F441652

General Info

Members Datasets Scaffolds Average Seq Length
428 143 856 257

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10133633|Ga0075433_101336331
Length 232
Sequence MRTPLVMGNWKMYGLLAEARALATGVRDGLKRVRDVEVALCPPYTALAAVSDVLGGGPIRLGAQNCHWDASGAHTGEISPVMLADVGCRYVLLGHSERRREMGESDEQVNRKVRAALAHRLTPVLCVGETAEERRQGLTFTTVEGQGVNATPAQAAEVHGYLRGLLSELTSKETALIIRILYGGSVKADNADALCAEPEIDGALVGSASLTAAGFIGIVKKAARAGAVTKGD

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
86 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
87 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
94 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
95 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 99.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10133633 3300006852 Bacteria 2205
2 JGI25406J46586_10024105 3300003203 Bacteria 2392
3 Ga0065707_10279063 3300005295 Bacteria 1052
4 Ga0065707_10281052 3300005295 Bacteria 1047
5 Ga0068869_100007524 3300005334 Bacteria 6968
6 Ga0070680_100007348 3300005336 Bacteria 8406
7 Ga0070669_100265391 3300005353 Bacteria 1371
8 Ga0070703_10087985 3300005406 Bacteria 1072
9 Ga0070713_100350118 3300005436 Bacteria 1370
10 Ga0070701_10005129 3300005438 Bacteria 5381
11 Ga0070711_100002410 3300005439 Bacteria 10664
12 Ga0070705_100002658 3300005440 Bacteria 8947
13 Ga0070705_100034542 3300005440 Bacteria 2828
14 Ga0070705_100117946 3300005440 Bacteria 1708
15 Ga0070705_100125114 3300005440 Bacteria 1667
16 Ga0070700_100193770 3300005441 Bacteria 1423
17 Ga0070700_100224993 3300005441 Bacteria 1332
18 Ga0070694_100020615 3300005444 Bacteria 4206
19 Ga0070708_100010351 3300005445 Bacteria 7553
20 Ga0070708_100068693 3300005445 Bacteria 3185
21 Ga0070708_100079411 3300005445 Bacteria 2968
22 Ga0070708_100156202 3300005445 Bacteria 2124
23 Ga0070708_100286150 3300005445 Bacteria 1551
24 Ga0070708_100300703 3300005445 Bacteria 1511
25 Ga0068867_100037786 3300005459 Bacteria 3511
26 Ga0068867_100668651 3300005459 Bacteria 913
27 Ga0070706_100010897 3300005467 Bacteria 8439
28 Ga0070706_100090793 3300005467 Bacteria 2833
29 Ga0070706_100122084 3300005467 Bacteria 2428
30 Ga0070706_100240345 3300005467 Bacteria 1691
31 Ga0070706_100370248 3300005467 Bacteria 1335
32 Ga0070707_100008770 3300005468 Bacteria 9378
33 Ga0070707_100039026 3300005468 Bacteria 4538
34 Ga0070707_100046654 3300005468 Bacteria 4146
35 Ga0070707_100065584 3300005468 Bacteria 3488
36 Ga0070707_100070359 3300005468 Bacteria 3370
37 Ga0070707_100112452 3300005468 Bacteria 2641
38 Ga0070707_100298487 3300005468 Bacteria 1565
39 Ga0070707_100303949 3300005468 Bacteria 1550
40 Ga0070698_100008479 3300005471 Bacteria 11102
41 Ga0070698_100383841 3300005471 Bacteria 1337
42 Ga0070699_100000534 3300005518 Bacteria 36008
43 Ga0070699_100014879 3300005518 Bacteria 6688
44 Ga0070699_100105276 3300005518 Bacteria 2475
45 Ga0070699_100142974 3300005518 Bacteria 2114
46 Ga0070699_100204206 3300005518 Bacteria 1758
47 Ga0070699_100226948 3300005518 Bacteria 1665
48 Ga0070699_100345579 3300005518 Bacteria 1339
49 Ga0070697_100002842 3300005536 Bacteria 13318
50 Ga0070697_100004778 3300005536 Bacteria 10386
51 Ga0070697_100037492 3300005536 Bacteria 3917
52 Ga0070697_100365560 3300005536 Bacteria 1248
53 Ga0070695_100007183 3300005545 Bacteria 6603
54 Ga0070695_100072856 3300005545 Bacteria 2253
55 Ga0070696_100017768 3300005546 Bacteria 4801
56 Ga0070696_100096295 3300005546 Bacteria 2115
57 Ga0070696_100359922 3300005546 Bacteria 1129
58 Ga0070704_100255126 3300005549 Bacteria 1442
59 Ga0068857_100020188 3300005577 Bacteria 5857
60 Ga0068859_100016362 3300005617 Bacteria 7451
61 Ga0068859_100714738 3300005617 Bacteria 1092
62 Ga0068870_10002194 3300005840 Bacteria 8088
63 Ga0068863_100073403 3300005841 Bacteria 3237
64 Ga0068860_100765603 3300005843 Bacteria 978
65 Ga0068862_100017153 3300005844 Bacteria 6025
66 Ga0068862_100176991 3300005844 Bacteria 1913
67 Ga0081540_1012183 3300005983 Bacteria 5686
68 Ga0081539_10000454 3300005985 Bacteria 87230
69 Ga0070712_100001853 3300006175 Bacteria 12884
70 Ga0075428_100001697 3300006844 Bacteria 23501
71 Ga0075428_100002161 3300006844 Bacteria 21262
72 Ga0075428_100056508 3300006844 Bacteria 4299
73 Ga0075428_100066138 3300006844 Bacteria 3958
74 Ga0075428_100095715 3300006844 Bacteria 3237
75 Ga0075428_100239155 3300006844 Bacteria 1959
76 Ga0075430_100000330 3300006846 Bacteria 33985
77 Ga0075430_100000397 3300006846 Bacteria 32197
78 Ga0075430_100022029 3300006846 Bacteria 5416
79 Ga0075430_100022512 3300006846 Bacteria 5363
80 Ga0075430_100076889 3300006846 Bacteria 2798
81 Ga0075430_100182936 3300006846 Bacteria 1743
82 Ga0075430_100190624 3300006846 Bacteria 1704
83 Ga0075431_100000322 3300006847 Bacteria 37762
84 Ga0075431_100000455 3300006847 Bacteria 33646
85 Ga0075431_100004664 3300006847 Bacteria 13466
86 Ga0075431_100006452 3300006847 Bacteria 11649
87 Ga0075431_100008506 3300006847 Bacteria 10276
88 Ga0075431_100018260 3300006847 Bacteria 7136
89 Ga0075431_100029174 3300006847 Bacteria 5675
90 Ga0075431_100029804 3300006847 Bacteria 5619
91 Ga0075431_100034147 3300006847 Bacteria 5242
92 Ga0075431_100406786 3300006847 Bacteria 1361
93 Ga0075433_10000061 3300006852 Bacteria 47469
94 Ga0075433_10000427 3300006852 Bacteria 27010
95 Ga0075433_10021428 3300006852 Bacteria 5419
96 Ga0075433_10022156 3300006852 Bacteria 5333
97 Ga0075433_10027815 3300006852 Bacteria 4801
98 Ga0075433_10086460 3300006852 Bacteria 2768
99 Ga0075433_10111965 3300006852 Bacteria 2422
100 Ga0075433_10114075 3300006852 Bacteria 2397
101 Ga0075433_10135939 3300006852 Bacteria 2185
102 Ga0075433_10297301 3300006852 Bacteria 1430
103 Ga0075434_100000180 3300006871 Bacteria 41040
104 Ga0075434_100001093 3300006871 Bacteria 22205
105 Ga0075434_100026482 3300006871 Bacteria 5682
106 Ga0075434_100034425 3300006871 Bacteria 5002
107 Ga0075434_100049897 3300006871 Bacteria 4156
108 Ga0075434_100106619 3300006871 Bacteria 2812
109 Ga0075434_100147405 3300006871 Bacteria 2374
110 Ga0075434_100167945 3300006871 Bacteria 2214
111 Ga0075434_100231281 3300006871 Bacteria 1868
112 Ga0075434_100248924 3300006871 Bacteria 1796
113 Ga0075434_100870977 3300006871 Bacteria 916
114 Ga0075429_100000023 3300006880 Bacteria 68064
115 Ga0075429_100006022 3300006880 Bacteria 10485
116 Ga0075429_100006260 3300006880 Bacteria 10302
117 Ga0075429_100009475 3300006880 Bacteria 8451
118 Ga0075429_100010194 3300006880 Bacteria 8136
119 Ga0075429_100011911 3300006880 Bacteria 7540
120 Ga0075429_100154556 3300006880 Bacteria 2009
121 Ga0075429_100384946 3300006880 Bacteria 1228
122 Ga0075429_100440900 3300006880 Bacteria 1141
123 Ga0075429_100592004 3300006880 Bacteria 972
124 Ga0075436_100000699 3300006914 Bacteria 22189
125 Ga0075436_100022732 3300006914 Bacteria 4308
126 Ga0097620_100016362 3300006931 Bacteria 7451
127 Ga0097620_100714588 3300006931 Bacteria 1092
128 Ga0075435_100000217 3300007076 Bacteria 35234
129 Ga0075435_100001420 3300007076 Bacteria 15463
130 Ga0075435_100032558 3300007076 Bacteria 4118
131 Ga0075435_100037789 3300007076 Bacteria 3847
132 Ga0075435_100129961 3300007076 Bacteria 2107
133 Ga0075435_100198992 3300007076 Bacteria 1697
134 Ga0099794_10003620 3300007265 Bacteria 5929
135 Ga0099794_10006451 3300007265 Bacteria 4753
136 Ga0111539_10000463 3300009094 Bacteria 51027
137 Ga0111539_10003456 3300009094 Bacteria 20802
138 Ga0111539_10013779 3300009094 Bacteria 10100
139 Ga0111539_10017755 3300009094 Bacteria 8808
140 Ga0111539_10072921 3300009094 Bacteria 4048
141 Ga0111539_10823892 3300009094 Bacteria 1080
142 Ga0105245_10280633 3300009098 Bacteria 1628
143 Ga0114129_10000110 3300009147 Bacteria 81178
144 Ga0114129_10000936 3300009147 Bacteria 38136
145 Ga0114129_10002179 3300009147 Bacteria 26947
146 Ga0114129_10002546 3300009147 Bacteria 25316
147 Ga0114129_10003145 3300009147 Bacteria 23174
148 Ga0114129_10027194 3300009147 Bacteria 8099
149 Ga0114129_10029862 3300009147 Bacteria 7720
150 Ga0114129_10032488 3300009147 Bacteria 7376
151 Ga0114129_10033339 3300009147 Bacteria 7277
152 Ga0114129_10038131 3300009147 Bacteria 6781
153 Ga0114129_10047070 3300009147 Bacteria 6061
154 Ga0114129_10095654 3300009147 Bacteria 4114
155 Ga0114129_10173302 3300009147 Bacteria 2940
156 Ga0114129_10175954 3300009147 Bacteria 2915
157 Ga0114129_10206181 3300009147 Bacteria 2660
158 Ga0114129_10291234 3300009147 Bacteria 2179
159 Ga0114129_10448928 3300009147 Bacteria 1691
160 Ga0114129_10461438 3300009147 Bacteria 1665
161 Ga0114129_10492281 3300009147 Bacteria 1602
162 Ga0114129_10607968 3300009147 Bacteria 1416
163 Ga0114129_10809746 3300009147 Bacteria 1194
164 Ga0114129_11044651 3300009147 Bacteria 1026
165 Ga0105243_10012018 3300009148 Bacteria 6545
166 Ga0105243_10538217 3300009148 Bacteria 1114
167 Ga0105241_10024191 3300009174 Bacteria 4510
168 Ga0105241_10083353 3300009174 Bacteria 2508
169 Ga0105242_10022494 3300009176 Bacteria 4958
170 Ga0105248_10237799 3300009177 Bacteria 2050
171 Ga0105249_10199662 3300009553 Bacteria 1957
172 Ga0157378_10153323 3300013297 Bacteria 2148
173 Ga0157372_10676115 3300013307 Bacteria 1202
174 Ga0207653_10003704 3300025885 Bacteria 4806
175 Ga0207643_10005762 3300025908 Bacteria 6620
176 Ga0207684_10000279 3300025910 Bacteria 74399
177 Ga0207684_10023853 3300025910 Bacteria 5221
178 Ga0207684_10050509 3300025910 Bacteria 3528
179 Ga0207684_10086919 3300025910 Bacteria 2663
180 Ga0207684_10529644 3300025910 Bacteria 1009
181 Ga0207654_10044726 3300025911 Bacteria 2516
182 Ga0207693_10019144 3300025915 Bacteria 5448
183 Ga0207660_10029603 3300025917 Bacteria 3758
184 Ga0207646_10001682 3300025922 Bacteria 26908
185 Ga0207646_10009939 3300025922 Bacteria 9356
186 Ga0207646_10035285 3300025922 Bacteria 4517
187 Ga0207646_10062259 3300025922 Bacteria 3331
188 Ga0207646_10076844 3300025922 Bacteria 2984
189 Ga0207646_10457527 3300025922 Bacteria 1151
190 Ga0207681_10122255 3300025923 Bacteria 1911
191 Ga0207681_10332143 3300025923 Bacteria 1212
192 Ga0207706_10028302 3300025933 Bacteria 5005
193 Ga0207706_10135435 3300025933 Bacteria 2167
194 Ga0207686_10035470 3300025934 Bacteria 2994
195 Ga0207691_10025783 3300025940 Bacteria 5517
196 Ga0207711_10547892 3300025941 Bacteria 1079
197 Ga0207689_10012380 3300025942 Bacteria 7297
198 Ga0207712_10071684 3300025961 Bacteria 2492
199 Ga0207708_10009082 3300026075 Bacteria 7357
200 Ga0207708_10247951 3300026075 Bacteria 1434
201 Ga0207641_10127058 3300026088 Bacteria 2284
202 Ga0207648_10043683 3300026089 Bacteria 3934
203 Ga0207648_10180798 3300026089 Bacteria 1867
204 Ga0207674_10007378 3300026116 Bacteria 12807
205 Ga0207675_100210034 3300026118 Bacteria 1872
206 Ga0209588_1005305 3300027671 Bacteria 3686
207 Ga0209971_1050061 3300027682 Bacteria 1009
208 Ga0209974_10054883 3300027876 Bacteria 1343
209 Ga0207428_10000027 3300027907 Bacteria 250186
210 Ga0207428_10000245 3300027907 Bacteria 74009
211 Ga0207428_10004270 3300027907 Bacteria 13678
212 Ga0207428_10223168 3300027907 Bacteria 1412
213 Ga0268265_10200807 3300028380 Bacteria 1730
214 Ga0307408_100013298 3300031548 Bacteria 5463
215 Ga0307408_100033085 3300031548 Bacteria 3609
216 Ga0307408_100448808 3300031548 Bacteria 1118
217 Ga0307410_10107161 3300031852 Bacteria 2015
218 Ga0307406_10168106 3300031901 Bacteria 1584
219 Ga0307407_10053681 3300031903 Bacteria 2320
220 Ga0307409_100138199 3300031995 Bacteria 2095
221 Ga0307416_100006419 3300032002 Bacteria 7362
222 Ga0307416_100382415 3300032002 Bacteria 1438
223 Ga0307411_10007782 3300032005 Bacteria 5495
224 Ga0307411_10185663 3300032005 Bacteria 1583
225 Ga0373948_0028769 3300034817 Bacteria 1108
226 Ga0373928_0029149 3300035084 Bacteria 1212
227 Ga0373940_0001302 3300035088 Bacteria 4442
228 Ga0373940_0018349 3300035088 Bacteria 1755
229 Ga0373949_0048144 3300035090 Bacteria 1067
230 Ga0373939_0052657 3300035114 Bacteria 1269
231 Ga0395899_0104468 3300037312 Bacteria 2041
232 Ga0395900_0002273 3300037418 Bacteria 21347
233 Ga0395900_0069382 3300037418 Bacteria 3623
234 Ga0395898_0002914 3300037466 Bacteria 19471
235 Ga0395905_0093009 3300037471 Bacteria 2828
236 Ga0395901_0003758 3300038443 Bacteria 15294
237 Ga0439441_010156 3300042001 Bacteria 1573
238 Ga0439435_0055741 3300042436 Bacteria 1141
239 Ga0439460_0019694 3300042461 Bacteria 1830
240 Ga0451577_0007999 3300042876 Bacteria 10322
241 Ga0451577_0060640 3300042876 Bacteria 3373
242 Ga0451577_0159885 3300042876 Bacteria 2028
243 Ga0451577_0248069 3300042876 Bacteria 1611
244 Ga0453683_0007766 3300044673 Bacteria 7251
245 Ga0453683_0131910 3300044673 Bacteria 1575
246 Ga0453684_0012894 3300044712 Bacteria 13693
247 Ga0453684_0377402 3300044712 Bacteria 1593
248 Ga0451576_0036148 3300045051 Bacteria 5237
249 Ga0451576_0161254 3300045051 Bacteria 2340
250 Ga0451576_0597146 3300045051 Bacteria 1160
251 Ga0451576_0862661 3300045051 Bacteria 950
252 Ga0495603_0030970 3300046455 Bacteria 3221
253 Ga0495580_0000727 3300046472 Bacteria 28206
254 Ga0495594_0130143 3300046499 Bacteria 1425
255 Ga0495642_0059358 3300046528 Bacteria 1585
256 Ga0495642_0084314 3300046528 Bacteria 1341
257 Ga0495659_0044605 3300046664 Bacteria 1595
258 Ga0495659_0092185 3300046664 Bacteria 1164
259 Ga0495669_0029667 3300046684 Bacteria 2399
260 Ga0496102_0020355 3300048905 Bacteria 5864
261 Ga0496106_0115725 3300048909 Bacteria 2091
262 Ga0496106_0358639 3300048909 Bacteria 1171
263 Ga0501031_0205000 3300049568 Bacteria 1286
264 Ga0501036_0064969 3300049572 Bacteria 3088
265 Ga0501036_0155917 3300049572 Bacteria 1926
266 Ga0501036_0280253 3300049572 Bacteria 1395
267 Ga0501037_0543056 3300049573 Bacteria 785
268 Ga0501038_0018640 3300049574 Bacteria 6269
269 Ga0501038_0397338 3300049574 Bacteria 1067
270 Ga0501039_0046889 3300049575 Bacteria 3339
271 Ga0501039_0137413 3300049575 Bacteria 1919
272 Ga0501039_0185985 3300049575 Bacteria 1634
273 Ga0501039_0458666 3300049575 Bacteria 1001
274 Ga0501040_0010590 3300049576 Bacteria 6030
275 Ga0501040_0010672 3300049576 Bacteria 6008
276 Ga0501040_0034408 3300049576 Bacteria 3432
277 Ga0501040_0269278 3300049576 Bacteria 1216
278 Ga0501040_0448885 3300049576 Bacteria 928
279 Ga0501040_0456865 3300049576 Bacteria 919
280 Ga0501041_0020199 3300049577 Bacteria 3979
281 Ga0501042_0347447 3300049578 Bacteria 1073
282 Ga0501046_0147767 3300049580 Bacteria 1774
283 Ga0501048_0014424 3300049582 Bacteria 5850
284 Ga0501048_0137972 3300049582 Bacteria 1724
285 Ga0501067_0005543 3300049583 Bacteria 6995
286 Ga0501068_0019031 3300049584 Bacteria 3980
287 Ga0501068_0076711 3300049584 Bacteria 2046
288 Ga0501068_0221546 3300049584 Bacteria 1202
289 Ga0501069_0017117 3300049585 Bacteria 3898
290 Ga0501071_0058325 3300049587 Bacteria 2791
291 Ga0501071_0180400 3300049587 Bacteria 1582
292 Ga0501072_0006731 3300049588 Bacteria 8737
293 Ga0501072_0009215 3300049588 Bacteria 7500
294 Ga0501072_0009417 3300049588 Bacteria 7427
295 Ga0501072_0161559 3300049588 Bacteria 1787
296 Ga0501072_0435961 3300049588 Bacteria 1038
297 Ga0501074_0050212 3300049590 Bacteria 3011
298 Ga0501075_0011883 3300049591 Bacteria 6176
299 Ga0501075_0015688 3300049591 Bacteria 5442
300 Ga0501075_0068125 3300049591 Bacteria 2688
301 Ga0501075_0077435 3300049591 Bacteria 2516
302 Ga0501075_0105277 3300049591 Bacteria 2144
303 Ga0501075_0152431 3300049591 Bacteria 1762
304 Ga0501075_0167391 3300049591 Bacteria 1677
305 Ga0501075_0283540 3300049591 Bacteria 1262
306 Ga0501075_0501398 3300049591 Bacteria 926
307 Ga0501076_0004607 3300049592 Bacteria 9813
308 Ga0501076_0036278 3300049592 Bacteria 3863
309 Ga0501076_0036703 3300049592 Bacteria 3841
310 Ga0501076_0041959 3300049592 Bacteria 3602
311 Ga0501076_0047676 3300049592 Bacteria 3387
312 Ga0501076_0407042 3300049592 Bacteria 1119
313 Ga0501076_0456851 3300049592 Bacteria 1051
314 Ga0501076_0549770 3300049592 Bacteria 952
315 Ga0501077_0001634 3300049593 Bacteria 13461
316 Ga0501077_0022406 3300049593 Bacteria 4001
317 Ga0501077_0049898 3300049593 Bacteria 2660
318 Ga0501077_0078221 3300049593 Bacteria 2096
319 Ga0501077_0117781 3300049593 Bacteria 1683
320 Ga0501077_0135042 3300049593 Bacteria 1565
321 Ga0501079_0003482 3300049741 Bacteria 11571
322 Ga0501079_0006853 3300049741 Bacteria 8581
323 Ga0501079_0029330 3300049741 Bacteria 4224
324 Ga0501079_0683397 3300049741 Bacteria 808
325 Ga0501080_0030460 3300049742 Bacteria 5027
326 Ga0501080_0282060 3300049742 Bacteria 1510
327 Ga0501081_0009611 3300049743 Bacteria 6304
328 Ga0501081_0013069 3300049743 Bacteria 5460
329 Ga0501081_0042442 3300049743 Bacteria 3117
330 Ga0501081_0179386 3300049743 Bacteria 1531
331 Ga0501081_0197776 3300049743 Bacteria 1457
332 Ga0501035_0220131 3300049822 Bacteria 1621
333 Ga0501035_0554515 3300049822 Bacteria 941
334 Ga0501045_0009788 3300049824 Bacteria 6705
335 Ga0501045_0121879 3300049824 Bacteria 1936
336 nmdc:mga05p37_10163_c1 3300050507 Bacteria 11170
337 nmdc:mga05p37_106625_c1 3300050507 Bacteria 3447
338 nmdc:mga05p37_149435_c1 3300050507 Bacteria 2859
339 nmdc:mga05p37_1590_c1 3300050507 Bacteria 26367
340 nmdc:mga05p37_16413_c1 3300050507 Bacteria 8922
341 nmdc:mga05p37_178231_c1 3300050507 Bacteria 2588
342 nmdc:mga05p37_184760_c1 3300050507 Bacteria 2535
343 nmdc:mga05p37_18972_c1 3300050507 Bacteria 8000
344 nmdc:mga05p37_198750_c1 3300050507 Bacteria 2430
345 nmdc:mga05p37_237874_c1 3300050507 Bacteria 2191
346 nmdc:mga05p37_26803_c1 3300050507 Bacteria 7009
347 nmdc:mga05p37_358133_c1 3300050507 Bacteria 1716
348 nmdc:mga05p37_4364_c1 3300050507 Bacteria 16507
349 nmdc:mga05p37_769_c1 3300050507 Bacteria 35683
350 nmdc:mga05p37_807516_c1 3300050507 Bacteria 1025
351 nmdc:mga05p37_9582_c1 3300050507 Bacteria 11471
352 nmdc:mga09592_147572_c1 3300050508 Bacteria 2028
353 nmdc:mga09592_148463_c1 3300050508 Bacteria 2022
354 nmdc:mga09592_1895_c1 3300050508 Bacteria 16842
355 nmdc:mga09592_204225_c1 3300050508 Bacteria 1711
356 nmdc:mga09592_276066_c1 3300050508 Bacteria 1458
357 nmdc:mga09592_364837_c1 3300050508 Bacteria 1249
358 nmdc:mga09592_3897_c1 3300050508 Bacteria 12019
359 nmdc:mga09592_458238_c1 3300050508 Bacteria 1100
360 nmdc:mga09592_469927_c1 3300050508 Bacteria 1084
361 nmdc:mga09592_570251_c1 3300050508 Bacteria 971
362 nmdc:mga09592_7315_c1 3300050508 Bacteria 8976
363 nmdc:mga09592_79286_c1 3300050508 Bacteria 2796
364 nmdc:mga09592_97300_c1 3300050508 Bacteria 2519
365 nmdc:mga0qj67_140_c1 3300050509 Bacteria 48848
366 nmdc:mga0qj67_211852_c1 3300050509 Bacteria 1574
367 nmdc:mga0qj67_3069_c1 3300050509 Bacteria 12000
368 nmdc:mga0qj67_3096_c1 3300050509 Bacteria 11962
369 nmdc:mga0qj67_82754_c1 3300050509 Bacteria 2573
370 nmdc:mga06r32_10905_c1 3300050510 Bacteria 8184
371 nmdc:mga06r32_125345_c2 3300050510 Bacteria 1930
372 nmdc:mga06r32_150003_c1 3300050510 Bacteria 2309
373 nmdc:mga06r32_1729_c1 3300050510 Bacteria 19654
374 nmdc:mga06r32_18821_c1 3300050510 Bacteria 6328
375 nmdc:mga06r32_227148_c1 3300050510 Bacteria 1855
376 nmdc:mga06r32_23665_c1 3300050510 Bacteria 5688
377 nmdc:mga06r32_2388_c1 3300050510 Bacteria 16811
378 nmdc:mga06r32_5417_c1 3300050510 Bacteria 11484
379 nmdc:mga06r32_547948_c1 3300050510 Bacteria 1131
380 nmdc:mga06r32_680485_c1 3300050510 Bacteria 995
381 nmdc:mga06r32_9659_c1 3300050510 Bacteria 8714
382 nmdc:mga08y16_1000414_c1 3300050511 Bacteria 816
383 nmdc:mga08y16_10911_c1 3300050511 Bacteria 9543
384 nmdc:mga08y16_109808_c1 3300050511 Bacteria 2872
385 nmdc:mga08y16_110750_c1 3300050511 Bacteria 2859
386 nmdc:mga08y16_597_c1 3300050511 Bacteria 33660
387 nmdc:mga08y16_724075_c1 3300050511 Bacteria 993
388 nmdc:mga08y16_8315_c1 3300050511 Bacteria 10863
389 nmdc:mga0n895_10186_c1 3300050512 Bacteria 8280
390 nmdc:mga0n895_163419_c1 3300050512 Bacteria 2258
391 nmdc:mga0n895_21057_c1 3300050512 Bacteria 6093
392 nmdc:mga0n895_25174_c1 3300050512 Bacteria 5620
393 nmdc:mga0n895_253704_c1 3300050512 Bacteria 1785
394 nmdc:mga0n895_6022_c1 3300050512 Bacteria 10220
395 nmdc:mga0n895_74199_c1 3300050512 Bacteria 3379
396 nmdc:mga0n895_9783_c1 3300050512 Bacteria 8419
397 nmdc:mga0rr50_27131_c1 3300050513 Bacteria 4005
398 nmdc:mga0rr50_2794_c1 3300050513 Bacteria 6389
399 nmdc:mga0rr50_50611_c1 3300050513 Bacteria 3079
400 nmdc:mga0rr50_640_c1 3300050513 Bacteria 18804
401 nmdc:mga0rr50_7126_c1 3300050513 Bacteria 6867
402 nmdc:mga08x19_119974_c1 3300050514 Bacteria 1762
403 nmdc:mga08x19_19282_c1 3300050514 Bacteria 4184
404 nmdc:mga08x19_42300_c1 3300050514 Bacteria 2904
405 nmdc:mga0a205_200429_c1 3300050515 Bacteria 1887
406 nmdc:mga0a205_289_c1 3300050515 Bacteria 37019
407 nmdc:mga0a205_363387_c1 3300050515 Bacteria 1314
408 nmdc:mga0a205_385200_c1 3300050515 Bacteria 1267
409 nmdc:mga0a205_46448_c1 3300050515 Bacteria 4188
410 nmdc:mga0a205_4793_c2 3300050515 Bacteria 5442
411 nmdc:mga0a205_58006_c1 3300050515 Bacteria 3739
412 nmdc:mga0a205_72166_c1 3300050515 Bacteria 3335
413 Ga0501084_0013003 3300054114 Bacteria 6888
414 Ga0501084_0022249 3300054114 Bacteria 5290
415 Ga0501084_0342380 3300054114 Bacteria 1263
416 Ga0501084_0520057 3300054114 Bacteria 1006
417 Ga0501082_0113657 3300060353 Bacteria 2344
418 Ga0501082_0118077 3300060353 Bacteria 2298
419 Ga0501082_0137832 3300060353 Bacteria 2117
420 Ga0501082_0307775 3300060353 Bacteria 1380
421 Ga0530510_0010979 3300061734 Bacteria 6351
422 Ga0530510_0021986 3300061734 Bacteria 4540
423 Ga0530510_0027463 3300061734 Bacteria 4077
424 Ga0530510_0121817 3300061734 Bacteria 1915
425 Ga0530510_0208243 3300061734 Bacteria 1453
426 Ga0530510_0229660 3300061734 Bacteria 1380
427 Ga0530510_0423742 3300061734 Bacteria 1005
428 Ga0530510_0515958 3300061734 Bacteria 906
429 Ga0075433_10133633
430 JGI25406J46586_10024105
431 Ga0065707_10279063
432 Ga0065707_10281052
433 Ga0068869_100007524
434 Ga0070680_100007348
435 Ga0070669_100265391
436 Ga0070703_10087985
437 Ga0070713_100350118
438 Ga0070701_10005129
439 Ga0070711_100002410
440 Ga0070705_100002658
441 Ga0070705_100034542
442 Ga0070705_100117946
443 Ga0070705_100125114
444 Ga0070700_100193770
445 Ga0070700_100224993
446 Ga0070694_100020615
447 Ga0070708_100010351
448 Ga0070708_100068693
449 Ga0070708_100079411
450 Ga0070708_100156202
451 Ga0070708_100286150
452 Ga0070708_100300703
453 Ga0068867_100037786
454 Ga0068867_100668651
455 Ga0070706_100010897
456 Ga0070706_100090793
457 Ga0070706_100122084
458 Ga0070706_100240345
459 Ga0070706_100370248
460 Ga0070707_100008770
461 Ga0070707_100039026
462 Ga0070707_100046654
463 Ga0070707_100065584
464 Ga0070707_100070359
465 Ga0070707_100112452
466 Ga0070707_100298487
467 Ga0070707_100303949
468 Ga0070698_100008479
469 Ga0070698_100383841
470 Ga0070699_100000534
471 Ga0070699_100014879
472 Ga0070699_100105276
473 Ga0070699_100142974
474 Ga0070699_100204206
475 Ga0070699_100226948
476 Ga0070699_100345579
477 Ga0070697_100002842
478 Ga0070697_100004778
479 Ga0070697_100037492
480 Ga0070697_100365560
481 Ga0070695_100007183
482 Ga0070695_100072856
483 Ga0070696_100017768
484 Ga0070696_100096295
485 Ga0070696_100359922
486 Ga0070704_100255126
487 Ga0068857_100020188
488 Ga0068859_100016362
489 Ga0068859_100714738
490 Ga0068870_10002194
491 Ga0068863_100073403
492 Ga0068860_100765603
493 Ga0068862_100017153
494 Ga0068862_100176991
495 Ga0081540_1012183
496 Ga0081539_10000454
497 Ga0070712_100001853
498 Ga0075428_100001697
499 Ga0075428_100002161
500 Ga0075428_100056508
501 Ga0075428_100066138
502 Ga0075428_100095715
503 Ga0075428_100239155
504 Ga0075430_100000330
505 Ga0075430_100000397
506 Ga0075430_100022029
507 Ga0075430_100022512
508 Ga0075430_100076889
509 Ga0075430_100182936
510 Ga0075430_100190624
511 Ga0075431_100000322
512 Ga0075431_100000455
513 Ga0075431_100004664
514 Ga0075431_100006452
515 Ga0075431_100008506
516 Ga0075431_100018260
517 Ga0075431_100029174
518 Ga0075431_100029804
519 Ga0075431_100034147
520 Ga0075431_100406786
521 Ga0075433_10000061
522 Ga0075433_10000427
523 Ga0075433_10021428
524 Ga0075433_10022156
525 Ga0075433_10027815
526 Ga0075433_10086460
527 Ga0075433_10111965
528 Ga0075433_10114075
529 Ga0075433_10135939
530 Ga0075433_10297301
531 Ga0075434_100000180
532 Ga0075434_100001093
533 Ga0075434_100026482
534 Ga0075434_100034425
535 Ga0075434_100049897
536 Ga0075434_100106619
537 Ga0075434_100147405
538 Ga0075434_100167945
539 Ga0075434_100231281
540 Ga0075434_100248924
541 Ga0075434_100870977
542 Ga0075429_100000023
543 Ga0075429_100006022
544 Ga0075429_100006260
545 Ga0075429_100009475
546 Ga0075429_100010194
547 Ga0075429_100011911
548 Ga0075429_100154556
549 Ga0075429_100384946
550 Ga0075429_100440900
551 Ga0075429_100592004
552 Ga0075436_100000699
553 Ga0075436_100022732
554 Ga0097620_100016362
555 Ga0097620_100714588
556 Ga0075435_100000217
557 Ga0075435_100001420
558 Ga0075435_100032558
559 Ga0075435_100037789
560 Ga0075435_100129961
561 Ga0075435_100198992
562 Ga0099794_10003620
563 Ga0099794_10006451
564 Ga0111539_10000463
565 Ga0111539_10003456
566 Ga0111539_10013779
567 Ga0111539_10017755
568 Ga0111539_10072921
569 Ga0111539_10823892
570 Ga0105245_10280633
571 Ga0114129_10000110
572 Ga0114129_10000936
573 Ga0114129_10002179
574 Ga0114129_10002546
575 Ga0114129_10003145
576 Ga0114129_10027194
577 Ga0114129_10029862
578 Ga0114129_10032488
579 Ga0114129_10033339
580 Ga0114129_10038131
581 Ga0114129_10047070
582 Ga0114129_10095654
583 Ga0114129_10173302
584 Ga0114129_10175954
585 Ga0114129_10206181
586 Ga0114129_10291234
587 Ga0114129_10448928
588 Ga0114129_10461438
589 Ga0114129_10492281
590 Ga0114129_10607968
591 Ga0114129_10809746
592 Ga0114129_11044651
593 Ga0105243_10012018
594 Ga0105243_10538217
595 Ga0105241_10024191
596 Ga0105241_10083353
597 Ga0105242_10022494
598 Ga0105248_10237799
599 Ga0105249_10199662
600 Ga0157378_10153323
601 Ga0157372_10676115
602 Ga0207653_10003704
603 Ga0207643_10005762
604 Ga0207684_10000279
605 Ga0207684_10023853
606 Ga0207684_10050509
607 Ga0207684_10086919
608 Ga0207684_10529644
609 Ga0207654_10044726
610 Ga0207693_10019144
611 Ga0207660_10029603
612 Ga0207646_10001682
613 Ga0207646_10009939
614 Ga0207646_10035285
615 Ga0207646_10062259
616 Ga0207646_10076844
617 Ga0207646_10457527
618 Ga0207681_10122255
619 Ga0207681_10332143
620 Ga0207706_10028302
621 Ga0207706_10135435
622 Ga0207686_10035470
623 Ga0207691_10025783
624 Ga0207711_10547892
625 Ga0207689_10012380
626 Ga0207712_10071684
627 Ga0207708_10009082
628 Ga0207708_10247951
629 Ga0207641_10127058
630 Ga0207648_10043683
631 Ga0207648_10180798
632 Ga0207674_10007378
633 Ga0207675_100210034
634 Ga0209588_1005305
635 Ga0209971_1050061
636 Ga0209974_10054883
637 Ga0207428_10000027
638 Ga0207428_10000245
639 Ga0207428_10004270
640 Ga0207428_10223168
641 Ga0268265_10200807
642 Ga0307408_100013298
643 Ga0307408_100033085
644 Ga0307408_100448808
645 Ga0307410_10107161
646 Ga0307406_10168106
647 Ga0307407_10053681
648 Ga0307409_100138199
649 Ga0307416_100006419
650 Ga0307416_100382415
651 Ga0307411_10007782
652 Ga0307411_10185663
653 Ga0373948_0028769
654 Ga0373928_0029149
655 Ga0373940_0001302
656 Ga0373940_0018349
657 Ga0373949_0048144
658 Ga0373939_0052657
659 Ga0395899_0104468
660 Ga0395900_0002273
661 Ga0395900_0069382
662 Ga0395898_0002914
663 Ga0395905_0093009
664 Ga0395901_0003758
665 Ga0439441_010156
666 Ga0439435_0055741
667 Ga0439460_0019694
668 Ga0451577_0007999
669 Ga0451577_0060640
670 Ga0451577_0159885
671 Ga0451577_0248069
672 Ga0453683_0007766
673 Ga0453683_0131910
674 Ga0453684_0012894
675 Ga0453684_0377402
676 Ga0451576_0036148
677 Ga0451576_0161254
678 Ga0451576_0597146
679 Ga0451576_0862661
680 Ga0495603_0030970
681 Ga0495580_0000727
682 Ga0495594_0130143
683 Ga0495642_0059358
684 Ga0495642_0084314
685 Ga0495659_0044605
686 Ga0495659_0092185
687 Ga0495669_0029667
688 Ga0496102_0020355
689 Ga0496106_0115725
690 Ga0496106_0358639
691 Ga0501031_0205000
692 Ga0501036_0064969
693 Ga0501036_0155917
694 Ga0501036_0280253
695 Ga0501037_0543056
696 Ga0501038_0018640
697 Ga0501038_0397338
698 Ga0501039_0046889
699 Ga0501039_0137413
700 Ga0501039_0185985
701 Ga0501039_0458666
702 Ga0501040_0010590
703 Ga0501040_0010672
704 Ga0501040_0034408
705 Ga0501040_0269278
706 Ga0501040_0448885
707 Ga0501040_0456865
708 Ga0501041_0020199
709 Ga0501042_0347447
710 Ga0501046_0147767
711 Ga0501048_0014424
712 Ga0501048_0137972
713 Ga0501067_0005543
714 Ga0501068_0019031
715 Ga0501068_0076711
716 Ga0501068_0221546
717 Ga0501069_0017117
718 Ga0501071_0058325
719 Ga0501071_0180400
720 Ga0501072_0006731
721 Ga0501072_0009215
722 Ga0501072_0009417
723 Ga0501072_0161559
724 Ga0501072_0435961
725 Ga0501074_0050212
726 Ga0501075_0011883
727 Ga0501075_0015688
728 Ga0501075_0068125
729 Ga0501075_0077435
730 Ga0501075_0105277
731 Ga0501075_0152431
732 Ga0501075_0167391
733 Ga0501075_0283540
734 Ga0501075_0501398
735 Ga0501076_0004607
736 Ga0501076_0036278
737 Ga0501076_0036703
738 Ga0501076_0041959
739 Ga0501076_0047676
740 Ga0501076_0407042
741 Ga0501076_0456851
742 Ga0501076_0549770
743 Ga0501077_0001634
744 Ga0501077_0022406
745 Ga0501077_0049898
746 Ga0501077_0078221
747 Ga0501077_0117781
748 Ga0501077_0135042
749 Ga0501079_0003482
750 Ga0501079_0006853
751 Ga0501079_0029330
752 Ga0501079_0683397
753 Ga0501080_0030460
754 Ga0501080_0282060
755 Ga0501081_0009611
756 Ga0501081_0013069
757 Ga0501081_0042442
758 Ga0501081_0179386
759 Ga0501081_0197776
760 Ga0501035_0220131
761 Ga0501035_0554515
762 Ga0501045_0009788
763 Ga0501045_0121879
764 nmdc:mga05p37_10163_c1
765 nmdc:mga05p37_106625_c1
766 nmdc:mga05p37_149435_c1
767 nmdc:mga05p37_1590_c1
768 nmdc:mga05p37_16413_c1
769 nmdc:mga05p37_178231_c1
770 nmdc:mga05p37_184760_c1
771 nmdc:mga05p37_18972_c1
772 nmdc:mga05p37_198750_c1
773 nmdc:mga05p37_237874_c1
774 nmdc:mga05p37_26803_c1
775 nmdc:mga05p37_358133_c1
776 nmdc:mga05p37_4364_c1
777 nmdc:mga05p37_769_c1
778 nmdc:mga05p37_807516_c1
779 nmdc:mga05p37_9582_c1
780 nmdc:mga09592_147572_c1
781 nmdc:mga09592_148463_c1
782 nmdc:mga09592_1895_c1
783 nmdc:mga09592_204225_c1
784 nmdc:mga09592_276066_c1
785 nmdc:mga09592_364837_c1
786 nmdc:mga09592_3897_c1
787 nmdc:mga09592_458238_c1
788 nmdc:mga09592_469927_c1
789 nmdc:mga09592_570251_c1
790 nmdc:mga09592_7315_c1
791 nmdc:mga09592_79286_c1
792 nmdc:mga09592_97300_c1
793 nmdc:mga0qj67_140_c1
794 nmdc:mga0qj67_211852_c1
795 nmdc:mga0qj67_3069_c1
796 nmdc:mga0qj67_3096_c1
797 nmdc:mga0qj67_82754_c1
798 nmdc:mga06r32_10905_c1
799 nmdc:mga06r32_125345_c2
800 nmdc:mga06r32_150003_c1
801 nmdc:mga06r32_1729_c1
802 nmdc:mga06r32_18821_c1
803 nmdc:mga06r32_227148_c1
804 nmdc:mga06r32_23665_c1
805 nmdc:mga06r32_2388_c1
806 nmdc:mga06r32_5417_c1
807 nmdc:mga06r32_547948_c1
808 nmdc:mga06r32_680485_c1
809 nmdc:mga06r32_9659_c1
810 nmdc:mga08y16_1000414_c1
811 nmdc:mga08y16_10911_c1
812 nmdc:mga08y16_109808_c1
813 nmdc:mga08y16_110750_c1
814 nmdc:mga08y16_597_c1
815 nmdc:mga08y16_724075_c1
816 nmdc:mga08y16_8315_c1
817 nmdc:mga0n895_10186_c1
818 nmdc:mga0n895_163419_c1
819 nmdc:mga0n895_21057_c1
820 nmdc:mga0n895_25174_c1
821 nmdc:mga0n895_253704_c1
822 nmdc:mga0n895_6022_c1
823 nmdc:mga0n895_74199_c1
824 nmdc:mga0n895_9783_c1
825 nmdc:mga0rr50_27131_c1
826 nmdc:mga0rr50_2794_c1
827 nmdc:mga0rr50_50611_c1
828 nmdc:mga0rr50_640_c1
829 nmdc:mga0rr50_7126_c1
830 nmdc:mga08x19_119974_c1
831 nmdc:mga08x19_19282_c1
832 nmdc:mga08x19_42300_c1
833 nmdc:mga0a205_200429_c1
834 nmdc:mga0a205_289_c1
835 nmdc:mga0a205_363387_c1
836 nmdc:mga0a205_385200_c1
837 nmdc:mga0a205_46448_c1
838 nmdc:mga0a205_4793_c2
839 nmdc:mga0a205_58006_c1
840 nmdc:mga0a205_72166_c1
841 Ga0501084_0013003
842 Ga0501084_0022249
843 Ga0501084_0342380
844 Ga0501084_0520057
845 Ga0501082_0113657
846 Ga0501082_0118077
847 Ga0501082_0137832
848 Ga0501082_0307775
849 Ga0530510_0010979
850 Ga0530510_0021986
851 Ga0530510_0027463
852 Ga0530510_0121817
853 Ga0530510_0208243
854 Ga0530510_0229660
855 Ga0530510_0423742
856 Ga0530510_0515958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

4

147

0.98

PF00121

TIM

Triosephosphate isomerase

144

222

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9512 1 250
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9497 2 249
1tmh-assembly2.cif.gz_D modular mutagenesis of a tim-barrel enzyme: the crystal structure of a chimeric e. coli tim having the eighth (beta-alpha)-unit replaced by the equivalent unit of chicken tim 0.9452 1 253
4x22-assembly1.cif.gz_A-2 crystal structure of leptospira interrogans triosephosphate isomerase (litim) 0.9451 2 246
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9439 1 250
ID Description Score Start End Superfamily
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9523 41 249 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9512 1 250 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9482 1 253 3.20.20.70
4x22A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9451 2 246 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9439 1 250 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V9CT98-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9793 82 248 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7C2TN94-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9793 95 248 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A351UNB1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9788 87 247 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A359IJH2-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9762 78 248 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A800JAV4-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.976 83 250 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map