria 3113
81 Ga0097620_100188467 3300006931 Bacteria 2147
82 Ga0097620_100922827 3300006931 Bacteria 957
83 Ga0097620_101230032 3300006931 Bacteria 825
84 Ga0075435_100357198 3300007076 Bacteria 1253
85 Ga0105244_10065870 3300009036 Bacteria 1814
86 Ga0111539_10358421 3300009094 Bacteria 1697
87 Ga0105245_10001345 3300009098 Bacteria 22274
88 Ga0105245_10049567 3300009098 Bacteria 3761
89 Ga0105245_10204161 3300009098 Bacteria 1899
90 Ga0105245_10475505 3300009098 Bacteria 1262
91 Ga0105247_10217373 3300009101 Bacteria 1292
92 Ga0114129_10011207 3300009147 Bacteria 12781
93 Ga0114129_10099001 3300009147 Bacteria 4036
94 Ga0114129_10201800 3300009147 Bacteria 2693
95 Ga0114129_10265778 3300009147 Bacteria 2297
96 Ga0114129_10593788 3300009147 Bacteria 1435
97 Ga0114129_11040573 3300009147 Bacteria 1028
98 Ga0105243_10001693 3300009148 Bacteria 18989
99 Ga0105243_10102219 3300009148 Bacteria 2381
100 Ga0105243_10110296 3300009148 Bacteria 2301
101 Ga0105243_10780281 3300009148 Bacteria 940
102 Ga0105243_11016084 3300009148 Bacteria 833
103 Ga0105242_10139022 3300009176 Bacteria 2105
104 Ga0105242_11115714 3300009176 Bacteria 804
105 Ga0105248_10300666 3300009177 Bacteria 1807
106 Ga0105248_11087102 3300009177 Bacteria 904
107 Ga0105248_12083853 3300009177 Bacteria 645
108 Ga0105238_10389393 3300009551 Bacteria 1386
109 Ga0105238_10811884 3300009551 Bacteria 951
110 Ga0105249_10273520 3300009553 Bacteria 1684
111 Ga0105249_11172089 3300009553 Bacteria 839
112 Ga0105249_12073981 3300009553 Bacteria 641
113 Ga0105028_129724 3300009993 Bacteria 608
114 Ga0105239_10310201 3300010375 Bacteria 1778
115 Ga0105246_10694336 3300011119 Bacteria 891
116 Ga0105246_11696467 3300011119 Bacteria 600
117 Ga0157369_10261814 3300013105 Bacteria 1804
118 Ga0157369_12020788 3300013105 Bacteria 585
119 Ga0157369_12090291 3300013105 Bacteria 574
120 Ga0157374_10651376 3300013296 Bacteria 1065
121 Ga0163162_10242538 3300013306 Bacteria 1933
122 Ga0163162_10247811 3300013306 Bacteria 1913
123 Ga0157372_12127902 3300013307 Bacteria 645
124 Ga0157375_10065933 3300013308 Bacteria 3612
125 Ga0157375_10193794 3300013308 Bacteria 2187
126 Ga0157375_10469521 3300013308 Bacteria 1423
127 Ga0163163_10022080 3300014325 Bacteria 6019
128 Ga0163163_10028334 3300014325 Bacteria 5376
129 Ga0163163_10043482 3300014325 Bacteria 4405
130 Ga0163163_10271621 3300014325 Bacteria 1747
131 Ga0157380_11023046 3300014326 Bacteria 861
132 Ga0157380_12266079 3300014326 Bacteria 607
133 Ga0182008_10226945 3300014497 Bacteria 957
134 Ga0157377_10355320 3300014745 Bacteria 984
135 Ga0157377_10391561 3300014745 Bacteria 944
136 Ga0163161_10371220 3300017792 Bacteria 1141
137 Ga0206349_1897964 3300020075 Bacteria 764
138 Ga0206351_10834222 3300020077 Bacteria 764
139 Ga0206350_11610342 3300020080 Bacteria 801
140 Ga0206354_10053245 3300020081 Bacteria 832
141 Ga0206353_11199414 3300020082 Bacteria 576
142 Ga0224712_10132084 3300022467 Bacteria 1091
143 Ga0224712_10444319 3300022467 Bacteria 622
144 Ga0207642_10061599 3300025899 Bacteria 1746
145 Ga0207643_10651297 3300025908 Bacteria 680
146 Ga0207643_10934793 3300025908 Bacteria 561
147 Ga0207652_10065077 3300025921 Bacteria 3156
148 Ga0207681_10615199 3300025923 Bacteria 899
149 Ga0207694_10273504 3300025924 Bacteria 1386
150 Ga0207687_10000605 3300025927 Bacteria 24228
151 Ga0207687_10083896 3300025927 Bacteria 2308
152 Ga0207687_10318162 3300025927 Bacteria 1259
153 Ga0207664_10452069 3300025929 Bacteria 1147
154 Ga0207690_10444529 3300025932 Bacteria 1041
155 Ga0207690_11626667 3300025932 Bacteria 540
156 Ga0207709_10001344 3300025935 Bacteria 17304
157 Ga0207709_10065288 3300025935 Bacteria 2288
158 Ga0207669_10660236 3300025937 Bacteria 856
159 Ga0207669_11237359 3300025937 Bacteria 633
160 Ga0207704_11045727 3300025938 Bacteria 692
161 Ga0207691_10759827 3300025940 Bacteria 816
162 Ga0207711_10175904 3300025941 Bacteria 1944
163 Ga0207711_10504516 3300025941 Bacteria 1128
164 Ga0207711_10534328 3300025941 Bacteria 1094
165 Ga0207711_11923766 3300025941 Bacteria 534
166 Ga0207689_10211782 3300025942 Bacteria 1601
167 Ga0207661_10058339 3300025944 Bacteria 3106
168 Ga0207661_10255662 3300025944 Bacteria 1559
169 Ga0207679_10322046 3300025945 Bacteria 1339
170 Ga0207679_10980901 3300025945 Bacteria 774
171 Ga0207679_11424979 3300025945 Bacteria 636
172 Ga0207668_11981530 3300025972 Bacteria 525
173 Ga0207640_10171742 3300025981 Bacteria 1616
174 Ga0207658_10708995 3300025986 Bacteria 910
175 Ga0207677_10294497 3300026023 Bacteria 1338
176 Ga0207678_11334835 3300026067 Bacteria 634
177 Ga0207708_10063498 3300026075 Bacteria 2821
178 Ga0207641_10010085 3300026088 Bacteria 7767
179 Ga0207641_10631353 3300026088 Bacteria 1051
180 Ga0207648_10201637 3300026089 Bacteria 1764
181 Ga0207676_10162908 3300026095 Bacteria 1934
182 Ga0207676_10586915 3300026095 Bacteria 1069
183 Ga0207674_10329273 3300026116 Bacteria 1477
184 Ga0207674_10755463 3300026116 Bacteria 939
185 Ga0207675_100021272 3300026118 Bacteria 6041
186 Ga0207675_102442577 3300026118 Bacteria 534
187 Ga0207683_11104338 3300026121 Bacteria 736
188 Ga0207698_10907139 3300026142 Bacteria 889
189 Ga0207428_10263282 3300027907 Bacteria 1283
190 Ga0268266_10276043 3300028379 Bacteria 1561
191 Ga0268266_10688651 3300028379 Bacteria 985
192 Ga0268266_11691094 3300028379 Bacteria 608
193 Ga0268265_11251067 3300028380 Bacteria 741
194 Ga0307515_10157150 3300028794 Bacteria 2340
195 Ga0307512_10005858 3300030522 Bacteria 12645
196 Ga0307512_10030386 3300030522 Bacteria 4701
197 Ga0307513_10223303 3300031456 Bacteria 1702
198 Ga0307408_100144368 3300031548 Bacteria 1871
199 Ga0307508_10037985 3300031616 Bacteria 4329
200 Ga0307405_10044658 3300031731 Bacteria 2711
201 Ga0307405_10060750 3300031731 Bacteria 2386
202 Ga0307405_10601794 3300031731 Bacteria 897
203 Ga0307413_10068289 3300031824 Bacteria 2226
204 Ga0307413_10354488 3300031824 Bacteria 1133
205 Ga0307413_10388835 3300031824 Bacteria 1089
206 Ga0307413_10994042 3300031824 Bacteria 719
207 Ga0307410_10040949 3300031852 Bacteria 3052
208 Ga0307410_10091367 3300031852 Bacteria 2161
209 Ga0307410_10094692 3300031852 Bacteria 2128
210 Ga0307410_10101546 3300031852 Bacteria 2062
211 Ga0307410_10375572 3300031852 Bacteria 1142
212 Ga0326468_10014984 3300031889 Bacteria 852
213 Ga0307406_10702307 3300031901 Bacteria 844
214 Ga0307407_10041793 3300031903 Bacteria 2566
215 Ga0307407_10096114 3300031903 Bacteria 1828
216 Ga0307407_10280753 3300031903 Bacteria 1153
217 Ga0307412_10195550 3300031911 Bacteria 1532
218 Ga0307412_10211195 3300031911 Bacteria 1481
219 Ga0307412_10678789 3300031911 Bacteria 882
220 Ga0307412_10847641 3300031911 Bacteria 797
221 Ga0307409_100003145 3300031995 Bacteria 8870
222 Ga0307409_100017029 3300031995 Bacteria 4831
223 Ga0307409_100053915 3300031995 Bacteria 3093
224 Ga0307409_100407593 3300031995 Bacteria 1300
225 Ga0307409_101087181 3300031995 Bacteria 820
226 Ga0307416_100019878 3300032002 Bacteria 4773
227 Ga0307416_100037525 3300032002 Bacteria 3729
228 Ga0307416_100107090 3300032002 Bacteria 2452
229 Ga0307416_100151650 3300032002 Bacteria 2126
230 Ga0307416_100487342 3300032002 Bacteria 1294
231 Ga0307416_101895761 3300032002 Bacteria 699
232 Ga0307416_102153547 3300032002 Bacteria 659
233 Ga0307416_102291058 3300032002 Bacteria 641
234 Ga0307414_10035254 3300032004 Bacteria 3328
235 Ga0307414_10449196 3300032004 Bacteria 1130
236 Ga0307411_10057279 3300032005 Bacteria 2573
237 Ga0307411_10159723 3300032005 Bacteria 1686
238 Ga0307411_10237990 3300032005 Bacteria 1423
239 Ga0307411_11594041 3300032005 Bacteria 602
240 Ga0307415_100003237 3300032126 Bacteria 8262
241 Ga0307415_100017088 3300032126 Bacteria 4341
242 Ga0307415_100157559 3300032126 Bacteria 1755
243 Ga0307415_100303066 3300032126 Bacteria 1324
244 Ga0307415_101214754 3300032126 Bacteria 711
245 Ga0307510_10096970 3300033180 Bacteria 2761
246 Ga0395899_0039523 3300037312 Bacteria 3531
247 Ga0395900_0568947 3300037418 Bacteria 1076
248 Ga0395898_0193639 3300037466 Bacteria 1942
249 Ga0395905_0015865 3300037471 Bacteria 7156
250 Ga0395901_0359172 3300038443 Bacteria 1502
251 Ga0395901_0646732 3300038443 Bacteria 1061
252 Ga0451791_0994330 3300041451 Bacteria 814
253 Ga0451791_1872085 3300041451 Bacteria 624
254 Ga0451837_1410504 3300041494 Bacteria 2379
255 Ga0451843_1328031 3300041509 Bacteria 710
256 Ga0451853_1083858 3300041512 Bacteria 1045
257 Ga0439448_0317181 3300042005 Bacteria 554
258 Ga0439449_0001722 3300042007 Bacteria 8595
259 Ga0439449_0018177 3300042007 Bacteria 2638
260 Ga0439449_0083509 3300042007 Bacteria 1178
261 Ga0439455_0031557 3300042012 Bacteria 1320
262 Ga0439463_012988 3300042016 Bacteria 2048
263 Ga0450923_055832 3300042125 Bacteria 855
264 Ga0450902_003807 3300042137 Bacteria 2226
265 Ga0450918_089744 3300042531 Bacteria 593
266 Ga0439440_0002182 3300042993 Bacteria 3667
267 Ga0466965_0612048 3300044683 Bacteria 619
268 Ga0495664_0122446 3300046477 Bacteria 1573
269 Ga0495608_0517366 3300046511 Bacteria 722
270 Ga0495665_0492007 3300046531 Bacteria 618
271 Ga0495668_0002284 3300046616 Bacteria 16112
272 Ga0495625_0038844 3300046660 Bacteria 3480
273 Ga0495635_0653910 3300046663 Bacteria 684
274 Ga0495659_0488569 3300046664 Bacteria 539
275 Ga0495581_0053208 3300047315 Bacteria 2339
276 Ga0495674_0164664 3300047319 Bacteria 1854
277 Ga0496100_0442886 3300048903 Bacteria 995
278 Ga0496100_1633458 3300048903 Bacteria 509
279 Ga0496101_0079627 3300048904 Bacteria 2419
280 Ga0496101_0638751 3300048904 Bacteria 841
281 Ga0496102_0120258 3300048905 Bacteria 2453
282 Ga0496102_1793410 3300048905 Bacteria 531
283 Ga0496104_0032177 3300048907 Bacteria 4881
284 Ga0496106_0089586 3300048909 Bacteria 2373
285 Ga0496106_0174728 3300048909 Bacteria 1704
286 Ga0496107_0061745 3300048910 Bacteria 2714
287 Ga0496108_0047573 3300048911 Bacteria 3585
288 Ga0496108_0152659 3300048911 Bacteria 1993
289 Ga0496108_0275487 3300048911 Bacteria 1465
290 Ga0496109_0413403 3300048912 Bacteria 1274
291 Ga0496109_0667740 3300048912 Bacteria 976
292 Ga0496109_0746831 3300048912 Bacteria 916
293 Ga0496110_0029651 3300048913 Bacteria 4711
294 Ga0496110_0086763 3300048913 Bacteria 2794
295 Ga0496110_0350527 3300048913 Bacteria 1345
296 Ga0496111_0028304 3300048914 Bacteria 3970
297 Ga0496111_0549468 3300048914 Bacteria 848
298 Ga0496111_0586357 3300048914 Bacteria 817
299 Ga0496112_0015771 3300048915 Bacteria 7060
300 Ga0496112_0069482 3300048915 Bacteria 3479
301 Ga0496113_0075406 3300048916 Bacteria 2574
302 Ga0496113_0089586 3300048916 Bacteria 2368
303 Ga0496114_0397496 3300048917 Bacteria 1220
304 Ga0496114_0597385 3300048917 Bacteria 973
305 Ga0496115_0989802 3300048918 Bacteria 643
306 Ga0496125_0050736 3300048928 Bacteria 3431
307 Ga0501031_0048808 3300049568 Bacteria 2759
308 Ga0501031_0066352 3300049568 Bacteria 2351
309 Ga0501031_0208008 3300049568 Bacteria 1275
310 Ga0501032_0164411 3300049569 Bacteria 1456
311 Ga0501033_0017187 3300049570 Bacteria 5466
312 Ga0501033_0030647 3300049570 Bacteria 4041
313 Ga0501033_0093245 3300049570 Bacteria 2202
314 Ga0501034_0362411 3300049571 Bacteria 1377
315 Ga0501036_0012245 3300049572 Bacteria 7105
316 Ga0501036_0014078 3300049572 Bacteria 6648
317 Ga0501036_0298889 3300049572 Bacteria 1346
318 Ga0501036_1643594 3300049572 Bacteria 518
319 Ga0501037_0145604 3300049573 Bacteria 1694
320 Ga0501037_0405185 3300049573 Bacteria 935
321 Ga0501038_0061996 3300049574 Bacteria 3196
322 Ga0501039_0013837 3300049575 Bacteria 6172
323 Ga0501039_0097183 3300049575 Bacteria 2296
324 Ga0501039_1523172 3300049575 Bacteria 514
325 Ga0501040_0003961 3300049576 Bacteria 9619
326 Ga0501040_0011519 3300049576 Bacteria 5788
327 Ga0501040_0219196 3300049576 Bacteria 1353
328 Ga0501041_0007937 3300049577 Bacteria 6240
329 Ga0501041_0029696 3300049577 Bacteria 3298
330 Ga0501041_0549975 3300049577 Bacteria 735
331 Ga0501041_0795822 3300049577 Bacteria 606
332 Ga0501042_0008652 3300049578 Bacteria 6741
333 Ga0501042_0009283 3300049578 Bacteria 6546
334 Ga0501042_0088875 3300049578 Bacteria 2216
335 Ga0501043_0129857 3300049579 Bacteria 1974
336 Ga0501043_0207604 3300049579 Bacteria 1518
337 Ga0501046_0015660 3300049580 Bacteria 6366
338 Ga0501046_0036785 3300049580 Bacteria 3938
339 Ga0501046_0049052 3300049580 Bacteria 3341
340 Ga0501047_0378024 3300049581 Bacteria 1251
341 Ga0501047_0837580 3300049581 Bacteria 734
342 Ga0501048_0064263 3300049582 Bacteria 2595
343 Ga0501048_0126174 3300049582 Bacteria 1809
344 Ga0501048_0428479 3300049582 Bacteria 946
345 Ga0501068_0022667 3300049584 Bacteria 3674
346 Ga0501068_0062777 3300049584 Bacteria 2259
347 Ga0501069_0145896 3300049585 Bacteria 1358
348 Ga0501070_0098981 3300049586 Bacteria 2412
349 Ga0501070_0139964 3300049586 Bacteria 1998
350 Ga0501071_0275159 3300049587 Bacteria 1273
351 Ga0501071_0377398 3300049587 Bacteria 1081
352 Ga0501072_0125416 3300049588 Bacteria 2045
353 Ga0501072_0187358 3300049588 Bacteria 1650
354 Ga0501072_0358450 3300049588 Bacteria 1158
355 Ga0501073_0094946 3300049589 Bacteria 2071
356 Ga0501073_0435472 3300049589 Bacteria 906
357 Ga0501074_0031357 3300049590 Bacteria 3851
358 Ga0501074_0065657 3300049590 Bacteria 2611
359 Ga0501074_0238593 3300049590 Bacteria 1293
360 Ga0501075_0052131 3300049591 Bacteria 3077
361 Ga0501075_0146505 3300049591 Bacteria 1799
362 Ga0501075_0230443 3300049591 Bacteria 1412
363 Ga0501075_0458889 3300049591 Bacteria 972
364 Ga0501076_0006574 3300049592 Bacteria 8432
365 Ga0501076_0014928 3300049592 Bacteria 5861
366 Ga0501076_0287355 3300049592 Bacteria 1347
367 Ga0501076_0424113 3300049592 Bacteria 1095
368 Ga0501077_0014847 3300049593 Bacteria 4895
369 Ga0501077_0020884 3300049593 Bacteria 4145
370 Ga0501077_0023749 3300049593 Bacteria 3887
371 Ga0501216_161564 3300049660 Bacteria 538
372 Ga0501079_0009495 3300049741 Bacteria 7375
373 Ga0501079_0103323 3300049741 Bacteria 2210
374 Ga0501079_0181251 3300049741 Bacteria 1643
375 Ga0501080_0041496 3300049742 Bacteria 4287
376 Ga0501081_0009926 3300049743 Bacteria 6202
377 Ga0501081_0191872 3300049743 Bacteria 1479
378 Ga0501081_0390154 3300049743 Bacteria 1030
379 Ga0501083_0162554 3300049744 Bacteria 1460
380 Ga0501035_0087148 3300049822 Bacteria 2751
381 Ga0501044_0105235 3300049823 Bacteria 2835
382 Ga0501045_0014099 3300049824 Bacteria 5660
383 Ga0501045_0076834 3300049824 Bacteria 2460
384 Ga0501045_0327156 3300049824 Bacteria 1140
385 nmdc:mga00v17_3510_c1 3300050491 Bacteria 7332
386 nmdc:mga07m45_52939_c1 3300050496 Bacteria 2293
387 nmdc:mga05p37_233576_c1 3300050507 Bacteria 2214
388 nmdc:mga05p37_508717_c1 3300050507 Bacteria 1380
389 nmdc:mga05p37_86944_c1 3300050507 Bacteria 3853
390 nmdc:mga05p37_918616_c1 3300050507 Bacteria 941
391 nmdc:mga09592_1168961_c1 3300050508 Bacteria 637
392 nmdc:mga09592_148786_c1 3300050508 Bacteria 2019
393 nmdc:mga0qj67_426674_c1 3300050509 Bacteria 1069
394 nmdc:mga06r32_1333388_c1 3300050510 Bacteria 661
395 nmdc:mga06r32_162506_c1 3300050510 Bacteria 2215
396 nmdc:mga06r32_415851_c1 3300050510 Bacteria 1326
397 nmdc:mga06r32_532051_c1 3300050510 Bacteria 1150
398 nmdc:mga08y16_450867_c1 3300050511 Bacteria 1312
399 nmdc:mga0rr50_342046_c1 3300050513 Bacteria 1257
400 nmdc:mga0a205_17147_c2 3300050515 Bacteria 6196
401 Ga0495601_0014829 3300053077 Bacteria 4704
402 Ga0495655_0019148 3300053083 Bacteria 1516
403 Ga0500600_0269460 3300053149 Bacteria 750
404 Ga0501084_0061110 3300054114 Bacteria 3154
405 Ga0501084_0061413 3300054114 Bacteria 3146
406 Ga0590075_023788 3300059424 Bacteria 1535
407 Ga0587099_059311 3300059622 Bacteria 525
408 Ga0501082_0026158 3300060353 Bacteria 5029
409 Ga0501082_0138955 3300060353 Bacteria 2108
410 Ga0530510_0015768 3300061734 Bacteria 5342
411 Ga0530510_0444052 3300061734 Bacteria 980
412 2917736257 2917736166 Bacteria 9690793
413 2547412331 2547132111 Bacteria 8013147
414 2552108547 2551306166 Bacteria 9731570
415 2558909182 2558860112 Bacteria 9931328
416 2566995931 2565956761 Bacteria 6601618
417 2739240514 2738543011 Bacteria 5731169
418 2811846339 2808606982 Bacteria 7791042
419 2812483124 2811994917 Bacteria 7761064
420 2889302109 2889300758 Bacteria 5690814
421 2904540567 2904535858 Bacteria 6308016
422 2922554651 2922554459 Bacteria 6683962
423 2939748063 2939743619 Bacteria 5762299
424 2997452579 2997451912 Bacteria 8492419
425 3006500265 3006493962 Bacteria 8825450
426 8047713334 8047710418 Bacteria 11023148
427 8055176690 8055172936 Bacteria 9305943
428 8055414334 8055412473 Bacteria 6257500
429 JGI25407J50210_10000525
430 JGI25407J50210_10048604
431 JGI25407J50210_10068706
432 JGI25407J50210_10178452
433 Ga0070683_100285233
434 Ga0070683_100456122
435 Ga0070670_100747503
436 Ga0068869_100364272
437 Ga0068868_100244057
438 Ga0068868_100256197
439 Ga0070661_101103899
440 Ga0070692_10464601
441 Ga0070669_100580876
442 Ga0070675_101249422
443 Ga0070674_100098523
444 Ga0070674_101535557
445 Ga0070688_100460622
446 Ga0070659_100287409
447 Ga0070714_100296813
448 Ga0070701_10385391
449 Ga0070701_10388037
450 Ga0070700_100647288
451 Ga0070681_10107799
452 Ga0068867_101494077
453 Ga0070706_100502042
454 Ga0070698_100995825
455 Ga0070679_100090039
456 Ga0070672_100919864
457 Ga0070686_100678622
458 Ga0070686_101127089
459 Ga0070696_101936781
460 Ga0070665_100159814
461 Ga0070665_102173777
462 Ga0068855_100647513
463 Ga0070664_101439250
464 Ga0070664_101823351
465 Ga0068857_100409455
466 Ga0068854_100040582
467 Ga0070702_100029129
468 Ga0070702_100213113
469 Ga0070702_100662512
470 Ga0068852_100176274
471 Ga0068852_100337498
472 Ga0068859_100090377
473 Ga0068859_100188472
474 Ga0068859_100922992
475 Ga0068859_101229600
476 Ga0068864_100115372
477 Ga0068866_10083644
478 Ga0068861_100271033
479 Ga0068851_10799227
480 Ga0068863_100013256
481 Ga0068863_100038314
482 Ga0068860_101005427
483 Ga0068860_101142978
484 Ga0068860_102022146
485 Ga0081455_10000005
486 Ga0081455_10157634
487 Ga0081455_10279272
488 Ga0081538_10000298
489 Ga0081538_10001065
490 Ga0081538_10003870
491 Ga0081538_10006672
492 Ga0081538_10011941
493 Ga0081538_10172881
494 Ga0081538_10336671
495 Ga0075364_10023721
496 Ga0075367_10678764
497 Ga0097621_100358185
498 Ga0075370_10019692
499 Ga0075370_10019719
500 Ga0075370_10719266
501 Ga0075428_102044751
502 Ga0075430_100005439
503 Ga0075430_100464928
504 Ga0075431_100797470
505 Ga0075431_101091638
506 Ga0075429_100184855
507 Ga0068865_102149331
508 Ga0097620_100090378
509 Ga0097620_100188467
510 Ga0097620_100922827
511 Ga0097620_101230032
512 Ga0075435_100357198
513 Ga0105244_10065870
514 Ga0111539_10358421
515 Ga0105245_10001345
516 Ga0105245_10049567
517 Ga0105245_10204161
518 Ga0105245_10475505
519 Ga0105247_10217373
520 Ga0114129_10011207
521 Ga0114129_10099001
522 Ga0114129_10201800
523 Ga0114129_10265778
524 Ga0114129_10593788
525 Ga0114129_11040573
526 Ga0105243_10001693
527 Ga0105243_10102219
528 Ga0105243_10110296
529 Ga0105243_10780281
530 Ga0105243_11016084
531 Ga0105242_10139022
532 Ga0105242_11115714
533 Ga0105248_10300666
534 Ga0105248_11087102
535 Ga0105248_12083853
536 Ga0105238_10389393
537 Ga0105238_10811884
538 Ga0105249_10273520
539 Ga0105249_11172089
540 Ga0105249_12073981
541 Ga0105028_129724
542 Ga0105239_10310201
543 Ga0105246_10694336
544 Ga0105246_11696467
545 Ga0157369_10261814
546 Ga0157369_12020788
547 Ga0157369_12090291
548 Ga0157374_10651376
549 Ga0163162_10242538
550 Ga0163162_10247811
551 Ga0157372_12127902
552 Ga0157375_10065933
553 Ga0157375_10193794
554 Ga0157375_10469521
555 Ga0163163_10022080
556 Ga0163163_10028334
557 Ga0163163_10043482
558 Ga0163163_10271621
559 Ga0157380_11023046
560 Ga0157380_12266079
561 Ga0182008_10226945
562 Ga0157377_10355320
563 Ga0157377_10391561
564 Ga0163161_10371220
565 Ga0206349_1897964
566 Ga0206351_10834222
567 Ga0206350_11610342
568 Ga0206354_10053245
569 Ga0206353_11199414
570 Ga0224712_10132084
571 Ga0224712_10444319
572 Ga0207642_10061599
573 Ga0207643_10651297
574 Ga0207643_10934793
575 Ga0207652_10065077
576 Ga0207681_10615199
577 Ga0207694_10273504
578 Ga0207687_10000605
579 Ga0207687_10083896
580 Ga0207687_10318162
581 Ga0207664_10452069
582 Ga0207690_10444529
583 Ga0207690_11626667
584 Ga0207709_10001344
585 Ga0207709_10065288
586 Ga0207669_10660236
587 Ga0207669_11237359
588 Ga0207704_11045727
589 Ga0207691_10759827
590 Ga0207711_10175904
591 Ga0207711_10504516
592 Ga0207711_10534328
593 Ga0207711_11923766
594 Ga0207689_10211782
595 Ga0207661_10058339
596 Ga0207661_10255662
597 Ga0207679_10322046
598 Ga0207679_10980901
599 Ga0207679_11424979
600 Ga0207668_11981530
601 Ga0207640_10171742
602 Ga0207658_10708995
603 Ga0207677_10294497
604 Ga0207678_11334835
605 Ga0207708_10063498
606 Ga0207641_10010085
607 Ga0207641_10631353
608 Ga0207648_10201637
609 Ga0207676_10162908
610 Ga0207676_10586915
611 Ga0207674_10329273
612 Ga0207674_10755463
613 Ga0207675_100021272
614 Ga0207675_102442577
615 Ga0207683_11104338
616 Ga0207698_10907139
617 Ga0207428_10263282
618 Ga0268266_10276043
619 Ga0268266_10688651
620 Ga0268266_11691094
621 Ga0268265_11251067
622 Ga0307515_10157150
623 Ga0307512_10005858
624 Ga0307512_10030386
625 Ga0307513_10223303
626 Ga0307408_100144368
627 Ga0307508_10037985
628 Ga0307405_10044658
629 Ga0307405_10060750
630 Ga0307405_10601794
631 Ga0307413_10068289
632 Ga0307413_10354488
633 Ga0307413_10388835
634 Ga0307413_10994042
635 Ga0307410_10040949
636 Ga0307410_10091367
637 Ga0307410_10094692
638 Ga0307410_10101546
639 Ga0307410_10375572
640 Ga0326468_10014984
641 Ga0307406_10702307
642 Ga0307407_10041793
643 Ga0307407_10096114
644 Ga0307407_10280753
645 Ga0307412_10195550
646 Ga0307412_10211195
647 Ga0307412_10678789
648 Ga0307412_10847641
649 Ga0307409_100003145
650 Ga0307409_100017029
651 Ga0307409_100053915
652 Ga0307409_100407593
653 Ga0307409_101087181
654 Ga0307416_100019878
655 Ga0307416_100037525
656 Ga0307416_100107090
657 Ga0307416_100151650
658 Ga0307416_100487342
659 Ga0307416_101895761
660 Ga0307416_102153547
661 Ga0307416_102291058
662 Ga0307414_10035254
663 Ga0307414_10449196
664 Ga0307411_10057279
665 Ga0307411_10159723
666 Ga0307411_10237990
667 Ga0307411_11594041
668 Ga0307415_100003237
669 Ga0307415_100017088
670 Ga0307415_100157559
671 Ga0307415_100303066
672 Ga0307415_101214754
673 Ga0307510_10096970
674 Ga0395899_0039523
675 Ga0395900_0568947
676 Ga0395898_0193639
677 Ga0395905_0015865
678 Ga0395901_0359172
679 Ga0395901_0646732
680 Ga0451791_0994330
681 Ga0451791_1872085
682 Ga0451837_1410504
683 Ga0451843_1328031
684 Ga0451853_1083858
685 Ga0439448_0317181
686 Ga0439449_0001722
687 Ga0439449_0018177
688 Ga0439449_0083509
689 Ga0439455_0031557
690 Ga0439463_012988
691 Ga0450923_055832
692 Ga0450902_003807
693 Ga0450918_089744
694 Ga0439440_0002182
695 Ga0466965_0612048
696 Ga0495664_0122446
697 Ga0495608_0517366
698 Ga0495665_0492007
699 Ga0495668_0002284
700 Ga0495625_0038844
701 Ga0495635_0653910
702 Ga0495659_0488569
703 Ga0495581_0053208
704 Ga0495674_0164664
705 Ga0496100_0442886
706 Ga0496100_1633458
707 Ga0496101_0079627
708 Ga0496101_0638751
709 Ga0496102_0120258
710 Ga0496102_1793410
711 Ga0496104_0032177
712 Ga0496106_0089586
713 Ga0496106_0174728
714 Ga0496107_0061745
715 Ga0496108_0047573
716 Ga0496108_0152659
717 Ga0496108_0275487
718 Ga0496109_0413403
719 Ga0496109_0667740
720 Ga0496109_0746831
721 Ga0496110_0029651
722 Ga0496110_0086763
723 Ga0496110_0350527
724 Ga0496111_0028304
725 Ga0496111_0549468
726 Ga0496111_0586357
727 Ga0496112_0015771
728 Ga0496112_0069482
729 Ga0496113_0075406
730 Ga0496113_0089586
731 Ga0496114_0397496
732 Ga0496114_0597385
733 Ga0496115_0989802
734 Ga0496125_0050736
735 Ga0501031_0048808
736 Ga0501031_0066352
737 Ga0501031_0208008
738 Ga0501032_0164411
739 Ga0501033_0017187
740 Ga0501033_0030647
741 Ga0501033_0093245
742 Ga0501034_0362411
743 Ga0501036_0012245
744 Ga0501036_0014078
745 Ga0501036_0298889
746 Ga0501036_1643594
747 Ga0501037_0145604
748 Ga0501037_0405185
749 Ga0501038_0061996
750 Ga0501039_0013837
751 Ga0501039_0097183
752 Ga0501039_1523172
753 Ga0501040_0003961
754 Ga0501040_0011519
755 Ga0501040_0219196
756 Ga0501041_0007937
757 Ga0501041_0029696
758 Ga0501041_0549975
759 Ga0501041_0795822
760 Ga0501042_0008652
761 Ga0501042_0009283
762 Ga0501042_0088875
763 Ga0501043_0129857
764 Ga0501043_0207604
765 Ga0501046_0015660
766 Ga0501046_0036785
767 Ga0501046_0049052
768 Ga0501047_0378024
769 Ga0501047_0837580
770 Ga0501048_0064263
771 Ga0501048_0126174
772 Ga0501048_0428479
773 Ga0501068_0022667
774 Ga0501068_0062777
775 Ga0501069_0145896
776 Ga0501070_0098981
777 Ga0501070_0139964
778 Ga0501071_0275159
779 Ga0501071_0377398
780 Ga0501072_0125416
781 Ga0501072_0187358
782 Ga0501072_0358450
783 Ga0501073_0094946
784 Ga0501073_0435472
785 Ga0501074_0031357
786 Ga0501074_0065657
787 Ga0501074_0238593
788 Ga0501075_0052131
789 Ga0501075_0146505
790 Ga0501075_0230443
791 Ga0501075_0458889
792 Ga0501076_0006574
793 Ga0501076_0014928
794 Ga0501076_0287355
795 Ga0501076_0424113
796 Ga0501077_0014847
797 Ga0501077_0020884
798 Ga0501077_0023749
799 Ga0501216_161564
800 Ga0501079_0009495
801 Ga0501079_0103323
802 Ga0501079_0181251
803 Ga0501080_0041496
804 Ga0501081_0009926
805 Ga0501081_0191872
806 Ga0501081_0390154
807 Ga0501083_0162554
808 Ga0501035_0087148
809 Ga0501044_0105235
810 Ga0501045_0014099
811 Ga0501045_0076834
812 Ga0501045_0327156
813 nmdc:mga00v17_3510_c1
814 nmdc:mga07m45_52939_c1
815 nmdc:mga05p37_233576_c1
816 nmdc:mga05p37_508717_c1
817 nmdc:mga05p37_86944_c1
818 nmdc:mga05p37_918616_c1
819 nmdc:mga09592_1168961_c1
820 nmdc:mga09592_148786_c1
821 nmdc:mga0qj67_426674_c1
822 nmdc:mga06r32_1333388_c1
823 nmdc:mga06r32_162506_c1
824 nmdc:mga06r32_415851_c1
825 nmdc:mga06r32_532051_c1
826 nmdc:mga08y16_450867_c1
827 nmdc:mga0rr50_342046_c1
828 nmdc:mga0a205_17147_c2
829 Ga0495601_0014829
830 Ga0495655_0019148
831 Ga0500600_0269460
832 Ga0501084_0061110
833 Ga0501084_0061413
834 Ga0590075_023788
835 Ga0587099_059311
836 Ga0501082_0026158
837 Ga0501082_0138955
838 Ga0530510_0015768
839 Ga0530510_0444052
840 2917736257
841 2547412331
842 2552108547
843 2558909182
844 2566995931
845 2739240514
846 2811846339
847 2812483124
848 2889302109
849 2904540567
850 2922554651
851 2939748063
852 2997452579
853 3006500265
854 8047713334
855 8055176690
856 8055414334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

127

0.94

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

1

128

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8642 2 135
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8581 2 135
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.7953 1 137
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.7903 1 137
3l20-assembly1.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.7777 1 135
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8781 79 133 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8492 10 135 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8361 10 135 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.803 10 137 3.10.180.10
4ntcB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8017 51 64 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A5N0UW44-F1-model_v4 VOC family protein 0.9804 1 133
AF-A0A6J4NGG0-F1-model_v4 PhnB protein putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein 0.9775 1 137 GO:0008168
GO:0032259
AF-A0A7W0R6A6-F1-model_v4 VOC family protein 0.9764 1 67
AF-A0A1R0KGC5-F1-model_v4 PhnB-like domain-containing protein 0.9744 1 135
AF-A0A1W2LV17-F1-model_v4 PhnB-like domain-containing protein 0.9737 1 135

Map