F441459

General Info

Members Datasets Scaffolds Average Seq Length
427 245 854 132

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10051324|Ga0207699_100513242
Length 145
Sequence VARPLLSHGKHSKHEPGVRENVREKSHGKLRDKHSPQSHEEVHAHAHELPELDRLIHERIRLGIVSALATNDSLSFNDLKRVLKTTDGNLSVHARKLEEAQYISCVKFFEGRVPRTEYRLTATGRRALSEYLDQMEEWIRVTREE

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
238 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.68
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 18.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10051324 3300025906 Bacteria 2437
2 LJNas_1002125 3300000546 Bacteria 2489
3 rootH1_10035583 3300003316 Bacteria 6187
4 Ga0065712_10165446 3300005290 Bacteria 1265
5 Ga0070658_10006538 3300005327 Bacteria 9456
6 Ga0070683_100016038 3300005329 Bacteria 6594
7 Ga0070683_100040740 3300005329 Bacteria 4271
8 Ga0070683_100048908 3300005329 Bacteria 3909
9 Ga0070690_100087345 3300005330 Bacteria 2048
10 Ga0070670_100168855 3300005331 Bacteria 1897
11 Ga0070670_100433614 3300005331 Bacteria 1163
12 Ga0070682_101397485 3300005337 Unclassified 598
13 Ga0068868_100172083 3300005338 Bacteria 1793
14 Ga0068868_100880606 3300005338 Bacteria 812
15 Ga0070660_101290828 3300005339 Unclassified 619
16 Ga0070689_100133938 3300005340 Bacteria 1989
17 Ga0070687_100000918 3300005343 Bacteria 9938
18 Ga0070687_100210367 3300005343 Bacteria 1184
19 Ga0070687_101288521 3300005343 Unclassified 542
20 Ga0070661_100241005 3300005344 Bacteria 1392
21 Ga0070661_100251681 3300005344 Bacteria 1363
22 Ga0070692_10330896 3300005345 Bacteria 940
23 Ga0070668_100156326 3300005347 Bacteria 1847
24 Ga0070669_100001494 3300005353 Bacteria 16898
25 Ga0070675_100006766 3300005354 Bacteria 8809
26 Ga0070671_100008987 3300005355 Bacteria 8018
27 Ga0070673_100103772 3300005364 Bacteria 2346
28 Ga0070673_100795130 3300005364 Unclassified 873
29 Ga0070688_100014146 3300005365 Bacteria 4516
30 Ga0070667_100164186 3300005367 Bacteria 1958
31 Ga0070667_100333174 3300005367 Bacteria 1371
32 Ga0070667_100372157 3300005367 Bacteria 1296
33 Ga0070709_10029630 3300005434 Bacteria 3276
34 Ga0070709_10032173 3300005434 Unclassified 3161
35 Ga0070709_10091185 3300005434 Bacteria 2011
36 Ga0070709_10647200 3300005434 Bacteria 818
37 Ga0070709_10764422 3300005434 Unclassified 756
38 Ga0070709_11603885 3300005434 Unclassified 530
39 Ga0070714_100024575 3300005435 Bacteria 4964
40 Ga0070714_100029382 3300005435 Bacteria 4570
41 Ga0070714_100059341 3300005435 Bacteria 3280
42 Ga0070714_100404740 3300005435 Unclassified 1290
43 Ga0070713_100000173 3300005436 Bacteria 43094
44 Ga0070713_100010054 3300005436 Bacteria 6821
45 Ga0070713_100103936 3300005436 Unclassified 2465
46 Ga0070713_100193866 3300005436 Unclassified 1832
47 Ga0070713_101373186 3300005436 Bacteria 685
48 Ga0070710_10095722 3300005437 Bacteria 1759
49 Ga0070710_10170427 3300005437 Bacteria 1356
50 Ga0070710_10578013 3300005437 Bacteria 779
51 Ga0070710_11235948 3300005437 Unclassified 553
52 Ga0070711_100003219 3300005439 Bacteria 9478
53 Ga0070711_100341250 3300005439 Bacteria 1202
54 Ga0070711_100374773 3300005439 Viruses 1149
55 Ga0070705_100270847 3300005440 Bacteria 1202
56 Ga0070708_100002159 3300005445 Bacteria 15186
57 Ga0070708_100025138 3300005445 Bacteria 5089
58 Ga0070708_100083313 3300005445 Bacteria 2899
59 Ga0070708_100222153 3300005445 Unclassified 1772
60 Ga0070663_101066610 3300005455 Bacteria 705
61 Ga0070678_100129158 3300005456 Bacteria 2005
62 Ga0070662_101009328 3300005457 Bacteria 712
63 Ga0070681_10031124 3300005458 Bacteria 5356
64 Ga0068867_100177177 3300005459 Bacteria 1693
65 Ga0068867_100506117 3300005459 Bacteria 1039
66 Ga0070685_10005573 3300005466 Bacteria 6389
67 Ga0070685_10657559 3300005466 Bacteria 760
68 Ga0070706_100004080 3300005467 Bacteria 14201
69 Ga0070706_100619052 3300005467 Bacteria 1005
70 Ga0070706_100636735 3300005467 Bacteria 990
71 Ga0070707_100133661 3300005468 Bacteria 2413
72 Ga0070707_100272601 3300005468 Bacteria 1645
73 Ga0070707_100314222 3300005468 Bacteria 1523
74 Ga0070707_100835751 3300005468 Bacteria 885
75 Ga0070698_100008946 3300005471 Bacteria 10774
76 Ga0070699_100036277 3300005518 Bacteria 4265
77 Ga0070699_100793995 3300005518 Bacteria 866
78 Ga0070699_101552646 3300005518 Bacteria 607
79 Ga0070679_100246084 3300005530 Unclassified 1745
80 Ga0070679_100562547 3300005530 Bacteria 1084
81 Ga0070679_101070465 3300005530 Unclassified 751
82 Ga0070684_100002811 3300005535 Bacteria 12914
83 Ga0070684_100005306 3300005535 Bacteria 9865
84 Ga0070697_100000114 3300005536 Bacteria 63225
85 Ga0068853_100149197 3300005539 Bacteria 2104
86 Ga0070672_100017716 3300005543 Bacteria 5132
87 Ga0070672_100080117 3300005543 Bacteria 2615
88 Ga0070696_100085773 3300005546 Unclassified 2235
89 Ga0070696_100193041 3300005546 Bacteria 1516
90 Ga0070664_100007662 3300005564 Bacteria 8721
91 Ga0070664_100017213 3300005564 Bacteria 5935
92 Ga0070664_100499210 3300005564 Bacteria 1121
93 Ga0070664_101008721 3300005564 Bacteria 782
94 Ga0068857_100053533 3300005577 Bacteria 3580
95 Ga0068856_100025859 3300005614 Bacteria 5724
96 Ga0070702_100242480 3300005615 Bacteria 1217
97 Ga0070702_100264094 3300005615 Bacteria 1173
98 Ga0068852_100474195 3300005616 Bacteria 1242
99 Ga0068852_100634189 3300005616 Bacteria 1075
100 Ga0068852_101609817 3300005616 Unclassified 672
101 Ga0068859_100006570 3300005617 Bacteria 11800
102 Ga0068864_100523745 3300005618 Bacteria 1143
103 Ga0068861_101432678 3300005719 Bacteria 676
104 Ga0068870_10159654 3300005840 Bacteria 1336
105 Ga0068858_100296380 3300005842 Unclassified 1542
106 Ga0068860_100166568 3300005843 Bacteria 2128
107 Ga0070717_10001348 3300006028 Bacteria 16882
108 Ga0070717_10151840 3300006028 Bacteria 2004
109 Ga0070717_10223795 3300006028 Unclassified 1654
110 Ga0070717_10256356 3300006028 Bacteria 1547
111 Ga0070717_10294025 3300006028 Unclassified 1443
112 Ga0070717_10551268 3300006028 Archaea 1044
113 Ga0070717_10840863 3300006028 Bacteria 835
114 Ga0070717_11210435 3300006028 Unclassified 687
115 Ga0070717_11822027 3300006028 Unclassified 550
116 Ga0070715_10007753 3300006163 Bacteria 3708
117 Ga0070715_10244293 3300006163 Bacteria 935
118 Ga0070716_100028427 3300006173 Bacteria 3012
119 Ga0070716_100136320 3300006173 Bacteria 1559
120 Ga0070712_100000179 3300006175 Bacteria 35191
121 Ga0070712_100006336 3300006175 Bacteria 7336
122 Ga0070712_100041383 3300006175 Unclassified 3164
123 Ga0070712_100943635 3300006175 Bacteria 745
124 Ga0097621_100407805 3300006237 Bacteria 1218
125 Ga0075430_100560718 3300006846 Unclassified 942
126 Ga0075430_100768289 3300006846 Unclassified 794
127 Ga0075431_100150551 3300006847 Bacteria 2396
128 Ga0068865_100504624 3300006881 Bacteria 1009
129 Ga0075436_100949810 3300006914 Bacteria 644
130 Ga0097620_100006570 3300006931 Bacteria 11800
131 Ga0099795_10104130 3300007788 Unclassified 1117
132 Ga0105240_10034876 3300009093 Bacteria 6487
133 Ga0111539_10050820 3300009094 Bacteria 4939
134 Ga0111539_10154759 3300009094 Bacteria 2683
135 Ga0105247_10205037 3300009101 Bacteria 1327
136 Ga0105247_11025082 3300009101 Unclassified 646
137 Ga0114129_10489411 3300009147 Bacteria 1608
138 Ga0114129_10850054 3300009147 Bacteria 1160
139 Ga0105243_10147072 3300009148 Bacteria 2017
140 Ga0105243_11120581 3300009148 Bacteria 796
141 Ga0105241_10212855 3300009174 Bacteria 1620
142 Ga0105242_10114851 3300009176 Bacteria 2301
143 Ga0105248_10273176 3300009177 Bacteria 1903
144 Ga0105248_11330462 3300009177 Bacteria 813
145 Ga0105238_10226282 3300009551 Bacteria 1847
146 Ga0105238_11143517 3300009551 Bacteria 802
147 Ga0105249_13299285 3300009553 Unclassified 519
148 Ga0099796_10103321 3300010159 Bacteria 1075
149 Ga0105239_12931339 3300010375 Bacteria 556
150 Ga0105246_10330036 3300011119 Bacteria 1243
151 Ga0157373_10784719 3300013100 Unclassified 702
152 Ga0157371_10158382 3300013102 Bacteria 1617
153 Ga0157370_10531698 3300013104 Bacteria 1078
154 Ga0157369_11744435 3300013105 Unclassified 632
155 Ga0157374_10785254 3300013296 Bacteria 968
156 Ga0157374_11315914 3300013296 Bacteria 745
157 Ga0163162_10260972 3300013306 Bacteria 1864
158 Ga0157372_10020799 3300013307 Bacteria 7086
159 Ga0157372_10720872 3300013307 Bacteria 1160
160 Ga0157375_10423152 3300013308 Bacteria 1498
161 Ga0157375_11526856 3300013308 Bacteria 789
162 Ga0163163_10077143 3300014325 Bacteria 3328
163 Ga0182007_10244760 3300015262 Unclassified 641
164 Ga0182005_1109567 3300015265 Unclassified 779
165 Ga0163161_10085387 3300017792 Bacteria 2328
166 Ga0224572_1038880 3300024225 Bacteria 898
167 Ga0228598_1003575 3300024227 Bacteria 3340
168 Ga0228598_1006536 3300024227 Bacteria 2411
169 Ga0228598_1008107 3300024227 Unclassified 2129
170 Ga0207682_10010831 3300025893 Bacteria 3570
171 Ga0207692_10147562 3300025898 Bacteria 1344
172 Ga0207692_10169139 3300025898 Bacteria 1265
173 Ga0207692_10423636 3300025898 Bacteria 834
174 Ga0207642_10053154 3300025899 Bacteria 1842
175 Ga0207642_10146924 3300025899 Bacteria 1250
176 Ga0207710_10371254 3300025900 Unclassified 731
177 Ga0207688_10052083 3300025901 Bacteria 2293
178 Ga0207685_10018708 3300025905 Bacteria 2267
179 Ga0207685_10240442 3300025905 Bacteria 871
180 Ga0207699_10000548 3300025906 Bacteria 18511
181 Ga0207699_10161995 3300025906 Unclassified 1490
182 Ga0207699_10337609 3300025906 Bacteria 1061
183 Ga0207645_10038303 3300025907 Bacteria 3075
184 Ga0207645_10280638 3300025907 Bacteria 1106
185 Ga0207643_10005363 3300025908 Bacteria 6862
186 Ga0207705_10037757 3300025909 Bacteria 3456
187 Ga0207684_10000526 3300025910 Bacteria 47353
188 Ga0207684_10082399 3300025910 Bacteria 2740
189 Ga0207707_10116085 3300025912 Unclassified 2339
190 Ga0207693_10000042 3300025915 Bacteria 104665
191 Ga0207693_10000547 3300025915 Bacteria 34011
192 Ga0207693_10005411 3300025915 Bacteria 10664
193 Ga0207693_10075067 3300025915 Unclassified 2647
194 Ga0207662_10002146 3300025918 Bacteria 9821
195 Ga0207662_10006122 3300025918 Bacteria 6470
196 Ga0207657_10067128 3300025919 Bacteria 3051
197 Ga0207649_10105600 3300025920 Bacteria 1872
198 Ga0207649_10353392 3300025920 Bacteria 1088
199 Ga0207652_10304213 3300025921 Unclassified 1439
200 Ga0207646_10191086 3300025922 Unclassified 1849
201 Ga0207646_10218552 3300025922 Bacteria 1721
202 Ga0207646_10329141 3300025922 Bacteria 1380
203 Ga0207681_10003457 3300025923 Bacteria 9845
204 Ga0207694_10188736 3300025924 Bacteria 1674
205 Ga0207659_10001351 3300025926 Bacteria 14635
206 Ga0207659_10807770 3300025926 Bacteria 806
207 Ga0207659_10890237 3300025926 Bacteria 765
208 Ga0207687_10249629 3300025927 Bacteria 1410
209 Ga0207700_10007596 3300025928 Bacteria 6646
210 Ga0207700_10071466 3300025928 Bacteria 2672
211 Ga0207700_10117299 3300025928 Viruses 2152
212 Ga0207700_10432265 3300025928 Bacteria 1158
213 Ga0207700_11414218 3300025928 Unclassified 618
214 Ga0207700_11569830 3300025928 Unclassified 583
215 Ga0207664_10001072 3300025929 Bacteria 18242
216 Ga0207664_10019079 3300025929 Bacteria 5062
217 Ga0207664_10043216 3300025929 Bacteria 3523
218 Ga0207644_10091782 3300025931 Bacteria 2265
219 Ga0207644_10195866 3300025931 Unclassified 1591
220 Ga0207644_10648219 3300025931 Bacteria 879
221 Ga0207690_10053429 3300025932 Bacteria 2711
222 Ga0207690_10263274 3300025932 Bacteria 1337
223 Ga0207706_10000293 3300025933 Bacteria 54228
224 Ga0207706_10393551 3300025933 Bacteria 1202
225 Ga0207686_10036839 3300025934 Bacteria 2948
226 Ga0207670_10059483 3300025936 Bacteria 2599
227 Ga0207665_10081519 3300025939 Bacteria 2228
228 Ga0207665_10171260 3300025939 Unclassified 1568
229 Ga0207691_10141603 3300025940 Bacteria 2119
230 Ga0207691_10170015 3300025940 Bacteria 1909
231 Ga0207691_10783081 3300025940 Bacteria 802
232 Ga0207711_10098491 3300025941 Bacteria 2583
233 Ga0207711_10402363 3300025941 Bacteria 1272
234 Ga0207661_10010956 3300025944 Bacteria 6547
235 Ga0207661_10021275 3300025944 Bacteria 4859
236 Ga0207661_10089877 3300025944 Bacteria 2556
237 Ga0207679_10038185 3300025945 Bacteria 3420
238 Ga0207679_10124673 3300025945 Bacteria 2057
239 Ga0207679_10151831 3300025945 Bacteria 1886
240 Ga0207679_10433361 3300025945 Bacteria 1163
241 Ga0207679_11055960 3300025945 Bacteria 745
242 Ga0207651_10036531 3300025960 Bacteria 3208
243 Ga0207651_10196926 3300025960 Bacteria 1611
244 Ga0207651_10732799 3300025960 Bacteria 873
245 Ga0207712_10926661 3300025961 Unclassified 771
246 Ga0207668_10184000 3300025972 Bacteria 1650
247 Ga0207658_10126858 3300025986 Bacteria 2044
248 Ga0207658_10247559 3300025986 Bacteria 1513
249 Ga0207658_10907312 3300025986 Bacteria 802
250 Ga0207677_11201355 3300026023 Bacteria 694
251 Ga0207677_11659641 3300026023 Unclassified 592
252 Ga0207703_10127163 3300026035 Bacteria 2196
253 Ga0207703_10177014 3300026035 Bacteria 1880
254 Ga0207678_10260760 3300026067 Bacteria 1485
255 Ga0207678_10806701 3300026067 Bacteria 829
256 Ga0207678_11902970 3300026067 Unclassified 519
257 Ga0207702_10004422 3300026078 Bacteria 12494
258 Ga0207702_10168803 3300026078 Unclassified 2004
259 Ga0207641_10515024 3300026088 Bacteria 1163
260 Ga0207648_10092338 3300026089 Bacteria 2647
261 Ga0207676_10200427 3300026095 Bacteria 1763
262 Ga0207676_10318965 3300026095 Bacteria 1426
263 Ga0207674_10007116 3300026116 Bacteria 13071
264 Ga0207674_10016099 3300026116 Bacteria 8191
265 Ga0207675_101837117 3300026118 Bacteria 625
266 Ga0207683_10150001 3300026121 Bacteria 2104
267 Ga0207683_10418140 3300026121 Bacteria 1234
268 Ga0207698_10458784 3300026142 Bacteria 1232
269 Ga0207428_10262332 3300027907 Bacteria 1286
270 Ga0207428_10887015 3300027907 Bacteria 631
271 Ga0265356_1000089 3300028017 Bacteria 15437
272 Ga0268265_10075333 3300028380 Bacteria 2643
273 Ga0268264_10142504 3300028381 Bacteria 2139
274 Ga0268264_10707531 3300028381 Bacteria 1001
275 Ga0265336_10171703 3300028666 Unclassified 645
276 Ga0265338_10020485 3300028800 Bacteria 6953
277 Ga0265338_10064208 3300028800 Unclassified 3195
278 Ga0265338_10129949 3300028800 Bacteria 1991
279 Ga0265338_10251760 3300028800 Bacteria 1303
280 Ga0265762_1002741 3300030760 Bacteria 3153
281 Ga0265762_1012831 3300030760 Bacteria 1506
282 Ga0265770_1074063 3300030878 Bacteria 655
283 Ga0265760_10000657 3300031090 Bacteria 9832
284 Ga0265325_10299688 3300031241 Unclassified 718
285 Ga0265339_10030719 3300031249 Bacteria 3041
286 Ga0265339_10137619 3300031249 Unclassified 1244
287 Ga0265327_10036423 3300031251 Bacteria 2704
288 Ga0307408_100057289 3300031548 Bacteria 2828
289 Ga0307408_100159081 3300031548 Bacteria 1792
290 Ga0307408_100354461 3300031548 Bacteria 1246
291 Ga0265314_10038271 3300031711 Unclassified 3468
292 Ga0265314_10072009 3300031711 Bacteria 2310
293 Ga0265342_10006400 3300031712 Bacteria 8775
294 Ga0307405_10004736 3300031731 Bacteria 6476
295 Ga0307405_10008763 3300031731 Bacteria 5147
296 Ga0307405_10897338 3300031731 Bacteria 749
297 Ga0307405_12114741 3300031731 Bacteria 505
298 Ga0307413_10092072 3300031824 Bacteria 1977
299 Ga0307410_10028229 3300031852 Bacteria 3556
300 Ga0307410_10268996 3300031852 Bacteria 1332
301 Ga0307410_10888070 3300031852 Bacteria 763
302 Ga0307406_10000770 3300031901 Bacteria 17971
303 Ga0307406_10047378 3300031901 Bacteria 2709
304 Ga0307406_10258240 3300031901 Bacteria 1316
305 Ga0307406_10475699 3300031901 Bacteria 1008
306 Ga0307407_10006151 3300031903 Bacteria 5301
307 Ga0307407_10174919 3300031903 Bacteria 1417
308 Ga0307412_10005146 3300031911 Bacteria 7323
309 Ga0307409_100217721 3300031995 Bacteria 1721
310 Ga0307409_100265864 3300031995 Bacteria 1577
311 Ga0307409_102440429 3300031995 Bacteria 552
312 Ga0307416_100014214 3300032002 Bacteria 5443
313 Ga0307416_100342684 3300032002 Bacteria 1508
314 Ga0307414_10075611 3300032004 Bacteria 2444
315 Ga0307411_10024686 3300032005 Bacteria 3587
316 Ga0307411_10113377 3300032005 Bacteria 1945
317 Ga0307415_100076329 3300032126 Bacteria 2375
318 Ga0307415_100927755 3300032126 Bacteria 804
319 Ga0316214_1003504 3300033545 Unclassified 1981
320 Ga0373934_0072079 3300035086 Bacteria 1383
321 Ga0373934_0080682 3300035086 Bacteria 1307
322 Ga0373944_0081540 3300035089 Bacteria 1069
323 Ga0373923_0027506 3300035111 Bacteria 2269
324 Ga0373923_0147795 3300035111 Bacteria 1066
325 Ga0373936_0000265 3300035113 Bacteria 17255
326 Ga0373945_0001056 3300035116 Bacteria 8267
327 Ga0373956_0132679 3300035119 Bacteria 1167
328 Ga0373960_0362622 3300035121 Unclassified 552
329 Ga0373943_0000052 3300035170 Bacteria 40212
330 Ga0373943_0087664 3300035170 Unclassified 1607
331 Ga0373946_0002077 3300035171 Bacteria 7032
332 Ga0373924_0278018 3300035410 Bacteria 742
333 Ga0373924_0313464 3300035410 Unclassified 697
334 Ga0373935_0000198 3300035692 Bacteria 28616
335 Ga0373935_0396899 3300035692 Bacteria 990
336 Ga0373935_1487324 3300035692 Bacteria 507
337 Ga0373927_0000016 3300035695 Bacteria 154151
338 Ga0373927_0491720 3300035695 Unclassified 811
339 Ga0373933_0199840 3300035724 Bacteria 1279
340 Ga0373933_0306503 3300035724 Bacteria 1029
341 Ga0373947_0000042 3300035725 Bacteria 62180
342 Ga0373947_0107423 3300035725 Unclassified 1760
343 Ga0373947_0369530 3300035725 Unclassified 964
344 Ga0373937_0153159 3300036401 Bacteria 2160
345 Ga0373937_0217873 3300036401 Bacteria 1796
346 Ga0373937_0479191 3300036401 Unclassified 1182
347 Ga0373925_0000956 3300037068 Bacteria 26271
348 Ga0373925_0503179 3300037068 Unclassified 995
349 Ga0373925_0538042 3300037068 Bacteria 960
350 Ga0373925_0608057 3300037068 Unclassified 900
351 Ga0395898_0003671 3300037466 Bacteria 17050
352 Ga0395901_0009611 3300038443 Bacteria 9813
353 Ga0395901_1677910 3300038443 Bacteria 587
354 Ga0436365_0105081 3300039437 Bacteria 1529
355 Ga0436365_1432202 3300039437 Bacteria 1328
356 Ga0436360_1092347 3300039438 Unclassified 576
357 Ga0436363_0865516 3300039450 Unclassified 565
358 Ga0439435_0034422 3300042436 Bacteria 1392
359 Ga0453683_0175067 3300044673 Bacteria 1360
360 Ga0466965_0565466 3300044683 Unclassified 643
361 Ga0495603_0371567 3300046455 Unclassified 820
362 Ga0495653_0131635 3300046463 Bacteria 1770
363 Ga0495580_0007410 3300046472 Bacteria 8823
364 Ga0495580_0678243 3300046472 Unclassified 676
365 Ga0495582_0816370 3300046473 Unclassified 539
366 Ga0495664_0105958 3300046477 Bacteria 1695
367 Ga0495608_0237427 3300046511 Bacteria 1140
368 Ga0495630_0037261 3300046517 Bacteria 3636
369 Ga0495630_0372831 3300046517 Unclassified 1093
370 Ga0495652_0530679 3300046529 Bacteria 812
371 Ga0495621_0011872 3300046539 Bacteria 2706
372 Ga0495645_0362050 3300046543 Bacteria 932
373 Ga0495645_0779762 3300046543 Bacteria 575
374 Ga0495599_0666865 3300046678 Bacteria 602
375 Ga0495623_0190542 3300046679 Bacteria 1185
376 Ga0495624_0095803 3300046690 Bacteria 1829
377 Ga0495674_0012319 3300047319 Bacteria 8056
378 Ga0495685_028183 3300047447 Bacteria 1932
379 Ga0495602_0222892 3300048088 Bacteria 1422
380 Ga0495602_0331911 3300048088 Bacteria 1103
381 Ga0495602_0578598 3300048088 Bacteria 775
382 Ga0495614_0484083 3300048089 Unclassified 588
383 Ga0496100_0150158 3300048903 Bacteria 1661
384 Ga0496100_0209058 3300048903 Bacteria 1426
385 Ga0496101_0667394 3300048904 Bacteria 821
386 Ga0496104_0042141 3300048907 Bacteria 4283
387 Ga0496104_0322281 3300048907 Bacteria 1458
388 Ga0496104_1077311 3300048907 Bacteria 707
389 Ga0496105_0124422 3300048908 Bacteria 2126
390 Ga0496105_0132436 3300048908 Bacteria 2055
391 Ga0496106_0395199 3300048909 Bacteria 1111
392 Ga0496107_0413301 3300048910 Bacteria 1003
393 Ga0496108_0220651 3300048911 Unclassified 1647
394 Ga0496108_0270754 3300048911 Bacteria 1478
395 Ga0496109_0271807 3300048912 Bacteria 1597
396 Ga0496109_1238182 3300048912 Bacteria 683
397 Ga0496111_0080561 3300048914 Bacteria 2376
398 Ga0496112_0007742 3300048915 Bacteria 9557
399 Ga0496113_0080889 3300048916 Bacteria 2489
400 Ga0496114_0207858 3300048917 Bacteria 1716
401 Ga0496114_0449678 3300048917 Viruses 1141
402 Ga0496115_0008922 3300048918 Bacteria 7436
403 Ga0501300_053315 3300049523 Bacteria 628
404 Ga0501034_0447108 3300049571 Bacteria 1210
405 Ga0501069_0577034 3300049585 Bacteria 674
406 Ga0501070_0354894 3300049586 Unclassified 1190
407 Ga0501073_0547204 3300049589 Bacteria 800
408 Ga0501075_0817078 3300049591 Bacteria 709
409 Ga0501076_0097139 3300049592 Bacteria 2373
410 Ga0501223_024076 3300049663 Bacteria 1186
411 Ga0501228_070007 3300049666 Bacteria 511
412 Ga0501225_0043082 3300049705 Bacteria 1247
413 Ga0501079_0190995 3300049741 Bacteria 1598
414 Ga0501080_0315509 3300049742 Unclassified 1416
415 Ga0501081_0778125 3300049743 Bacteria 720
416 Ga0501268_111628 3300049765 Unclassified 597
417 Ga0501212_072452 3300049851 Bacteria 612
418 nmdc:mga05p37_1063196_c1 3300050507 Bacteria 852
419 nmdc:mga05p37_509064_c1 3300050507 Unclassified 1380
420 nmdc:mga0qj67_1152685_c1 3300050509 Unclassified 604
421 nmdc:mga0qj67_438798_c1 3300050509 Unclassified 1052
422 nmdc:mga08y16_150030_c1 3300050511 Bacteria 2423
423 nmdc:mga08y16_211370_c1 3300050511 Bacteria 2009
424 nmdc:mga0rr50_236366_c1 3300050513 Bacteria 1513
425 nmdc:mga08x19_942042_c1 3300050514 Unclassified 613
426 Ga0501084_0180698 3300054114 Bacteria 1781
427 Ga0587111_0089222 3300060346 Unclassified 750
428 Ga0207699_10051324
429 LJNas_1002125
430 rootH1_10035583
431 Ga0065712_10165446
432 Ga0070658_10006538
433 Ga0070683_100016038
434 Ga0070683_100040740
435 Ga0070683_100048908
436 Ga0070690_100087345
437 Ga0070670_100168855
438 Ga0070670_100433614
439 Ga0070682_101397485
440 Ga0068868_100172083
441 Ga0068868_100880606
442 Ga0070660_101290828
443 Ga0070689_100133938
444 Ga0070687_100000918
445 Ga0070687_100210367
446 Ga0070687_101288521
447 Ga0070661_100241005
448 Ga0070661_100251681
449 Ga0070692_10330896
450 Ga0070668_100156326
451 Ga0070669_100001494
452 Ga0070675_100006766
453 Ga0070671_100008987
454 Ga0070673_100103772
455 Ga0070673_100795130
456 Ga0070688_100014146
457 Ga0070667_100164186
458 Ga0070667_100333174
459 Ga0070667_100372157
460 Ga0070709_10029630
461 Ga0070709_10032173
462 Ga0070709_10091185
463 Ga0070709_10647200
464 Ga0070709_10764422
465 Ga0070709_11603885
466 Ga0070714_100024575
467 Ga0070714_100029382
468 Ga0070714_100059341
469 Ga0070714_100404740
470 Ga0070713_100000173
471 Ga0070713_100010054
472 Ga0070713_100103936
473 Ga0070713_100193866
474 Ga0070713_101373186
475 Ga0070710_10095722
476 Ga0070710_10170427
477 Ga0070710_10578013
478 Ga0070710_11235948
479 Ga0070711_100003219
480 Ga0070711_100341250
481 Ga0070711_100374773
482 Ga0070705_100270847
483 Ga0070708_100002159
484 Ga0070708_100025138
485 Ga0070708_100083313
486 Ga0070708_100222153
487 Ga0070663_101066610
488 Ga0070678_100129158
489 Ga0070662_101009328
490 Ga0070681_10031124
491 Ga0068867_100177177
492 Ga0068867_100506117
493 Ga0070685_10005573
494 Ga0070685_10657559
495 Ga0070706_100004080
496 Ga0070706_100619052
497 Ga0070706_100636735
498 Ga0070707_100133661
499 Ga0070707_100272601
500 Ga0070707_100314222
501 Ga0070707_100835751
502 Ga0070698_100008946
503 Ga0070699_100036277
504 Ga0070699_100793995
505 Ga0070699_101552646
506 Ga0070679_100246084
507 Ga0070679_100562547
508 Ga0070679_101070465
509 Ga0070684_100002811
510 Ga0070684_100005306
511 Ga0070697_100000114
512 Ga0068853_100149197
513 Ga0070672_100017716
514 Ga0070672_100080117
515 Ga0070696_100085773
516 Ga0070696_100193041
517 Ga0070664_100007662
518 Ga0070664_100017213
519 Ga0070664_100499210
520 Ga0070664_101008721
521 Ga0068857_100053533
522 Ga0068856_100025859
523 Ga0070702_100242480
524 Ga0070702_100264094
525 Ga0068852_100474195
526 Ga0068852_100634189
527 Ga0068852_101609817
528 Ga0068859_100006570
529 Ga0068864_100523745
530 Ga0068861_101432678
531 Ga0068870_10159654
532 Ga0068858_100296380
533 Ga0068860_100166568
534 Ga0070717_10001348
535 Ga0070717_10151840
536 Ga0070717_10223795
537 Ga0070717_10256356
538 Ga0070717_10294025
539 Ga0070717_10551268
540 Ga0070717_10840863
541 Ga0070717_11210435
542 Ga0070717_11822027
543 Ga0070715_10007753
544 Ga0070715_10244293
545 Ga0070716_100028427
546 Ga0070716_100136320
547 Ga0070712_100000179
548 Ga0070712_100006336
549 Ga0070712_100041383
550 Ga0070712_100943635
551 Ga0097621_100407805
552 Ga0075430_100560718
553 Ga0075430_100768289
554 Ga0075431_100150551
555 Ga0068865_100504624
556 Ga0075436_100949810
557 Ga0097620_100006570
558 Ga0099795_10104130
559 Ga0105240_10034876
560 Ga0111539_10050820
561 Ga0111539_10154759
562 Ga0105247_10205037
563 Ga0105247_11025082
564 Ga0114129_10489411
565 Ga0114129_10850054
566 Ga0105243_10147072
567 Ga0105243_11120581
568 Ga0105241_10212855
569 Ga0105242_10114851
570 Ga0105248_10273176
571 Ga0105248_11330462
572 Ga0105238_10226282
573 Ga0105238_11143517
574 Ga0105249_13299285
575 Ga0099796_10103321
576 Ga0105239_12931339
577 Ga0105246_10330036
578 Ga0157373_10784719
579 Ga0157371_10158382
580 Ga0157370_10531698
581 Ga0157369_11744435
582 Ga0157374_10785254
583 Ga0157374_11315914
584 Ga0163162_10260972
585 Ga0157372_10020799
586 Ga0157372_10720872
587 Ga0157375_10423152
588 Ga0157375_11526856
589 Ga0163163_10077143
590 Ga0182007_10244760
591 Ga0182005_1109567
592 Ga0163161_10085387
593 Ga0224572_1038880
594 Ga0228598_1003575
595 Ga0228598_1006536
596 Ga0228598_1008107
597 Ga0207682_10010831
598 Ga0207692_10147562
599 Ga0207692_10169139
600 Ga0207692_10423636
601 Ga0207642_10053154
602 Ga0207642_10146924
603 Ga0207710_10371254
604 Ga0207688_10052083
605 Ga0207685_10018708
606 Ga0207685_10240442
607 Ga0207699_10000548
608 Ga0207699_10161995
609 Ga0207699_10337609
610 Ga0207645_10038303
611 Ga0207645_10280638
612 Ga0207643_10005363
613 Ga0207705_10037757
614 Ga0207684_10000526
615 Ga0207684_10082399
616 Ga0207707_10116085
617 Ga0207693_10000042
618 Ga0207693_10000547
619 Ga0207693_10005411
620 Ga0207693_10075067
621 Ga0207662_10002146
622 Ga0207662_10006122
623 Ga0207657_10067128
624 Ga0207649_10105600
625 Ga0207649_10353392
626 Ga0207652_10304213
627 Ga0207646_10191086
628 Ga0207646_10218552
629 Ga0207646_10329141
630 Ga0207681_10003457
631 Ga0207694_10188736
632 Ga0207659_10001351
633 Ga0207659_10807770
634 Ga0207659_10890237
635 Ga0207687_10249629
636 Ga0207700_10007596
637 Ga0207700_10071466
638 Ga0207700_10117299
639 Ga0207700_10432265
640 Ga0207700_11414218
641 Ga0207700_11569830
642 Ga0207664_10001072
643 Ga0207664_10019079
644 Ga0207664_10043216
645 Ga0207644_10091782
646 Ga0207644_10195866
647 Ga0207644_10648219
648 Ga0207690_10053429
649 Ga0207690_10263274
650 Ga0207706_10000293
651 Ga0207706_10393551
652 Ga0207686_10036839
653 Ga0207670_10059483
654 Ga0207665_10081519
655 Ga0207665_10171260
656 Ga0207691_10141603
657 Ga0207691_10170015
658 Ga0207691_10783081
659 Ga0207711_10098491
660 Ga0207711_10402363
661 Ga0207661_10010956
662 Ga0207661_10021275
663 Ga0207661_10089877
664 Ga0207679_10038185
665 Ga0207679_10124673
666 Ga0207679_10151831
667 Ga0207679_10433361
668 Ga0207679_11055960
669 Ga0207651_10036531
670 Ga0207651_10196926
671 Ga0207651_10732799
672 Ga0207712_10926661
673 Ga0207668_10184000
674 Ga0207658_10126858
675 Ga0207658_10247559
676 Ga0207658_10907312
677 Ga0207677_11201355
678 Ga0207677_11659641
679 Ga0207703_10127163
680 Ga0207703_10177014
681 Ga0207678_10260760
682 Ga0207678_10806701
683 Ga0207678_11902970
684 Ga0207702_10004422
685 Ga0207702_10168803
686 Ga0207641_10515024
687 Ga0207648_10092338
688 Ga0207676_10200427
689 Ga0207676_10318965
690 Ga0207674_10007116
691 Ga0207674_10016099
692 Ga0207675_101837117
693 Ga0207683_10150001
694 Ga0207683_10418140
695 Ga0207698_10458784
696 Ga0207428_10262332
697 Ga0207428_10887015
698 Ga0265356_1000089
699 Ga0268265_10075333
700 Ga0268264_10142504
701 Ga0268264_10707531
702 Ga0265336_10171703
703 Ga0265338_10020485
704 Ga0265338_10064208
705 Ga0265338_10129949
706 Ga0265338_10251760
707 Ga0265762_1002741
708 Ga0265762_1012831
709 Ga0265770_1074063
710 Ga0265760_10000657
711 Ga0265325_10299688
712 Ga0265339_10030719
713 Ga0265339_10137619
714 Ga0265327_10036423
715 Ga0307408_100057289
716 Ga0307408_100159081
717 Ga0307408_100354461
718 Ga0265314_10038271
719 Ga0265314_10072009
720 Ga0265342_10006400
721 Ga0307405_10004736
722 Ga0307405_10008763
723 Ga0307405_10897338
724 Ga0307405_12114741
725 Ga0307413_10092072
726 Ga0307410_10028229
727 Ga0307410_10268996
728 Ga0307410_10888070
729 Ga0307406_10000770
730 Ga0307406_10047378
731 Ga0307406_10258240
732 Ga0307406_10475699
733 Ga0307407_10006151
734 Ga0307407_10174919
735 Ga0307412_10005146
736 Ga0307409_100217721
737 Ga0307409_100265864
738 Ga0307409_102440429
739 Ga0307416_100014214
740 Ga0307416_100342684
741 Ga0307414_10075611
742 Ga0307411_10024686
743 Ga0307411_10113377
744 Ga0307415_100076329
745 Ga0307415_100927755
746 Ga0316214_1003504
747 Ga0373934_0072079
748 Ga0373934_0080682
749 Ga0373944_0081540
750 Ga0373923_0027506
751 Ga0373923_0147795
752 Ga0373936_0000265
753 Ga0373945_0001056
754 Ga0373956_0132679
755 Ga0373960_0362622
756 Ga0373943_0000052
757 Ga0373943_0087664
758 Ga0373946_0002077
759 Ga0373924_0278018
760 Ga0373924_0313464
761 Ga0373935_0000198
762 Ga0373935_0396899
763 Ga0373935_1487324
764 Ga0373927_0000016
765 Ga0373927_0491720
766 Ga0373933_0199840
767 Ga0373933_0306503
768 Ga0373947_0000042
769 Ga0373947_0107423
770 Ga0373947_0369530
771 Ga0373937_0153159
772 Ga0373937_0217873
773 Ga0373937_0479191
774 Ga0373925_0000956
775 Ga0373925_0503179
776 Ga0373925_0538042
777 Ga0373925_0608057
778 Ga0395898_0003671
779 Ga0395901_0009611
780 Ga0395901_1677910
781 Ga0436365_0105081
782 Ga0436365_1432202
783 Ga0436360_1092347
784 Ga0436363_0865516
785 Ga0439435_0034422
786 Ga0453683_0175067
787 Ga0466965_0565466
788 Ga0495603_0371567
789 Ga0495653_0131635
790 Ga0495580_0007410
791 Ga0495580_0678243
792 Ga0495582_0816370
793 Ga0495664_0105958
794 Ga0495608_0237427
795 Ga0495630_0037261
796 Ga0495630_0372831
797 Ga0495652_0530679
798 Ga0495621_0011872
799 Ga0495645_0362050
800 Ga0495645_0779762
801 Ga0495599_0666865
802 Ga0495623_0190542
803 Ga0495624_0095803
804 Ga0495674_0012319
805 Ga0495685_028183
806 Ga0495602_0222892
807 Ga0495602_0331911
808 Ga0495602_0578598
809 Ga0495614_0484083
810 Ga0496100_0150158
811 Ga0496100_0209058
812 Ga0496101_0667394
813 Ga0496104_0042141
814 Ga0496104_0322281
815 Ga0496104_1077311
816 Ga0496105_0124422
817 Ga0496105_0132436
818 Ga0496106_0395199
819 Ga0496107_0413301
820 Ga0496108_0220651
821 Ga0496108_0270754
822 Ga0496109_0271807
823 Ga0496109_1238182
824 Ga0496111_0080561
825 Ga0496112_0007742
826 Ga0496113_0080889
827 Ga0496114_0207858
828 Ga0496114_0449678
829 Ga0496115_0008922
830 Ga0501300_053315
831 Ga0501034_0447108
832 Ga0501069_0577034
833 Ga0501070_0354894
834 Ga0501073_0547204
835 Ga0501075_0817078
836 Ga0501076_0097139
837 Ga0501223_024076
838 Ga0501228_070007
839 Ga0501225_0043082
840 Ga0501079_0190995
841 Ga0501080_0315509
842 Ga0501081_0778125
843 Ga0501268_111628
844 Ga0501212_072452
845 nmdc:mga05p37_1063196_c1
846 nmdc:mga05p37_509064_c1
847 nmdc:mga0qj67_1152685_c1
848 nmdc:mga0qj67_438798_c1
849 nmdc:mga08y16_150030_c1
850 nmdc:mga08y16_211370_c1
851 nmdc:mga0rr50_236366_c1
852 nmdc:mga08x19_942042_c1
853 Ga0501084_0180698
854 Ga0587111_0089222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

60

139

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

59

104

0.93

PF01638

HxlR

HxlR-like helix-turn-helix

55

145

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9349 36 84
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.924 38 81
4chu-assembly1.cif.gz_B e. coli iscr-dna complex 0.9204 36 86
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9187 39 109
2mlg-assembly1.cif.gz_A stf76 from the sulfolobus islandicus plasmid-virus pssvx 0.9079 40 100
ID Description Score Start End Superfamily
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 38 81 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9218 37 84 1.10.10.10
3bp8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9212 36 84 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9169 37 86 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9144 39 117 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H4BP91-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9955 39 119 GO:0003677
GO:0005737
AF-A0A6M1YBQ9-F1-model_v4 Transcriptional regulator 0.9876 39 116
AF-A0A7L7LDY6-F1-model_v4 Transcriptional regulator 0.9873 39 124 GO:0005737
AF-A0A543B215-F1-model_v4 Winged helix DNA-binding protein 0.9855 39 122 GO:0003677
AF-D4YKT1-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9846 40 120

Map