F441383

General Info

Members Datasets Scaffolds Average Seq Length
427 186 854 414

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10000929|Ga0070676_1000092916
Length 446
Sequence MARRSRAELAEYKRAPSGDTGRVLMSVPRPATGDLAASASRAEPESAYAWTRLFVALTLSAIGGVGMWSVIVALPAVQAEFGVARSAATLPYTATMICFGLGAILTGRLSDRVGIMRPVVAGAVSLGVGYALASQATTLWQFILTQGLIVGVAGSVTFAPLVADTSLWFTRRRGIAVAIIASGSYLAGTIWPPVVQYFIQAQGWRRTYVGIAIFCVVTMLPLSLVLRRRSPLTGTVTASASTGAGSWPLRPLGMSPAALQTVLVIAGLSCCVAMSMPQVHIVAYSADLGHGAARGAQMLSLMLAGGIVSRLVSGWVCDRIGGRRTLLLGSSLQALALVLFLPFDGLASLYVVSVLFGLFQGGIVPSYAVIIREFFPPSEAGLRVSTVLTATVFGMALGGWMTGMIFDLTGSYQAAFVNGILWNLLNIGIAVGLLRQPGRPVQEAWR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
124 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
186 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10000929 3300005328 Bacteria 14505
2 JGI26141J51220_1000358 3300003503 Bacteria 2452
3 Ga0070670_100040498 3300005331 Bacteria 4005
4 Ga0068869_100002616 3300005334 Bacteria 10866
5 Ga0068869_100196422 3300005334 Bacteria 1589
6 Ga0070680_100019470 3300005336 Bacteria 5378
7 Ga0070680_100066832 3300005336 Bacteria 2949
8 Ga0070682_100002851 3300005337 Bacteria 9587
9 Ga0070660_100000970 3300005339 Bacteria 19181
10 Ga0070689_100048350 3300005340 Bacteria 3281
11 Ga0070691_10001273 3300005341 Bacteria 10649
12 Ga0070661_100004743 3300005344 Bacteria 9350
13 Ga0070692_10008016 3300005345 Bacteria 4688
14 Ga0070673_100010542 3300005364 Bacteria 6259
15 Ga0070659_100000818 3300005366 Bacteria 22732
16 Ga0070703_10002634 3300005406 Bacteria 5161
17 Ga0070701_10052164 3300005438 Bacteria 2123
18 Ga0070705_100001408 3300005440 Bacteria 12726
19 Ga0070705_100009258 3300005440 Bacteria 4892
20 Ga0070700_100084403 3300005441 Bacteria 2058
21 Ga0070694_100011016 3300005444 Bacteria 5594
22 Ga0070708_100128037 3300005445 Bacteria 2348
23 Ga0070663_100001424 3300005455 Bacteria 13094
24 Ga0070662_100005438 3300005457 Bacteria 8134
25 Ga0070662_100126074 3300005457 Bacteria 1968
26 Ga0070662_100172801 3300005457 Bacteria 1698
27 Ga0070681_10077136 3300005458 Bacteria 3290
28 Ga0068867_100021346 3300005459 Bacteria 4620
29 Ga0070706_100171292 3300005467 Bacteria 2027
30 Ga0070706_100195707 3300005467 Bacteria 1888
31 Ga0070706_100293767 3300005467 Bacteria 1516
32 Ga0070707_100022319 3300005468 Bacteria 5983
33 Ga0070707_100102264 3300005468 Bacteria 2776
34 Ga0070707_100210867 3300005468 Bacteria 1893
35 Ga0070698_100013819 3300005471 Bacteria 8541
36 Ga0070698_100034823 3300005471 Bacteria 5209
37 Ga0070698_100076475 3300005471 Bacteria 3349
38 Ga0070698_100212574 3300005471 Bacteria 1868
39 Ga0070699_100012203 3300005518 Bacteria 7414
40 Ga0070699_100029770 3300005518 Bacteria 4709
41 Ga0070679_100004451 3300005530 Bacteria 12943
42 Ga0070697_100002828 3300005536 Bacteria 13350
43 Ga0070697_100011641 3300005536 Bacteria 6875
44 Ga0070697_100021738 3300005536 Bacteria 5085
45 Ga0068853_100003042 3300005539 Bacteria 12807
46 Ga0070695_100005633 3300005545 Bacteria 7380
47 Ga0070695_100007566 3300005545 Bacteria 6436
48 Ga0070695_100027140 3300005545 Bacteria 3545
49 Ga0070696_100021441 3300005546 Bacteria 4380
50 Ga0070696_100160010 3300005546 Bacteria 1658
51 Ga0070696_100197214 3300005546 Bacteria 1501
52 Ga0070693_100000604 3300005547 Bacteria 15892
53 Ga0070704_100000528 3300005549 Bacteria 18308
54 Ga0070704_100001625 3300005549 Bacteria 12182
55 Ga0070704_100020574 3300005549 Bacteria 4258
56 Ga0070704_100088685 3300005549 Bacteria 2299
57 Ga0068855_100004425 3300005563 Bacteria 17170
58 Ga0070664_100048211 3300005564 Bacteria 3600
59 Ga0068857_100252090 3300005577 Bacteria 1618
60 Ga0068854_100027569 3300005578 Bacteria 3916
61 Ga0068856_100002103 3300005614 Bacteria 20655
62 Ga0068852_100193240 3300005616 Bacteria 1922
63 Ga0068859_100021420 3300005617 Bacteria 6488
64 Ga0068859_100230529 3300005617 Bacteria 1940
65 Ga0068870_10000542 3300005840 Bacteria 14287
66 Ga0068870_10032965 3300005840 Bacteria 2639
67 Ga0068858_100018450 3300005842 Bacteria 6532
68 Ga0068858_100041616 3300005842 Bacteria 4259
69 Ga0068860_100009397 3300005843 Bacteria 9717
70 Ga0068860_100014432 3300005843 Bacteria 7739
71 Ga0068862_100004918 3300005844 Bacteria 11254
72 Ga0068862_100100930 3300005844 Bacteria 2524
73 Ga0068862_100123368 3300005844 Bacteria 2285
74 Ga0081455_10000060 3300005937 Bacteria 119012
75 Ga0081538_10027233 3300005981 Bacteria 3970
76 Ga0081540_1021441 3300005983 Bacteria 3845
77 Ga0081539_10000271 3300005985 Bacteria 118902
78 Ga0075362_10000550 3300006177 Bacteria 10909
79 Ga0075362_10023505 3300006177 Bacteria 2607
80 Ga0075428_100000367 3300006844 Bacteria 44787
81 Ga0075428_100003078 3300006844 Bacteria 18193
82 Ga0075428_100031753 3300006844 Bacteria 5834
83 Ga0075428_100058488 3300006844 Bacteria 4221
84 Ga0075428_100210101 3300006844 Bacteria 2103
85 Ga0075428_100365603 3300006844 Bacteria 1547
86 Ga0075430_100000034 3300006846 Bacteria 70046
87 Ga0075430_100000036 3300006846 Bacteria 68655
88 Ga0075430_100008304 3300006846 Bacteria 8770
89 Ga0075430_100010413 3300006846 Bacteria 7873
90 Ga0075431_100004963 3300006847 Bacteria 13091
91 Ga0075431_100005295 3300006847 Bacteria 12717
92 Ga0075431_100011834 3300006847 Bacteria 8803
93 Ga0075431_100016278 3300006847 Bacteria 7545
94 Ga0075431_100016368 3300006847 Bacteria 7525
95 Ga0075431_100022483 3300006847 Bacteria 6447
96 Ga0075431_100134314 3300006847 Bacteria 2551
97 Ga0075431_100272085 3300006847 Bacteria 1716
98 Ga0075431_100433953 3300006847 Bacteria 1311
99 Ga0075433_10004051 3300006852 Bacteria 11347
100 Ga0075433_10004993 3300006852 Bacteria 10391
101 Ga0075433_10005364 3300006852 Bacteria 10068
102 Ga0075433_10013843 3300006852 Bacteria 6576
103 Ga0075433_10018223 3300006852 Bacteria 5831
104 Ga0075433_10034878 3300006852 Bacteria 4324
105 Ga0075433_10094382 3300006852 Bacteria 2648
106 Ga0075434_100008611 3300006871 Bacteria 9498
107 Ga0075434_100008750 3300006871 Bacteria 9419
108 Ga0075434_100034755 3300006871 Bacteria 4980
109 Ga0075434_100047386 3300006871 Bacteria 4265
110 Ga0075434_100199011 3300006871 Bacteria 2023
111 Ga0075429_100000001 3300006880 Bacteria 139031
112 Ga0075429_100001056 3300006880 Bacteria 22010
113 Ga0075429_100002334 3300006880 Bacteria 15949
114 Ga0075429_100002639 3300006880 Bacteria 15096
115 Ga0075429_100002691 3300006880 Bacteria 14967
116 Ga0075429_100018153 3300006880 Bacteria 6088
117 Ga0075429_100034004 3300006880 Bacteria 4429
118 Ga0075429_100148668 3300006880 Bacteria 2051
119 Ga0068865_100151482 3300006881 Bacteria 1760
120 Ga0075436_100021544 3300006914 Bacteria 4424
121 Ga0075436_100150047 3300006914 Bacteria 1640
122 Ga0097620_100021418 3300006931 Bacteria 6488
123 Ga0097620_100230545 3300006931 Bacteria 1940
124 Ga0075435_100011162 3300007076 Bacteria 6590
125 Ga0075435_100023910 3300007076 Bacteria 4734
126 Ga0075435_100058071 3300007076 Bacteria 3132
127 Ga0111539_10000939 3300009094 Bacteria 38168
128 Ga0111539_10008443 3300009094 Bacteria 13103
129 Ga0111539_10017094 3300009094 Bacteria 8978
130 Ga0114129_10000383 3300009147 Bacteria 51440
131 Ga0114129_10004221 3300009147 Bacteria 20302
132 Ga0114129_10006949 3300009147 Bacteria 16100
133 Ga0114129_10010980 3300009147 Bacteria 12903
134 Ga0114129_10010996 3300009147 Bacteria 12895
135 Ga0114129_10014487 3300009147 Bacteria 11237
136 Ga0114129_10040324 3300009147 Bacteria 6582
137 Ga0114129_10048550 3300009147 Bacteria 5964
138 Ga0114129_10050641 3300009147 Bacteria 5833
139 Ga0114129_10054182 3300009147 Bacteria 5624
140 Ga0114129_10069011 3300009147 Bacteria 4927
141 Ga0114129_10074495 3300009147 Bacteria 4729
142 Ga0114129_10081369 3300009147 Bacteria 4501
143 Ga0114129_10135959 3300009147 Bacteria 3372
144 Ga0114129_10629457 3300009147 Bacteria 1387
145 Ga0105243_10005129 3300009148 Bacteria 10272
146 Ga0105241_10001791 3300009174 Bacteria 16319
147 Ga0105242_10000761 3300009176 Bacteria 25021
148 Ga0105242_10040751 3300009176 Bacteria 3743
149 Ga0105248_10108298 3300009177 Bacteria 3133
150 Ga0105249_10073599 3300009553 Bacteria 3161
151 Ga0105246_10028078 3300011119 Bacteria 3694
152 Ga0157373_10001444 3300013100 Bacteria 18151
153 Ga0157369_10029073 3300013105 Bacteria 6110
154 Ga0157372_10001335 3300013307 Bacteria 26660
155 Ga0157372_10030918 3300013307 Bacteria 5859
156 Ga0207653_10002762 3300025885 Bacteria 5584
157 Ga0207645_10001090 3300025907 Bacteria 22399
158 Ga0207643_10000057 3300025908 Bacteria 73664
159 Ga0207684_10005716 3300025910 Bacteria 11425
160 Ga0207684_10196240 3300025910 Bacteria 1741
161 Ga0207684_10236563 3300025910 Bacteria 1576
162 Ga0207707_10001689 3300025912 Bacteria 20305
163 Ga0207660_10001714 3300025917 Bacteria 14711
164 Ga0207657_10001291 3300025919 Bacteria 26609
165 Ga0207652_10001723 3300025921 Bacteria 19088
166 Ga0207646_10012746 3300025922 Bacteria 8062
167 Ga0207646_10024873 3300025922 Bacteria 5480
168 Ga0207646_10031885 3300025922 Bacteria 4770
169 Ga0207646_10388871 3300025922 Bacteria 1260
170 Ga0207681_10061711 3300025923 Bacteria 2578
171 Ga0207650_10022059 3300025925 Bacteria 4507
172 Ga0207706_10007276 3300025933 Bacteria 10234
173 Ga0207706_10030517 3300025933 Bacteria 4808
174 Ga0207706_10145410 3300025933 Bacteria 2085
175 Ga0207686_10008264 3300025934 Bacteria 5614
176 Ga0207704_10139409 3300025938 Bacteria 1694
177 Ga0207711_10049364 3300025941 Bacteria 3603
178 Ga0207689_10001050 3300025942 Bacteria 26544
179 Ga0207679_10005417 3300025945 Bacteria 7993
180 Ga0207667_10003708 3300025949 Bacteria 18845
181 Ga0207651_10075930 3300025960 Bacteria 2400
182 Ga0207668_10028956 3300025972 Bacteria 3627
183 Ga0207640_10077234 3300025981 Bacteria 2263
184 Ga0207703_10018488 3300026035 Bacteria 5442
185 Ga0207639_10004062 3300026041 Bacteria 9871
186 Ga0207678_10004163 3300026067 Bacteria 12985
187 Ga0207708_10122026 3300026075 Bacteria 2031
188 Ga0207648_10080970 3300026089 Bacteria 2833
189 Ga0207674_10002538 3300026116 Bacteria 23000
190 Ga0207674_10008145 3300026116 Bacteria 12150
191 Ga0207675_100016827 3300026118 Bacteria 6832
192 Ga0207698_10136000 3300026142 Bacteria 2109
193 Ga0209968_1000240 3300027526 Bacteria 9432
194 Ga0209983_1000855 3300027665 Bacteria 6700
195 Ga0209971_1000376 3300027682 Bacteria 12232
196 Ga0209966_1000586 3300027695 Bacteria 8822
197 Ga0209998_10000117 3300027717 Bacteria 31452
198 Ga0209974_10002797 3300027876 Bacteria 6329
199 Ga0207428_10001049 3300027907 Bacteria 30412
200 Ga0207428_10002070 3300027907 Bacteria 20243
201 Ga0268265_10004815 3300028380 Bacteria 9305
202 Ga0268265_10033813 3300028380 Bacteria 3720
203 Ga0307515_10072272 3300028794 Bacteria 4659
204 Ga0307513_10083149 3300031456 Bacteria 3293
205 Ga0307408_100065280 3300031548 Bacteria 2669
206 Ga0307407_10011699 3300031903 Bacteria 4190
207 Ga0307416_100408409 3300032002 Bacteria 1398
208 Ga0373948_0009506 3300034817 Bacteria 1678
209 Ga0373961_0026473 3300035241 Bacteria 1585
210 Ga0373931_0099630 3300035691 Bacteria 1632
211 Ga0373927_0116767 3300035695 Bacteria 1740
212 Ga0395899_0007332 3300037312 Bacteria 8532
213 Ga0395900_0030228 3300037418 Bacteria 5561
214 Ga0395898_0039128 3300037466 Bacteria 4695
215 Ga0395905_0174102 3300037471 Bacteria 2021
216 Ga0395901_0005260 3300038443 Bacteria 13072
217 Ga0439441_008931 3300042001 Bacteria 1649
218 Ga0439456_005721 3300042013 Bacteria 2527
219 Ga0439458_0001784 3300042157 Bacteria 5359
220 Ga0439460_0001583 3300042461 Bacteria 5387
221 Ga0451577_0012743 3300042876 Bacteria 7887
222 Ga0451577_0026336 3300042876 Bacteria 5268
223 Ga0453683_0052965 3300044673 Bacteria 2540
224 Ga0453684_0008187 3300044712 Bacteria 18852
225 Ga0453684_0160155 3300044712 Bacteria 2663
226 Ga0453684_0418884 3300044712 Bacteria 1496
227 Ga0451576_0027219 3300045051 Bacteria 6143
228 Ga0451576_0036385 3300045051 Bacteria 5218
229 Ga0451576_0069126 3300045051 Bacteria 3675
230 Ga0451576_0071880 3300045051 Bacteria 3600
231 Ga0451576_0095008 3300045051 Bacteria 3101
232 Ga0451576_0114148 3300045051 Bacteria 2812
233 Ga0495580_0005148 3300046472 Bacteria 10877
234 Ga0495662_0020723 3300046476 Bacteria 3180
235 Ga0495630_0013500 3300046517 Bacteria 5940
236 Ga0495586_0068059 3300046535 Bacteria 1942
237 Ga0495634_0130220 3300046642 Bacteria 1604
238 Ga0495635_0143434 3300046663 Bacteria 1626
239 Ga0495624_0073469 3300046690 Bacteria 2126
240 Ga0495636_0004675 3300047318 Bacteria 5371
241 Ga0496102_0385716 3300048905 Bacteria 1318
242 Ga0496110_0116944 3300048913 Bacteria 2401
243 Ga0496112_0110515 3300048915 Bacteria 2719
244 Ga0501031_0014480 3300049568 Bacteria 5127
245 Ga0501032_0119094 3300049569 Bacteria 1746
246 Ga0501033_0016683 3300049570 Bacteria 5554
247 Ga0501033_0033235 3300049570 Bacteria 3873
248 Ga0501036_0000094 3300049572 Bacteria 55558
249 Ga0501036_0028511 3300049572 Bacteria 4717
250 Ga0501037_0012375 3300049573 Bacteria 6282
251 Ga0501037_0060578 3300049573 Bacteria 2761
252 Ga0501038_0001660 3300049574 Bacteria 20637
253 Ga0501038_0008917 3300049574 Bacteria 9202
254 Ga0501039_0001935 3300049575 Bacteria 15343
255 Ga0501039_0029090 3300049575 Bacteria 4255
256 Ga0501039_0040484 3300049575 Bacteria 3598
257 Ga0501039_0048117 3300049575 Bacteria 3296
258 Ga0501040_0000163 3300049576 Bacteria 37302
259 Ga0501040_0002278 3300049576 Bacteria 12335
260 Ga0501040_0099425 3300049576 Bacteria 2028
261 Ga0501041_0000062 3300049577 Bacteria 40482
262 Ga0501041_0020075 3300049577 Bacteria 3991
263 Ga0501041_0117189 3300049577 Bacteria 1654
264 Ga0501042_0000141 3300049578 Bacteria 31706
265 Ga0501042_0000424 3300049578 Bacteria 21414
266 Ga0501042_0013344 3300049578 Bacteria 5588
267 Ga0501042_0195435 3300049578 Bacteria 1459
268 Ga0501043_0004421 3300049579 Bacteria 11419
269 Ga0501046_0001548 3300049580 Bacteria 21972
270 Ga0501046_0002744 3300049580 Bacteria 16392
271 Ga0501046_0015294 3300049580 Bacteria 6453
272 Ga0501046_0108186 3300049580 Bacteria 2126
273 Ga0501047_0218846 3300049581 Bacteria 1761
274 Ga0501047_0227170 3300049581 Bacteria 1721
275 Ga0501048_0014617 3300049582 Bacteria 5810
276 Ga0501048_0053290 3300049582 Bacteria 2877
277 Ga0501048_0071386 3300049582 Bacteria 2451
278 Ga0501048_0086625 3300049582 Bacteria 2209
279 Ga0501048_0096784 3300049582 Bacteria 2082
280 Ga0501068_0001798 3300049584 Bacteria 11402
281 Ga0501068_0087172 3300049584 Bacteria 1922
282 Ga0501069_0085625 3300049585 Bacteria 1779
283 Ga0501071_0000391 3300049587 Bacteria 21588
284 Ga0501071_0030721 3300049587 Bacteria 3801
285 Ga0501071_0052836 3300049587 Bacteria 2930
286 Ga0501071_0064628 3300049587 Bacteria 2655
287 Ga0501071_0112872 3300049587 Bacteria 2009
288 Ga0501071_0227877 3300049587 Bacteria 1403
289 Ga0501072_0000069 3300049588 Bacteria 74196
290 Ga0501072_0003779 3300049588 Bacteria 11432
291 Ga0501072_0016181 3300049588 Bacteria 5721
292 Ga0501072_0070103 3300049588 Bacteria 2768
293 Ga0501074_0009878 3300049590 Bacteria 6932
294 Ga0501074_0142890 3300049590 Bacteria 1711
295 Ga0501074_0181544 3300049590 Bacteria 1501
296 Ga0501075_0002755 3300049591 Bacteria 11774
297 Ga0501075_0012856 3300049591 Bacteria 5961
298 Ga0501075_0025843 3300049591 Bacteria 4316
299 Ga0501075_0034183 3300049591 Bacteria 3784
300 Ga0501075_0070756 3300049591 Bacteria 2636
301 Ga0501075_0072340 3300049591 Bacteria 2606
302 Ga0501076_0000140 3300049592 Bacteria 41122
303 Ga0501076_0005700 3300049592 Bacteria 8981
304 Ga0501076_0006219 3300049592 Bacteria 8643
305 Ga0501076_0006932 3300049592 Bacteria 8232
306 Ga0501076_0013719 3300049592 Bacteria 6080
307 Ga0501076_0118602 3300049592 Bacteria 2142
308 Ga0501076_0165531 3300049592 Bacteria 1802
309 Ga0501077_0000870 3300049593 Bacteria 18238
310 Ga0501077_0018577 3300049593 Bacteria 4397
311 Ga0501077_0032881 3300049593 Bacteria 3303
312 Ga0501079_0000060 3300049741 Bacteria 49239
313 Ga0501079_0003567 3300049741 Bacteria 11447
314 Ga0501079_0005077 3300049741 Bacteria 9775
315 Ga0501079_0063520 3300049741 Bacteria 2848
316 Ga0501079_0143805 3300049741 Bacteria 1858
317 Ga0501079_0218391 3300049741 Bacteria 1489
318 Ga0501080_0001483 3300049742 Bacteria 19784
319 Ga0501080_0043368 3300049742 Bacteria 4189
320 Ga0501080_0092366 3300049742 Bacteria 2811
321 Ga0501080_0256085 3300049742 Bacteria 1595
322 Ga0501081_0000047 3300049743 Bacteria 45820
323 Ga0501081_0001528 3300049743 Bacteria 14206
324 Ga0501081_0009962 3300049743 Bacteria 6195
325 Ga0501081_0013201 3300049743 Bacteria 5432
326 Ga0501081_0029255 3300049743 Bacteria 3723
327 Ga0501081_0037629 3300049743 Bacteria 3302
328 Ga0501081_0155823 3300049743 Bacteria 1643
329 Ga0501081_0247583 3300049743 Bacteria 1300
330 Ga0501083_0016323 3300049744 Bacteria 5200
331 Ga0501083_0040397 3300049744 Bacteria 3167
332 Ga0501035_0032443 3300049822 Bacteria 4751
333 Ga0501045_0000004 3300049824 Bacteria 86792
334 Ga0501045_0002446 3300049824 Bacteria 12622
335 Ga0501045_0002923 3300049824 Bacteria 11681
336 Ga0501045_0017999 3300049824 Bacteria 5017
337 Ga0501045_0182609 3300049824 Bacteria 1563
338 nmdc:mga03683_707_c1 3300050489 Bacteria 9578
339 nmdc:mga03n38_70769_c1 3300050490 Bacteria 1614
340 nmdc:mga05p37_10648_c1 3300050507 Bacteria 10911
341 nmdc:mga05p37_10895_c1 3300050507 Bacteria 10797
342 nmdc:mga05p37_141_c1 3300050507 Bacteria 67555
343 nmdc:mga05p37_179638_c1 3300050507 Bacteria 2576
344 nmdc:mga05p37_202847_c1 3300050507 Bacteria 2401
345 nmdc:mga05p37_28229_c1 3300050507 Bacteria 6841
346 nmdc:mga05p37_3984_c1 3300050507 Bacteria 17275
347 nmdc:mga05p37_43350_c1 3300050507 Bacteria 5535
348 nmdc:mga05p37_53009_c1 3300050507 Bacteria 4989
349 nmdc:mga05p37_590_c1 3300050507 Bacteria 40000
350 nmdc:mga05p37_78757_c1 3300050507 Bacteria 4058
351 nmdc:mga05p37_88349_c1 3300050507 Bacteria 3820
352 nmdc:mga05p37_89401_c1 3300050507 Bacteria 3795
353 nmdc:mga05p37_98083_c2 3300050507 Bacteria 2730
354 nmdc:mga09592_132190_c1 3300050508 Bacteria 2148
355 nmdc:mga09592_143404_c1 3300050508 Bacteria 2059
356 nmdc:mga09592_145030_c1 3300050508 Bacteria 2047
357 nmdc:mga09592_15975_c1 3300050508 Bacteria 6134
358 nmdc:mga09592_191213_c1 3300050508 Bacteria 1772
359 nmdc:mga09592_1912_c1 3300050508 Bacteria 16750
360 nmdc:mga09592_23258_c1 3300050508 Bacteria 5118
361 nmdc:mga09592_24477_c1 3300050508 Bacteria 4994
362 nmdc:mga09592_2782_c1 3300050508 Bacteria 14166
363 nmdc:mga09592_41228_c1 3300050508 Bacteria 3881
364 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
365 nmdc:mga0qj67_108970_c1 3300050509 Bacteria 2235
366 nmdc:mga0qj67_124730_c1 3300050509 Bacteria 2084
367 nmdc:mga0qj67_1580_c1 3300050509 Bacteria 16011
368 nmdc:mga0qj67_296359_c1 3300050509 Bacteria 1311
369 nmdc:mga06r32_1360_c1 3300050510 Bacteria 22084
370 nmdc:mga06r32_2324_c1 3300050510 Bacteria 17027
371 nmdc:mga06r32_30678_c1 3300050510 Bacteria 5046
372 nmdc:mga06r32_310507_c1 3300050510 Bacteria 1563
373 nmdc:mga06r32_3135_c1 3300050510 Bacteria 14812
374 nmdc:mga06r32_37150_c1 3300050510 Bacteria 4607
375 nmdc:mga06r32_4554_c1 3300050510 Bacteria 12419
376 nmdc:mga06r32_5075_c1 3300050510 Bacteria 11855
377 nmdc:mga06r32_5485_c1 3300050510 Bacteria 11422
378 nmdc:mga06r32_91661_c1 3300050510 Bacteria 2970
379 nmdc:mga08y16_118289_c1 3300050511 Bacteria 2758
380 nmdc:mga08y16_163096_c1 3300050511 Bacteria 2316
381 nmdc:mga08y16_290928_c1 3300050511 Bacteria 1684
382 nmdc:mga08y16_4496_c1 3300050511 Bacteria 14568
383 nmdc:mga08y16_56317_c1 3300050511 Bacteria 4110
384 nmdc:mga0n895_12043_c1 3300050512 Bacteria 7742
385 nmdc:mga0n895_17086_c1 3300050512 Bacteria 6680
386 nmdc:mga0n895_41594_c1 3300050512 Bacteria 4469
387 nmdc:mga0n895_5289_c1 3300050512 Bacteria 10751
388 nmdc:mga0n895_667_c1 3300050512 Bacteria 24029
389 nmdc:mga0n895_77342_c1 3300050512 Bacteria 3310
390 nmdc:mga0n895_89783_c1 3300050512 Bacteria 3074
391 nmdc:mga0rr50_6825_c1 3300050513 Bacteria 6995
392 nmdc:mga0rr50_84485_c1 3300050513 Bacteria 2458
393 nmdc:mga08x19_367_c1 3300050514 Bacteria 31883
394 nmdc:mga0a205_121352_c1 3300050515 Bacteria 2513
395 nmdc:mga0a205_1467_c1 3300050515 Bacteria 20121
396 nmdc:mga0a205_16321_c1 3300050515 Bacteria 6954
397 nmdc:mga0a205_34173_c1 3300050515 Bacteria 4878
398 nmdc:mga0a205_35649_c1 3300050515 Bacteria 4777
399 nmdc:mga0a205_3810_c1 3300050515 Bacteria 13516
400 nmdc:mga0a205_3942_c1 3300050515 Bacteria 13284
401 nmdc:mga0a205_9877_c1 3300050515 Bacteria 4824
402 Ga0495601_0057273 3300053077 Bacteria 2469
403 Ga0501084_0000507 3300054114 Bacteria 29821
404 Ga0501084_0007126 3300054114 Bacteria 9210
405 Ga0501084_0008785 3300054114 Bacteria 8358
406 Ga0501084_0021087 3300054114 Bacteria 5435
407 Ga0501084_0023228 3300054114 Bacteria 5177
408 Ga0501084_0031402 3300054114 Bacteria 4441
409 Ga0501084_0234166 3300054114 Bacteria 1550
410 Ga0501082_0000422 3300060353 Bacteria 37497
411 Ga0501082_0006080 3300060353 Bacteria 10478
412 Ga0501082_0023143 3300060353 Bacteria 5358
413 Ga0501082_0034256 3300060353 Bacteria 4379
414 Ga0501082_0037844 3300060353 Bacteria 4161
415 Ga0501082_0134208 3300060353 Bacteria 2148
416 Ga0501082_0204766 3300060353 Bacteria 1717
417 Ga0501082_0206736 3300060353 Bacteria 1708
418 Ga0530510_0000216 3300061734 Bacteria 35741
419 Ga0530510_0006906 3300061734 Bacteria 7916
420 Ga0530510_0023150 3300061734 Bacteria 4424
421 Ga0530510_0035069 3300061734 Bacteria 3615
422 Ga0530510_0037495 3300061734 Bacteria 3497
423 Ga0530510_0048997 3300061734 Bacteria 3053
424 Ga0530510_0093072 3300061734 Bacteria 2200
425 Ga0530510_0146650 3300061734 Bacteria 1741
426 2929205940 2929199973 Bacteria 7260745
427 8055912307 8055909800 Bacteria 7278581
428 Ga0070676_10000929
429 JGI26141J51220_1000358
430 Ga0070670_100040498
431 Ga0068869_100002616
432 Ga0068869_100196422
433 Ga0070680_100019470
434 Ga0070680_100066832
435 Ga0070682_100002851
436 Ga0070660_100000970
437 Ga0070689_100048350
438 Ga0070691_10001273
439 Ga0070661_100004743
440 Ga0070692_10008016
441 Ga0070673_100010542
442 Ga0070659_100000818
443 Ga0070703_10002634
444 Ga0070701_10052164
445 Ga0070705_100001408
446 Ga0070705_100009258
447 Ga0070700_100084403
448 Ga0070694_100011016
449 Ga0070708_100128037
450 Ga0070663_100001424
451 Ga0070662_100005438
452 Ga0070662_100126074
453 Ga0070662_100172801
454 Ga0070681_10077136
455 Ga0068867_100021346
456 Ga0070706_100171292
457 Ga0070706_100195707
458 Ga0070706_100293767
459 Ga0070707_100022319
460 Ga0070707_100102264
461 Ga0070707_100210867
462 Ga0070698_100013819
463 Ga0070698_100034823
464 Ga0070698_100076475
465 Ga0070698_100212574
466 Ga0070699_100012203
467 Ga0070699_100029770
468 Ga0070679_100004451
469 Ga0070697_100002828
470 Ga0070697_100011641
471 Ga0070697_100021738
472 Ga0068853_100003042
473 Ga0070695_100005633
474 Ga0070695_100007566
475 Ga0070695_100027140
476 Ga0070696_100021441
477 Ga0070696_100160010
478 Ga0070696_100197214
479 Ga0070693_100000604
480 Ga0070704_100000528
481 Ga0070704_100001625
482 Ga0070704_100020574
483 Ga0070704_100088685
484 Ga0068855_100004425
485 Ga0070664_100048211
486 Ga0068857_100252090
487 Ga0068854_100027569
488 Ga0068856_100002103
489 Ga0068852_100193240
490 Ga0068859_100021420
491 Ga0068859_100230529
492 Ga0068870_10000542
493 Ga0068870_10032965
494 Ga0068858_100018450
495 Ga0068858_100041616
496 Ga0068860_100009397
497 Ga0068860_100014432
498 Ga0068862_100004918
499 Ga0068862_100100930
500 Ga0068862_100123368
501 Ga0081455_10000060
502 Ga0081538_10027233
503 Ga0081540_1021441
504 Ga0081539_10000271
505 Ga0075362_10000550
506 Ga0075362_10023505
507 Ga0075428_100000367
508 Ga0075428_100003078
509 Ga0075428_100031753
510 Ga0075428_100058488
511 Ga0075428_100210101
512 Ga0075428_100365603
513 Ga0075430_100000034
514 Ga0075430_100000036
515 Ga0075430_100008304
516 Ga0075430_100010413
517 Ga0075431_100004963
518 Ga0075431_100005295
519 Ga0075431_100011834
520 Ga0075431_100016278
521 Ga0075431_100016368
522 Ga0075431_100022483
523 Ga0075431_100134314
524 Ga0075431_100272085
525 Ga0075431_100433953
526 Ga0075433_10004051
527 Ga0075433_10004993
528 Ga0075433_10005364
529 Ga0075433_10013843
530 Ga0075433_10018223
531 Ga0075433_10034878
532 Ga0075433_10094382
533 Ga0075434_100008611
534 Ga0075434_100008750
535 Ga0075434_100034755
536 Ga0075434_100047386
537 Ga0075434_100199011
538 Ga0075429_100000001
539 Ga0075429_100001056
540 Ga0075429_100002334
541 Ga0075429_100002639
542 Ga0075429_100002691
543 Ga0075429_100018153
544 Ga0075429_100034004
545 Ga0075429_100148668
546 Ga0068865_100151482
547 Ga0075436_100021544
548 Ga0075436_100150047
549 Ga0097620_100021418
550 Ga0097620_100230545
551 Ga0075435_100011162
552 Ga0075435_100023910
553 Ga0075435_100058071
554 Ga0111539_10000939
555 Ga0111539_10008443
556 Ga0111539_10017094
557 Ga0114129_10000383
558 Ga0114129_10004221
559 Ga0114129_10006949
560 Ga0114129_10010980
561 Ga0114129_10010996
562 Ga0114129_10014487
563 Ga0114129_10040324
564 Ga0114129_10048550
565 Ga0114129_10050641
566 Ga0114129_10054182
567 Ga0114129_10069011
568 Ga0114129_10074495
569 Ga0114129_10081369
570 Ga0114129_10135959
571 Ga0114129_10629457
572 Ga0105243_10005129
573 Ga0105241_10001791
574 Ga0105242_10000761
575 Ga0105242_10040751
576 Ga0105248_10108298
577 Ga0105249_10073599
578 Ga0105246_10028078
579 Ga0157373_10001444
580 Ga0157369_10029073
581 Ga0157372_10001335
582 Ga0157372_10030918
583 Ga0207653_10002762
584 Ga0207645_10001090
585 Ga0207643_10000057
586 Ga0207684_10005716
587 Ga0207684_10196240
588 Ga0207684_10236563
589 Ga0207707_10001689
590 Ga0207660_10001714
591 Ga0207657_10001291
592 Ga0207652_10001723
593 Ga0207646_10012746
594 Ga0207646_10024873
595 Ga0207646_10031885
596 Ga0207646_10388871
597 Ga0207681_10061711
598 Ga0207650_10022059
599 Ga0207706_10007276
600 Ga0207706_10030517
601 Ga0207706_10145410
602 Ga0207686_10008264
603 Ga0207704_10139409
604 Ga0207711_10049364
605 Ga0207689_10001050
606 Ga0207679_10005417
607 Ga0207667_10003708
608 Ga0207651_10075930
609 Ga0207668_10028956
610 Ga0207640_10077234
611 Ga0207703_10018488
612 Ga0207639_10004062
613 Ga0207678_10004163
614 Ga0207708_10122026
615 Ga0207648_10080970
616 Ga0207674_10002538
617 Ga0207674_10008145
618 Ga0207675_100016827
619 Ga0207698_10136000
620 Ga0209968_1000240
621 Ga0209983_1000855
622 Ga0209971_1000376
623 Ga0209966_1000586
624 Ga0209998_10000117
625 Ga0209974_10002797
626 Ga0207428_10001049
627 Ga0207428_10002070
628 Ga0268265_10004815
629 Ga0268265_10033813
630 Ga0307515_10072272
631 Ga0307513_10083149
632 Ga0307408_100065280
633 Ga0307407_10011699
634 Ga0307416_100408409
635 Ga0373948_0009506
636 Ga0373961_0026473
637 Ga0373931_0099630
638 Ga0373927_0116767
639 Ga0395899_0007332
640 Ga0395900_0030228
641 Ga0395898_0039128
642 Ga0395905_0174102
643 Ga0395901_0005260
644 Ga0439441_008931
645 Ga0439456_005721
646 Ga0439458_0001784
647 Ga0439460_0001583
648 Ga0451577_0012743
649 Ga0451577_0026336
650 Ga0453683_0052965
651 Ga0453684_0008187
652 Ga0453684_0160155
653 Ga0453684_0418884
654 Ga0451576_0027219
655 Ga0451576_0036385
656 Ga0451576_0069126
657 Ga0451576_0071880
658 Ga0451576_0095008
659 Ga0451576_0114148
660 Ga0495580_0005148
661 Ga0495662_0020723
662 Ga0495630_0013500
663 Ga0495586_0068059
664 Ga0495634_0130220
665 Ga0495635_0143434
666 Ga0495624_0073469
667 Ga0495636_0004675
668 Ga0496102_0385716
669 Ga0496110_0116944
670 Ga0496112_0110515
671 Ga0501031_0014480
672 Ga0501032_0119094
673 Ga0501033_0016683
674 Ga0501033_0033235
675 Ga0501036_0000094
676 Ga0501036_0028511
677 Ga0501037_0012375
678 Ga0501037_0060578
679 Ga0501038_0001660
680 Ga0501038_0008917
681 Ga0501039_0001935
682 Ga0501039_0029090
683 Ga0501039_0040484
684 Ga0501039_0048117
685 Ga0501040_0000163
686 Ga0501040_0002278
687 Ga0501040_0099425
688 Ga0501041_0000062
689 Ga0501041_0020075
690 Ga0501041_0117189
691 Ga0501042_0000141
692 Ga0501042_0000424
693 Ga0501042_0013344
694 Ga0501042_0195435
695 Ga0501043_0004421
696 Ga0501046_0001548
697 Ga0501046_0002744
698 Ga0501046_0015294
699 Ga0501046_0108186
700 Ga0501047_0218846
701 Ga0501047_0227170
702 Ga0501048_0014617
703 Ga0501048_0053290
704 Ga0501048_0071386
705 Ga0501048_0086625
706 Ga0501048_0096784
707 Ga0501068_0001798
708 Ga0501068_0087172
709 Ga0501069_0085625
710 Ga0501071_0000391
711 Ga0501071_0030721
712 Ga0501071_0052836
713 Ga0501071_0064628
714 Ga0501071_0112872
715 Ga0501071_0227877
716 Ga0501072_0000069
717 Ga0501072_0003779
718 Ga0501072_0016181
719 Ga0501072_0070103
720 Ga0501074_0009878
721 Ga0501074_0142890
722 Ga0501074_0181544
723 Ga0501075_0002755
724 Ga0501075_0012856
725 Ga0501075_0025843
726 Ga0501075_0034183
727 Ga0501075_0070756
728 Ga0501075_0072340
729 Ga0501076_0000140
730 Ga0501076_0005700
731 Ga0501076_0006219
732 Ga0501076_0006932
733 Ga0501076_0013719
734 Ga0501076_0118602
735 Ga0501076_0165531
736 Ga0501077_0000870
737 Ga0501077_0018577
738 Ga0501077_0032881
739 Ga0501079_0000060
740 Ga0501079_0003567
741 Ga0501079_0005077
742 Ga0501079_0063520
743 Ga0501079_0143805
744 Ga0501079_0218391
745 Ga0501080_0001483
746 Ga0501080_0043368
747 Ga0501080_0092366
748 Ga0501080_0256085
749 Ga0501081_0000047
750 Ga0501081_0001528
751 Ga0501081_0009962
752 Ga0501081_0013201
753 Ga0501081_0029255
754 Ga0501081_0037629
755 Ga0501081_0155823
756 Ga0501081_0247583
757 Ga0501083_0016323
758 Ga0501083_0040397
759 Ga0501035_0032443
760 Ga0501045_0000004
761 Ga0501045_0002446
762 Ga0501045_0002923
763 Ga0501045_0017999
764 Ga0501045_0182609
765 nmdc:mga03683_707_c1
766 nmdc:mga03n38_70769_c1
767 nmdc:mga05p37_10648_c1
768 nmdc:mga05p37_10895_c1
769 nmdc:mga05p37_141_c1
770 nmdc:mga05p37_179638_c1
771 nmdc:mga05p37_202847_c1
772 nmdc:mga05p37_28229_c1
773 nmdc:mga05p37_3984_c1
774 nmdc:mga05p37_43350_c1
775 nmdc:mga05p37_53009_c1
776 nmdc:mga05p37_590_c1
777 nmdc:mga05p37_78757_c1
778 nmdc:mga05p37_88349_c1
779 nmdc:mga05p37_89401_c1
780 nmdc:mga05p37_98083_c2
781 nmdc:mga09592_132190_c1
782 nmdc:mga09592_143404_c1
783 nmdc:mga09592_145030_c1
784 nmdc:mga09592_15975_c1
785 nmdc:mga09592_191213_c1
786 nmdc:mga09592_1912_c1
787 nmdc:mga09592_23258_c1
788 nmdc:mga09592_24477_c1
789 nmdc:mga09592_2782_c1
790 nmdc:mga09592_41228_c1
791 nmdc:mga09592_66_c1
792 nmdc:mga0qj67_108970_c1
793 nmdc:mga0qj67_124730_c1
794 nmdc:mga0qj67_1580_c1
795 nmdc:mga0qj67_296359_c1
796 nmdc:mga06r32_1360_c1
797 nmdc:mga06r32_2324_c1
798 nmdc:mga06r32_30678_c1
799 nmdc:mga06r32_310507_c1
800 nmdc:mga06r32_3135_c1
801 nmdc:mga06r32_37150_c1
802 nmdc:mga06r32_4554_c1
803 nmdc:mga06r32_5075_c1
804 nmdc:mga06r32_5485_c1
805 nmdc:mga06r32_91661_c1
806 nmdc:mga08y16_118289_c1
807 nmdc:mga08y16_163096_c1
808 nmdc:mga08y16_290928_c1
809 nmdc:mga08y16_4496_c1
810 nmdc:mga08y16_56317_c1
811 nmdc:mga0n895_12043_c1
812 nmdc:mga0n895_17086_c1
813 nmdc:mga0n895_41594_c1
814 nmdc:mga0n895_5289_c1
815 nmdc:mga0n895_667_c1
816 nmdc:mga0n895_77342_c1
817 nmdc:mga0n895_89783_c1
818 nmdc:mga0rr50_6825_c1
819 nmdc:mga0rr50_84485_c1
820 nmdc:mga08x19_367_c1
821 nmdc:mga0a205_121352_c1
822 nmdc:mga0a205_1467_c1
823 nmdc:mga0a205_16321_c1
824 nmdc:mga0a205_34173_c1
825 nmdc:mga0a205_35649_c1
826 nmdc:mga0a205_3810_c1
827 nmdc:mga0a205_3942_c1
828 nmdc:mga0a205_9877_c1
829 Ga0495601_0057273
830 Ga0501084_0000507
831 Ga0501084_0007126
832 Ga0501084_0008785
833 Ga0501084_0021087
834 Ga0501084_0023228
835 Ga0501084_0031402
836 Ga0501084_0234166
837 Ga0501082_0000422
838 Ga0501082_0006080
839 Ga0501082_0023143
840 Ga0501082_0034256
841 Ga0501082_0037844
842 Ga0501082_0134208
843 Ga0501082_0204766
844 Ga0501082_0206736
845 Ga0530510_0000216
846 Ga0530510_0006906
847 Ga0530510_0023150
848 Ga0530510_0035069
849 Ga0530510_0037495
850 Ga0530510_0048997
851 Ga0530510_0093072
852 Ga0530510_0146650
853 2929205940
854 8055912307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

56

347

0.92

PF07690

MFS_1

Major Facilitator Superfamily

296

445

0.9

PF06779

MFS_4

Uncharacterised MFS-type transporter YbfB

58

431

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8928 22 409
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8913 23 408
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8683 22 409
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8541 23 408
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8386 26 411
ID Description Score Start End Superfamily
af_Q7RTY1_9_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9446 22 203 1.20.1250.20
af_A0A0R4IK09_14_317_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9429 25 204 1.20.1250.20
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9365 22 204 1.20.1250.20
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9346 26 204 1.20.1250.20
af_Q8BGC3_15_203_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9275 22 204 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6L7PKC3-F1-model_v4 deleted 0.9772 21 414
AF-A0A2S6U202-F1-model_v4 Putative MFS-type transporter YhjX 0.9687 28 376 GO:0016020
GO:0022857
AF-A0A2E5L866-F1-model_v4 MFS transporter 0.9672 21 419 GO:0016020
GO:0022857
AF-A0A2P5VL68-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9633 21 410 GO:0016020
GO:0022857
AF-A0A7S8IRI3-F1-model_v4 MFS transporter 0.9626 28 420 GO:0016020
GO:0022857

Map