F441235

General Info

Members Datasets Scaffolds Average Seq Length
426 215 852 228

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10008295|Ga0265314_100082955
Length 254
Sequence MASRPSPPATLSPPKPSVTLKVPVHIRVLFFGVLKDVTGCAAGQIELPAGATAGIVFEHYAALFPKLRAMERSILLARNQEFVRPSEPMADNDEIAFLPPVSGGTAAEGDNYFALTREPIDTRALAARLLRGEDGAVVAFEGVVRNNSQGRRTLWLDYECYEPMALKQITALGSEIALTREIGRIAIVHRLGRLEIGETSVAIVVTAPHRRPAFEAALEGIDRLKRTVPIWKKEHFEDGEVWVEGEWDESLRNP

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 97.65
Stem 0
Stem Tuber 0
Unclassified 11.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10008295 3300031711 Bacteria 8914
2 rootL2_10227476 3300003322 Bacteria 1142
3 Ga0065707_10170005 3300005295 Bacteria 1492
4 Ga0070676_10015341 3300005328 Bacteria 4226
5 Ga0070670_100007326 3300005331 Bacteria 9363
6 Ga0068869_100000131 3300005334 Bacteria 36287
7 Ga0070680_100000164 3300005336 Bacteria 41936
8 Ga0070682_100022084 3300005337 Bacteria 3764
9 Ga0070660_100000513 3300005339 Bacteria 25878
10 Ga0070689_100162901 3300005340 Bacteria 1804
11 Ga0070691_10017137 3300005341 Bacteria 3334
12 Ga0070661_100019714 3300005344 Bacteria 4806
13 Ga0070692_10241630 3300005345 Bacteria 1077
14 Ga0070669_100172956 3300005353 Bacteria 1685
15 Ga0070673_100117064 3300005364 Bacteria 2217
16 Ga0070659_100000632 3300005366 Bacteria 25732
17 Ga0070703_10003889 3300005406 Bacteria 4228
18 Ga0070709_10013208 3300005434 Bacteria 4636
19 Ga0070709_10305030 3300005434 Unclassified 1164
20 Ga0070701_10028648 3300005438 Bacteria 2739
21 Ga0070705_100035150 3300005440 Bacteria 2807
22 Ga0070694_100000051 3300005444 Bacteria 54318
23 Ga0070694_100008916 3300005444 Bacteria 6144
24 Ga0070694_100018974 3300005444 Bacteria 4370
25 Ga0070694_100025351 3300005444 Bacteria 3836
26 Ga0070694_100218452 3300005444 Bacteria 1429
27 Ga0070694_100240794 3300005444 Bacteria 1365
28 Ga0070708_100062846 3300005445 Bacteria 3322
29 Ga0070708_100070591 3300005445 Bacteria 3142
30 Ga0070708_100096748 3300005445 Bacteria 2697
31 Ga0070663_100001225 3300005455 Bacteria 14094
32 Ga0070662_100004719 3300005457 Bacteria 8638
33 Ga0070681_10020228 3300005458 Bacteria 6672
34 Ga0070681_10226785 3300005458 Bacteria 1783
35 Ga0068867_100029346 3300005459 Bacteria 3963
36 Ga0070685_10259289 3300005466 Unclassified 1155
37 Ga0070706_100014318 3300005467 Bacteria 7329
38 Ga0070706_100111099 3300005467 Bacteria 2551
39 Ga0070706_100276363 3300005467 Unclassified 1567
40 Ga0070706_100375245 3300005467 Bacteria 1325
41 Ga0070707_100013941 3300005468 Bacteria 7529
42 Ga0070707_100058180 3300005468 Bacteria 3707
43 Ga0070707_100327517 3300005468 Bacteria 1488
44 Ga0070707_100667896 3300005468 Bacteria 1002
45 Ga0070698_100001487 3300005471 Bacteria 26039
46 Ga0070698_100034344 3300005471 Bacteria 5249
47 Ga0070698_100087749 3300005471 Bacteria 3096
48 Ga0070698_100662095 3300005471 Bacteria 985
49 Ga0070699_100002290 3300005518 Bacteria 17227
50 Ga0070699_100006696 3300005518 Bacteria 10023
51 Ga0070699_100031750 3300005518 Bacteria 4560
52 Ga0070699_100043366 3300005518 Bacteria 3894
53 Ga0070699_100249406 3300005518 Bacteria 1586
54 Ga0070684_100138863 3300005535 Bacteria 2196
55 Ga0070697_100012706 3300005536 Bacteria 6595
56 Ga0070672_100007971 3300005543 Bacteria 7237
57 Ga0070686_100140283 3300005544 Bacteria 1682
58 Ga0070695_100001065 3300005545 Bacteria 15000
59 Ga0070695_100008708 3300005545 Bacteria 6030
60 Ga0070695_100031176 3300005545 Bacteria 3323
61 Ga0070695_100577610 3300005545 Bacteria 879
62 Ga0070696_100004606 3300005546 Bacteria 9205
63 Ga0070696_100140745 3300005546 Bacteria 1763
64 Ga0070704_100000254 3300005549 Bacteria 23085
65 Ga0070704_100019376 3300005549 Bacteria 4371
66 Ga0070704_100045065 3300005549 Bacteria 3067
67 Ga0070704_100127258 3300005549 Bacteria 1968
68 Ga0070704_100346366 3300005549 Bacteria 1253
69 Ga0068855_100008261 3300005563 Bacteria 12583
70 Ga0070664_100037146 3300005564 Bacteria 4093
71 Ga0068854_100000388 3300005578 Bacteria 27607
72 Ga0068856_100005218 3300005614 Bacteria 12818
73 Ga0070702_100011046 3300005615 Bacteria 4480
74 Ga0068859_100024991 3300005617 Bacteria 5996
75 Ga0068859_100043163 3300005617 Bacteria 4531
76 Ga0068859_100440347 3300005617 Bacteria 1399
77 Ga0068859_100492963 3300005617 Bacteria 1320
78 Ga0068859_100622873 3300005617 Bacteria 1172
79 Ga0068864_100001528 3300005618 Bacteria 19040
80 Ga0068861_100016720 3300005719 Bacteria 5197
81 Ga0068863_100011183 3300005841 Bacteria 8698
82 Ga0068858_100025234 3300005842 Bacteria 5532
83 Ga0068860_100007060 3300005843 Bacteria 11243
84 Ga0068862_100001179 3300005844 Bacteria 24639
85 Ga0068862_100015212 3300005844 Bacteria 6389
86 Ga0068862_100182505 3300005844 Bacteria 1884
87 Ga0081455_10000319 3300005937 Bacteria 62852
88 Ga0081455_10335848 3300005937 Unclassified 1071
89 Ga0070716_100044309 3300006173 Bacteria 2492
90 Ga0075428_100003817 3300006844 Bacteria 16536
91 Ga0075428_100668778 3300006844 Bacteria 1107
92 Ga0075430_100000005 3300006846 Bacteria 108528
93 Ga0075430_100011754 3300006846 Bacteria 7453
94 Ga0075430_100096505 3300006846 Bacteria 2471
95 Ga0075430_100178983 3300006846 Bacteria 1764
96 Ga0075431_100000181 3300006847 Bacteria 45325
97 Ga0075431_100006810 3300006847 Bacteria 11352
98 Ga0075431_100139445 3300006847 Unclassified 2500
99 Ga0075431_100213610 3300006847 Bacteria 1970
100 Ga0075431_100292113 3300006847 Bacteria 1648
101 Ga0075433_10042487 3300006852 Bacteria 3944
102 Ga0075433_10103671 3300006852 Bacteria 2520
103 Ga0075433_10149115 3300006852 Bacteria 2080
104 Ga0075434_100001352 3300006871 Bacteria 20583
105 Ga0075434_100010826 3300006871 Bacteria 8572
106 Ga0075434_100169726 3300006871 Unclassified 2202
107 Ga0075434_100638497 3300006871 Bacteria 1083
108 Ga0075429_100000346 3300006880 Bacteria 33783
109 Ga0075429_100005894 3300006880 Bacteria 10577
110 Ga0075429_100016517 3300006880 Bacteria 6395
111 Ga0075429_100515434 3300006880 Bacteria 1048
112 Ga0097620_100024990 3300006931 Bacteria 5996
113 Ga0097620_100043162 3300006931 Bacteria 4531
114 Ga0097620_100440312 3300006931 Bacteria 1399
115 Ga0097620_100493000 3300006931 Bacteria 1320
116 Ga0097620_100622817 3300006931 Bacteria 1172
117 Ga0075435_100028813 3300007076 Bacteria 4356
118 Ga0075435_100052908 3300007076 Bacteria 3272
119 Ga0075435_100298424 3300007076 Bacteria 1378
120 Ga0099794_10123620 3300007265 Bacteria 1303
121 Ga0105240_10201725 3300009093 Bacteria 2330
122 Ga0111539_10195846 3300009094 Bacteria 2357
123 Ga0111539_11669440 3300009094 Bacteria 739
124 Ga0114129_10022795 3300009147 Bacteria 8877
125 Ga0114129_10042738 3300009147 Bacteria 6379
126 Ga0114129_10100930 3300009147 Bacteria 3993
127 Ga0114129_10116055 3300009147 Unclassified 3689
128 Ga0114129_10215851 3300009147 Bacteria 2591
129 Ga0114129_10428145 3300009147 Unclassified 1739
130 Ga0114129_10468699 3300009147 Unclassified 1650
131 Ga0114129_10472122 3300009147 Unclassified 1642
132 Ga0114129_10529084 3300009147 Bacteria 1536
133 Ga0105241_10001332 3300009174 Bacteria 18756
134 Ga0105248_10048688 3300009177 Bacteria 4754
135 Ga0105249_10256311 3300009553 Bacteria 1736
136 Ga0105239_10618328 3300010375 Bacteria 1236
137 Ga0157373_10000676 3300013100 Bacteria 26705
138 Ga0157371_10161690 3300013102 Bacteria 1599
139 Ga0157370_10395827 3300013104 Unclassified 1272
140 Ga0157369_10016826 3300013105 Bacteria 8218
141 Ga0163162_10262243 3300013306 Bacteria 1860
142 Ga0157372_10000488 3300013307 Bacteria 43720
143 Ga0157372_10500772 3300013307 Bacteria 1417
144 Ga0157375_10239767 3300013308 Bacteria 1973
145 Ga0163163_10184798 3300014325 Bacteria 2132
146 Ga0206354_11101795 3300020081 Unclassified 1752
147 Ga0213873_10020398 3300021358 Unclassified 1548
148 Ga0213874_10011525 3300021377 Unclassified 2243
149 Ga0207653_10001969 3300025885 Bacteria 6576
150 Ga0207699_10027219 3300025906 Bacteria 3163
151 Ga0207699_10032496 3300025906 Bacteria 2941
152 Ga0207645_10000149 3300025907 Bacteria 54978
153 Ga0207643_10001005 3300025908 Bacteria 16805
154 Ga0207684_10000551 3300025910 Bacteria 46114
155 Ga0207684_10053194 3300025910 Bacteria 3437
156 Ga0207684_10053448 3300025910 Bacteria 3428
157 Ga0207684_10062740 3300025910 Bacteria 3155
158 Ga0207684_10561241 3300025910 Bacteria 976
159 Ga0207707_10000448 3300025912 Bacteria 42902
160 Ga0207707_10210285 3300025912 Bacteria 1695
161 Ga0207663_10148097 3300025916 Bacteria 1643
162 Ga0207660_10000157 3300025917 Bacteria 42274
163 Ga0207662_10123779 3300025918 Bacteria 1624
164 Ga0207662_10160593 3300025918 Unclassified 1435
165 Ga0207657_10000332 3300025919 Bacteria 50089
166 Ga0207649_10056324 3300025920 Bacteria 2454
167 Ga0207652_10000519 3300025921 Bacteria 39077
168 Ga0207646_10001189 3300025922 Bacteria 32786
169 Ga0207646_10017521 3300025922 Bacteria 6701
170 Ga0207646_10040893 3300025922 Bacteria 4168
171 Ga0207646_10102718 3300025922 Bacteria 2563
172 Ga0207646_10145897 3300025922 Bacteria 2133
173 Ga0207690_10010271 3300025932 Bacteria 5560
174 Ga0207706_10002143 3300025933 Bacteria 19305
175 Ga0207670_10098627 3300025936 Bacteria 2082
176 Ga0207665_10068355 3300025939 Bacteria 2421
177 Ga0207691_10013526 3300025940 Bacteria 7805
178 Ga0207711_10028167 3300025941 Bacteria 4726
179 Ga0207689_10000047 3300025942 Bacteria 91275
180 Ga0207679_10007792 3300025945 Bacteria 6806
181 Ga0207667_10002507 3300025949 Bacteria 22890
182 Ga0207667_10374296 3300025949 Unclassified 1451
183 Ga0207712_10050653 3300025961 Bacteria 2901
184 Ga0207668_10172194 3300025972 Bacteria 1699
185 Ga0207640_10336676 3300025981 Bacteria 1207
186 Ga0207703_10016721 3300026035 Bacteria 5721
187 Ga0207639_10730919 3300026041 Bacteria 919
188 Ga0207678_10002684 3300026067 Bacteria 16140
189 Ga0207708_10177224 3300026075 Bacteria 1691
190 Ga0207702_10010175 3300026078 Bacteria 7873
191 Ga0207648_10009045 3300026089 Bacteria 9581
192 Ga0207648_10369560 3300026089 Bacteria 1295
193 Ga0207648_10425329 3300026089 Bacteria 1206
194 Ga0207676_10026855 3300026095 Bacteria 4283
195 Ga0207676_10381342 3300026095 Bacteria 1312
196 Ga0207674_10000431 3300026116 Bacteria 54718
197 Ga0207674_10369488 3300026116 Bacteria 1386
198 Ga0207675_100000989 3300026118 Bacteria 28178
199 Ga0207675_100201250 3300026118 Bacteria 1913
200 Ga0207698_10105683 3300026142 Bacteria 2346
201 Ga0209969_1000928 3300027360 Bacteria 3962
202 Ga0209967_1001177 3300027364 Bacteria 3343
203 Ga0209981_1006035 3300027378 Bacteria 1618
204 Ga0209995_1002527 3300027471 Bacteria 2896
205 Ga0209968_1000386 3300027526 Bacteria 7191
206 Ga0209982_1003301 3300027552 Bacteria 2288
207 Ga0209970_1006478 3300027614 Bacteria 1922
208 Ga0209983_1000163 3300027665 Bacteria 12542
209 Ga0209971_1000006 3300027682 Bacteria 107602
210 Ga0209966_1000285 3300027695 Bacteria 17320
211 Ga0209998_10000080 3300027717 Bacteria 37627
212 Ga0209974_10001692 3300027876 Bacteria 7991
213 Ga0209974_10026761 3300027876 Unclassified 1908
214 Ga0268266_10517900 3300028379 Bacteria 1140
215 Ga0268265_10005449 3300028380 Bacteria 8695
216 Ga0268265_10024949 3300028380 Bacteria 4237
217 Ga0268265_10065532 3300028380 Bacteria 2804
218 Ga0268265_10164669 3300028380 Bacteria 1888
219 Ga0268264_10015573 3300028381 Bacteria 6233
220 Ga0268264_10092296 3300028381 Bacteria 2613
221 Ga0265323_10000102 3300028653 Bacteria 48958
222 Ga0265336_10017017 3300028666 Bacteria 2370
223 Ga0265338_10011854 3300028800 Bacteria 10017
224 Ga0265332_10120841 3300031238 Bacteria 1100
225 Ga0265340_10030658 3300031247 Bacteria 2695
226 Ga0265339_10104971 3300031249 Bacteria 1467
227 Ga0265331_10063266 3300031250 Bacteria 1743
228 Ga0265316_10009239 3300031344 Bacteria 9078
229 Ga0265316_10024981 3300031344 Bacteria 4993
230 Ga0265316_10052049 3300031344 Bacteria 3214
231 Ga0265316_10077438 3300031344 Bacteria 2554
232 Ga0265316_10283962 3300031344 Bacteria 1209
233 Ga0307408_100169676 3300031548 Bacteria 1741
234 Ga0307408_100340183 3300031548 Unclassified 1270
235 Ga0265342_10011119 3300031712 Bacteria 6179
236 Ga0307410_10226176 3300031852 Bacteria 1442
237 Ga0307406_10030168 3300031901 Bacteria 3290
238 Ga0307409_100862135 3300031995 Bacteria 917
239 Ga0307416_100216970 3300032002 Bacteria 1831
240 Ga0307414_10723161 3300032004 Unclassified 903
241 Ga0373948_0019878 3300034817 Unclassified 1274
242 Ga0373959_0006295 3300034820 Bacteria 1966
243 Ga0373929_0062777 3300035085 Unclassified 873
244 Ga0373940_0045191 3300035088 Bacteria 1222
245 Ga0373949_0006097 3300035090 Bacteria 2668
246 Ga0373949_0014883 3300035090 Bacteria 1735
247 Ga0373951_0014796 3300035091 Bacteria 1755
248 Ga0373931_0000680 3300035691 Bacteria 14110
249 Ga0373931_0095642 3300035691 Bacteria 1663
250 Ga0395900_0009505 3300037418 Bacteria 9969
251 Ga0395898_0016146 3300037466 Bacteria 7646
252 Ga0395901_0063650 3300038443 Bacteria 3839
253 Ga0395901_0497865 3300038443 Bacteria 1241
254 Ga0436365_0522698 3300039437 Unclassified 1661
255 Ga0436360_0945062 3300039438 Unclassified 1766
256 Ga0436363_0964036 3300039450 Bacteria 2962
257 Ga0436362_0097696 3300039453 Bacteria 9529
258 Ga0439448_0016306 3300042005 Bacteria 2260
259 Ga0439450_012117 3300042008 Bacteria 1705
260 Ga0439455_0031315 3300042012 Unclassified 1324
261 Ga0439463_067237 3300042016 Bacteria 917
262 Ga0439446_0053221 3300042156 Unclassified 1212
263 Ga0439458_0004163 3300042157 Bacteria 3339
264 Ga0439459_0054713 3300042438 Unclassified 886
265 Ga0439459_0089842 3300042438 Unclassified 737
266 Ga0439464_0004882 3300042439 Bacteria 3441
267 Ga0439460_0003314 3300042461 Bacteria 3899
268 Ga0439460_0261699 3300042461 Unclassified 599
269 Ga0451577_0024508 3300042876 Bacteria 5488
270 Ga0451577_0050821 3300042876 Bacteria 3700
271 Ga0451577_0152283 3300042876 Bacteria 2081
272 Ga0451577_0324516 3300042876 Bacteria 1396
273 Ga0453683_0010380 3300044673 Bacteria 6172
274 Ga0453683_0034171 3300044673 Bacteria 3205
275 Ga0453684_0165840 3300044712 Bacteria 2608
276 Ga0453684_0221854 3300044712 Bacteria 2189
277 Ga0453684_0239435 3300044712 Bacteria 2090
278 Ga0453684_0348451 3300044712 Unclassified 1671
279 Ga0453684_0585999 3300044712 Bacteria 1224
280 Ga0451576_0042963 3300045051 Bacteria 4771
281 Ga0451576_0114670 3300045051 Bacteria 2805
282 Ga0451576_0182305 3300045051 Bacteria 2192
283 Ga0451576_0191635 3300045051 Bacteria 2135
284 Ga0451576_0914254 3300045051 Unclassified 920
285 Ga0451576_1106633 3300045051 Bacteria 829
286 Ga0451576_1331491 3300045051 Bacteria 748
287 Ga0495580_0111857 3300046472 Bacteria 1896
288 Ga0495636_0152890 3300047318 Bacteria 1036
289 Ga0496102_0142687 3300048905 Bacteria 2246
290 Ga0496102_0251067 3300048905 Unclassified 1668
291 Ga0496103_0256187 3300048906 Unclassified 1126
292 Ga0496110_0067211 3300048913 Bacteria 3172
293 Ga0496110_0725760 3300048913 Bacteria 896
294 Ga0496112_0194152 3300048915 Bacteria 1991
295 Ga0501031_0172391 3300049568 Bacteria 1414
296 Ga0501033_0184460 3300049570 Bacteria 1495
297 Ga0501033_0214303 3300049570 Unclassified 1373
298 Ga0501034_0396357 3300049571 Bacteria 1304
299 Ga0501037_0181379 3300049573 Unclassified 1494
300 Ga0501038_0075775 3300049574 Unclassified 2843
301 Ga0501038_0082834 3300049574 Bacteria 2701
302 Ga0501038_0229007 3300049574 Bacteria 1480
303 Ga0501038_0509192 3300049574 Bacteria 920
304 Ga0501039_0091925 3300049575 Bacteria 2365
305 Ga0501040_0002328 3300049576 Bacteria 12209
306 Ga0501040_0145918 3300049576 Bacteria 1668
307 Ga0501040_0164086 3300049576 Bacteria 1571
308 Ga0501040_0189402 3300049576 Unclassified 1459
309 Ga0501040_0246555 3300049576 Bacteria 1274
310 Ga0501041_0002534 3300049577 Bacteria 10410
311 Ga0501041_0016175 3300049577 Bacteria 4432
312 Ga0501041_0186956 3300049577 Unclassified 1297
313 Ga0501042_0003151 3300049578 Bacteria 10282
314 Ga0501042_0020761 3300049578 Bacteria 4573
315 Ga0501042_0085176 3300049578 Bacteria 2266
316 Ga0501042_0121436 3300049578 Bacteria 1881
317 Ga0501042_0431615 3300049578 Bacteria 955
318 Ga0501043_0241906 3300049579 Bacteria 1392
319 Ga0501046_0003093 3300049580 Bacteria 15369
320 Ga0501046_0163690 3300049580 Unclassified 1672
321 Ga0501046_0216005 3300049580 Bacteria 1422
322 Ga0501046_0273996 3300049580 Bacteria 1237
323 Ga0501046_0382430 3300049580 Bacteria 1019
324 Ga0501048_0198877 3300049582 Bacteria 1420
325 Ga0501048_0253298 3300049582 Bacteria 1250
326 Ga0501067_0099384 3300049583 Bacteria 1616
327 Ga0501067_0120837 3300049583 Bacteria 1458
328 Ga0501068_0034461 3300049584 Bacteria 3019
329 Ga0501068_0189650 3300049584 Bacteria 1302
330 Ga0501068_0242064 3300049584 Unclassified 1148
331 Ga0501071_0131021 3300049587 Bacteria 1863
332 Ga0501071_0392190 3300049587 Unclassified 1059
333 Ga0501072_0045727 3300049588 Bacteria 3443
334 Ga0501072_0084493 3300049588 Bacteria 2517
335 Ga0501072_0186490 3300049588 Bacteria 1654
336 Ga0501072_0583837 3300049588 Unclassified 881
337 Ga0501073_0350272 3300049589 Bacteria 1020
338 Ga0501074_0000817 3300049590 Bacteria 19750
339 Ga0501074_0505816 3300049590 Bacteria 856
340 Ga0501075_0024538 3300049591 Bacteria 4423
341 Ga0501075_0026515 3300049591 Unclassified 4267
342 Ga0501075_0067239 3300049591 Bacteria 2706
343 Ga0501076_0003002 3300049592 Bacteria 11721
344 Ga0501076_0056580 3300049592 Bacteria 3113
345 Ga0501076_0058157 3300049592 Bacteria 3072
346 Ga0501076_0158961 3300049592 Bacteria 1840
347 Ga0501076_0367046 3300049592 Bacteria 1183
348 Ga0501076_0503640 3300049592 Unclassified 998
349 Ga0501077_0013958 3300049593 Bacteria 5037
350 Ga0501077_0019696 3300049593 Unclassified 4268
351 Ga0501077_0065769 3300049593 Bacteria 2299
352 Ga0501077_0075720 3300049593 Bacteria 2131
353 Ga0501079_0000064 3300049741 Bacteria 47953
354 Ga0501079_0041699 3300049741 Bacteria 3544
355 Ga0501079_0100293 3300049741 Bacteria 2245
356 Ga0501079_0357850 3300049741 Bacteria 1144
357 Ga0501079_0390396 3300049741 Bacteria 1091
358 Ga0501079_0540691 3300049741 Bacteria 916
359 Ga0501080_0467605 3300049742 Unclassified 1129
360 Ga0501080_0664753 3300049742 Bacteria 921
361 Ga0501081_0000139 3300049743 Bacteria 32505
362 Ga0501081_0008644 3300049743 Bacteria 6615
363 Ga0501081_0055954 3300049743 Bacteria 2725
364 Ga0501081_0199393 3300049743 Bacteria 1451
365 Ga0501081_0349179 3300049743 Bacteria 1090
366 Ga0501081_0350349 3300049743 Bacteria 1088
367 Ga0501083_0001124 3300049744 Bacteria 17915
368 Ga0501035_0107579 3300049822 Unclassified 2445
369 Ga0501035_0110498 3300049822 Bacteria 2409
370 Ga0501035_0275804 3300049822 Bacteria 1422
371 Ga0501045_0001026 3300049824 Bacteria 18356
372 Ga0501045_0013837 3300049824 Bacteria 5706
373 Ga0501045_0698635 3300049824 Bacteria 748
374 nmdc:mga05p37_189259_c1 3300050507 Bacteria 2500
375 nmdc:mga05p37_196751_c1 3300050507 Bacteria 2444
376 nmdc:mga05p37_20795_c1 3300050507 Bacteria 7942
377 nmdc:mga05p37_23979_c1 3300050507 Bacteria 7409
378 nmdc:mga05p37_27968_c1 3300050507 Bacteria 6869
379 nmdc:mga05p37_28236_c1 3300050507 Bacteria 6841
380 nmdc:mga05p37_37567_c1 3300050507 Bacteria 5938
381 nmdc:mga05p37_44540_c1 3300050507 Bacteria 5458
382 nmdc:mga05p37_493210_c1 3300050507 Bacteria 1408
383 nmdc:mga05p37_556206_c1 3300050507 Bacteria 1305
384 nmdc:mga05p37_66645_c1 3300050507 Bacteria 4428
385 nmdc:mga05p37_748451_c1 3300050507 Unclassified 1078
386 nmdc:mga09592_253_c1 3300050508 Bacteria 39042
387 nmdc:mga09592_6899_c1 3300050508 Bacteria 9235
388 nmdc:mga09592_93440_c1 3300050508 Bacteria 2572
389 nmdc:mga0qj67_324541_c1 3300050509 Bacteria 1246
390 nmdc:mga0qj67_3619_c1 3300050509 Bacteria 11152
391 nmdc:mga0qj67_80543_c1 3300050509 Bacteria 2609
392 nmdc:mga0qj67_982681_c1 3300050509 Bacteria 663
393 nmdc:mga06r32_12438_c1 3300050510 Bacteria 7681
394 nmdc:mga06r32_1838_c1 3300050510 Bacteria 18934
395 nmdc:mga06r32_269852_c1 3300050510 Bacteria 1689
396 nmdc:mga06r32_34614_c1 3300050510 Bacteria 4764
397 nmdc:mga06r32_420105_c1 3300050510 Bacteria 1318
398 nmdc:mga0n895_269591_c1 3300050512 Unclassified 1727
399 nmdc:mga0n895_545700_c1 3300050512 Unclassified 1165
400 nmdc:mga0n895_753910_c1 3300050512 Unclassified 966
401 nmdc:mga0rr50_147399_c1 3300050513 Bacteria 1899
402 nmdc:mga0rr50_27643_c1 3300050513 Bacteria 3976
403 nmdc:mga08x19_13571_c1 3300050514 Bacteria 4927
404 nmdc:mga08x19_57079_c1 3300050514 Bacteria 2522
405 nmdc:mga0a205_13653_c1 3300050515 Bacteria 7567
406 nmdc:mga0a205_154444_c1 3300050515 Bacteria 2194
407 nmdc:mga0a205_27192_c1 3300050515 Bacteria 5463
408 nmdc:mga0a205_46202_c1 3300050515 Bacteria 4199
409 nmdc:mga0a205_77105_c1 3300050515 Bacteria 3221
410 Ga0501084_0007730 3300054114 Bacteria 8854
411 Ga0501084_0011317 3300054114 Bacteria 7388
412 Ga0501084_0084017 3300054114 Bacteria 2673
413 Ga0501084_0126193 3300054114 Bacteria 2153
414 Ga0501084_0283011 3300054114 Bacteria 1400
415 Ga0501084_0697448 3300054114 Bacteria 856
416 Ga0501082_0000456 3300060353 Bacteria 36226
417 Ga0501082_0000526 3300060353 Bacteria 34036
418 Ga0501082_0102090 3300060353 Bacteria 2481
419 Ga0501082_0205267 3300060353 Bacteria 1714
420 Ga0530510_0000479 3300061734 Bacteria 25666
421 Ga0530510_0026045 3300061734 Bacteria 4183
422 Ga0530510_0035146 3300061734 Bacteria 3611
423 Ga0530510_0140661 3300061734 Bacteria 1778
424 Ga0530510_0172364 3300061734 Bacteria 1603
425 Ga0530510_0199072 3300061734 Bacteria 1487
426 Ga0530510_0230773 3300061734 Bacteria 1377
427 Ga0265314_10008295
428 rootL2_10227476
429 Ga0065707_10170005
430 Ga0070676_10015341
431 Ga0070670_100007326
432 Ga0068869_100000131
433 Ga0070680_100000164
434 Ga0070682_100022084
435 Ga0070660_100000513
436 Ga0070689_100162901
437 Ga0070691_10017137
438 Ga0070661_100019714
439 Ga0070692_10241630
440 Ga0070669_100172956
441 Ga0070673_100117064
442 Ga0070659_100000632
443 Ga0070703_10003889
444 Ga0070709_10013208
445 Ga0070709_10305030
446 Ga0070701_10028648
447 Ga0070705_100035150
448 Ga0070694_100000051
449 Ga0070694_100008916
450 Ga0070694_100018974
451 Ga0070694_100025351
452 Ga0070694_100218452
453 Ga0070694_100240794
454 Ga0070708_100062846
455 Ga0070708_100070591
456 Ga0070708_100096748
457 Ga0070663_100001225
458 Ga0070662_100004719
459 Ga0070681_10020228
460 Ga0070681_10226785
461 Ga0068867_100029346
462 Ga0070685_10259289
463 Ga0070706_100014318
464 Ga0070706_100111099
465 Ga0070706_100276363
466 Ga0070706_100375245
467 Ga0070707_100013941
468 Ga0070707_100058180
469 Ga0070707_100327517
470 Ga0070707_100667896
471 Ga0070698_100001487
472 Ga0070698_100034344
473 Ga0070698_100087749
474 Ga0070698_100662095
475 Ga0070699_100002290
476 Ga0070699_100006696
477 Ga0070699_100031750
478 Ga0070699_100043366
479 Ga0070699_100249406
480 Ga0070684_100138863
481 Ga0070697_100012706
482 Ga0070672_100007971
483 Ga0070686_100140283
484 Ga0070695_100001065
485 Ga0070695_100008708
486 Ga0070695_100031176
487 Ga0070695_100577610
488 Ga0070696_100004606
489 Ga0070696_100140745
490 Ga0070704_100000254
491 Ga0070704_100019376
492 Ga0070704_100045065
493 Ga0070704_100127258
494 Ga0070704_100346366
495 Ga0068855_100008261
496 Ga0070664_100037146
497 Ga0068854_100000388
498 Ga0068856_100005218
499 Ga0070702_100011046
500 Ga0068859_100024991
501 Ga0068859_100043163
502 Ga0068859_100440347
503 Ga0068859_100492963
504 Ga0068859_100622873
505 Ga0068864_100001528
506 Ga0068861_100016720
507 Ga0068863_100011183
508 Ga0068858_100025234
509 Ga0068860_100007060
510 Ga0068862_100001179
511 Ga0068862_100015212
512 Ga0068862_100182505
513 Ga0081455_10000319
514 Ga0081455_10335848
515 Ga0070716_100044309
516 Ga0075428_100003817
517 Ga0075428_100668778
518 Ga0075430_100000005
519 Ga0075430_100011754
520 Ga0075430_100096505
521 Ga0075430_100178983
522 Ga0075431_100000181
523 Ga0075431_100006810
524 Ga0075431_100139445
525 Ga0075431_100213610
526 Ga0075431_100292113
527 Ga0075433_10042487
528 Ga0075433_10103671
529 Ga0075433_10149115
530 Ga0075434_100001352
531 Ga0075434_100010826
532 Ga0075434_100169726
533 Ga0075434_100638497
534 Ga0075429_100000346
535 Ga0075429_100005894
536 Ga0075429_100016517
537 Ga0075429_100515434
538 Ga0097620_100024990
539 Ga0097620_100043162
540 Ga0097620_100440312
541 Ga0097620_100493000
542 Ga0097620_100622817
543 Ga0075435_100028813
544 Ga0075435_100052908
545 Ga0075435_100298424
546 Ga0099794_10123620
547 Ga0105240_10201725
548 Ga0111539_10195846
549 Ga0111539_11669440
550 Ga0114129_10022795
551 Ga0114129_10042738
552 Ga0114129_10100930
553 Ga0114129_10116055
554 Ga0114129_10215851
555 Ga0114129_10428145
556 Ga0114129_10468699
557 Ga0114129_10472122
558 Ga0114129_10529084
559 Ga0105241_10001332
560 Ga0105248_10048688
561 Ga0105249_10256311
562 Ga0105239_10618328
563 Ga0157373_10000676
564 Ga0157371_10161690
565 Ga0157370_10395827
566 Ga0157369_10016826
567 Ga0163162_10262243
568 Ga0157372_10000488
569 Ga0157372_10500772
570 Ga0157375_10239767
571 Ga0163163_10184798
572 Ga0206354_11101795
573 Ga0213873_10020398
574 Ga0213874_10011525
575 Ga0207653_10001969
576 Ga0207699_10027219
577 Ga0207699_10032496
578 Ga0207645_10000149
579 Ga0207643_10001005
580 Ga0207684_10000551
581 Ga0207684_10053194
582 Ga0207684_10053448
583 Ga0207684_10062740
584 Ga0207684_10561241
585 Ga0207707_10000448
586 Ga0207707_10210285
587 Ga0207663_10148097
588 Ga0207660_10000157
589 Ga0207662_10123779
590 Ga0207662_10160593
591 Ga0207657_10000332
592 Ga0207649_10056324
593 Ga0207652_10000519
594 Ga0207646_10001189
595 Ga0207646_10017521
596 Ga0207646_10040893
597 Ga0207646_10102718
598 Ga0207646_10145897
599 Ga0207690_10010271
600 Ga0207706_10002143
601 Ga0207670_10098627
602 Ga0207665_10068355
603 Ga0207691_10013526
604 Ga0207711_10028167
605 Ga0207689_10000047
606 Ga0207679_10007792
607 Ga0207667_10002507
608 Ga0207667_10374296
609 Ga0207712_10050653
610 Ga0207668_10172194
611 Ga0207640_10336676
612 Ga0207703_10016721
613 Ga0207639_10730919
614 Ga0207678_10002684
615 Ga0207708_10177224
616 Ga0207702_10010175
617 Ga0207648_10009045
618 Ga0207648_10369560
619 Ga0207648_10425329
620 Ga0207676_10026855
621 Ga0207676_10381342
622 Ga0207674_10000431
623 Ga0207674_10369488
624 Ga0207675_100000989
625 Ga0207675_100201250
626 Ga0207698_10105683
627 Ga0209969_1000928
628 Ga0209967_1001177
629 Ga0209981_1006035
630 Ga0209995_1002527
631 Ga0209968_1000386
632 Ga0209982_1003301
633 Ga0209970_1006478
634 Ga0209983_1000163
635 Ga0209971_1000006
636 Ga0209966_1000285
637 Ga0209998_10000080
638 Ga0209974_10001692
639 Ga0209974_10026761
640 Ga0268266_10517900
641 Ga0268265_10005449
642 Ga0268265_10024949
643 Ga0268265_10065532
644 Ga0268265_10164669
645 Ga0268264_10015573
646 Ga0268264_10092296
647 Ga0265323_10000102
648 Ga0265336_10017017
649 Ga0265338_10011854
650 Ga0265332_10120841
651 Ga0265340_10030658
652 Ga0265339_10104971
653 Ga0265331_10063266
654 Ga0265316_10009239
655 Ga0265316_10024981
656 Ga0265316_10052049
657 Ga0265316_10077438
658 Ga0265316_10283962
659 Ga0307408_100169676
660 Ga0307408_100340183
661 Ga0265342_10011119
662 Ga0307410_10226176
663 Ga0307406_10030168
664 Ga0307409_100862135
665 Ga0307416_100216970
666 Ga0307414_10723161
667 Ga0373948_0019878
668 Ga0373959_0006295
669 Ga0373929_0062777
670 Ga0373940_0045191
671 Ga0373949_0006097
672 Ga0373949_0014883
673 Ga0373951_0014796
674 Ga0373931_0000680
675 Ga0373931_0095642
676 Ga0395900_0009505
677 Ga0395898_0016146
678 Ga0395901_0063650
679 Ga0395901_0497865
680 Ga0436365_0522698
681 Ga0436360_0945062
682 Ga0436363_0964036
683 Ga0436362_0097696
684 Ga0439448_0016306
685 Ga0439450_012117
686 Ga0439455_0031315
687 Ga0439463_067237
688 Ga0439446_0053221
689 Ga0439458_0004163
690 Ga0439459_0054713
691 Ga0439459_0089842
692 Ga0439464_0004882
693 Ga0439460_0003314
694 Ga0439460_0261699
695 Ga0451577_0024508
696 Ga0451577_0050821
697 Ga0451577_0152283
698 Ga0451577_0324516
699 Ga0453683_0010380
700 Ga0453683_0034171
701 Ga0453684_0165840
702 Ga0453684_0221854
703 Ga0453684_0239435
704 Ga0453684_0348451
705 Ga0453684_0585999
706 Ga0451576_0042963
707 Ga0451576_0114670
708 Ga0451576_0182305
709 Ga0451576_0191635
710 Ga0451576_0914254
711 Ga0451576_1106633
712 Ga0451576_1331491
713 Ga0495580_0111857
714 Ga0495636_0152890
715 Ga0496102_0142687
716 Ga0496102_0251067
717 Ga0496103_0256187
718 Ga0496110_0067211
719 Ga0496110_0725760
720 Ga0496112_0194152
721 Ga0501031_0172391
722 Ga0501033_0184460
723 Ga0501033_0214303
724 Ga0501034_0396357
725 Ga0501037_0181379
726 Ga0501038_0075775
727 Ga0501038_0082834
728 Ga0501038_0229007
729 Ga0501038_0509192
730 Ga0501039_0091925
731 Ga0501040_0002328
732 Ga0501040_0145918
733 Ga0501040_0164086
734 Ga0501040_0189402
735 Ga0501040_0246555
736 Ga0501041_0002534
737 Ga0501041_0016175
738 Ga0501041_0186956
739 Ga0501042_0003151
740 Ga0501042_0020761
741 Ga0501042_0085176
742 Ga0501042_0121436
743 Ga0501042_0431615
744 Ga0501043_0241906
745 Ga0501046_0003093
746 Ga0501046_0163690
747 Ga0501046_0216005
748 Ga0501046_0273996
749 Ga0501046_0382430
750 Ga0501048_0198877
751 Ga0501048_0253298
752 Ga0501067_0099384
753 Ga0501067_0120837
754 Ga0501068_0034461
755 Ga0501068_0189650
756 Ga0501068_0242064
757 Ga0501071_0131021
758 Ga0501071_0392190
759 Ga0501072_0045727
760 Ga0501072_0084493
761 Ga0501072_0186490
762 Ga0501072_0583837
763 Ga0501073_0350272
764 Ga0501074_0000817
765 Ga0501074_0505816
766 Ga0501075_0024538
767 Ga0501075_0026515
768 Ga0501075_0067239
769 Ga0501076_0003002
770 Ga0501076_0056580
771 Ga0501076_0058157
772 Ga0501076_0158961
773 Ga0501076_0367046
774 Ga0501076_0503640
775 Ga0501077_0013958
776 Ga0501077_0019696
777 Ga0501077_0065769
778 Ga0501077_0075720
779 Ga0501079_0000064
780 Ga0501079_0041699
781 Ga0501079_0100293
782 Ga0501079_0357850
783 Ga0501079_0390396
784 Ga0501079_0540691
785 Ga0501080_0467605
786 Ga0501080_0664753
787 Ga0501081_0000139
788 Ga0501081_0008644
789 Ga0501081_0055954
790 Ga0501081_0199393
791 Ga0501081_0349179
792 Ga0501081_0350349
793 Ga0501083_0001124
794 Ga0501035_0107579
795 Ga0501035_0110498
796 Ga0501035_0275804
797 Ga0501045_0001026
798 Ga0501045_0013837
799 Ga0501045_0698635
800 nmdc:mga05p37_189259_c1
801 nmdc:mga05p37_196751_c1
802 nmdc:mga05p37_20795_c1
803 nmdc:mga05p37_23979_c1
804 nmdc:mga05p37_27968_c1
805 nmdc:mga05p37_28236_c1
806 nmdc:mga05p37_37567_c1
807 nmdc:mga05p37_44540_c1
808 nmdc:mga05p37_493210_c1
809 nmdc:mga05p37_556206_c1
810 nmdc:mga05p37_66645_c1
811 nmdc:mga05p37_748451_c1
812 nmdc:mga09592_253_c1
813 nmdc:mga09592_6899_c1
814 nmdc:mga09592_93440_c1
815 nmdc:mga0qj67_324541_c1
816 nmdc:mga0qj67_3619_c1
817 nmdc:mga0qj67_80543_c1
818 nmdc:mga0qj67_982681_c1
819 nmdc:mga06r32_12438_c1
820 nmdc:mga06r32_1838_c1
821 nmdc:mga06r32_269852_c1
822 nmdc:mga06r32_34614_c1
823 nmdc:mga06r32_420105_c1
824 nmdc:mga0n895_269591_c1
825 nmdc:mga0n895_545700_c1
826 nmdc:mga0n895_753910_c1
827 nmdc:mga0rr50_147399_c1
828 nmdc:mga0rr50_27643_c1
829 nmdc:mga08x19_13571_c1
830 nmdc:mga08x19_57079_c1
831 nmdc:mga0a205_13653_c1
832 nmdc:mga0a205_154444_c1
833 nmdc:mga0a205_27192_c1
834 nmdc:mga0a205_46202_c1
835 nmdc:mga0a205_77105_c1
836 Ga0501084_0007730
837 Ga0501084_0011317
838 Ga0501084_0084017
839 Ga0501084_0126193
840 Ga0501084_0283011
841 Ga0501084_0697448
842 Ga0501082_0000456
843 Ga0501082_0000526
844 Ga0501082_0102090
845 Ga0501082_0205267
846 Ga0530510_0000479
847 Ga0530510_0026045
848 Ga0530510_0035146
849 Ga0530510_0140661
850 Ga0530510_0172364
851 Ga0530510_0199072
852 Ga0530510_0230773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

28

104

0.98

PF02391

MoaE

MoaE protein

115

227

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qie-assembly2.cif.gz_H staphylococcus aureus molybdopterin synthase in complex with precursor z 0.9643 90 212
8hlg-assembly1.cif.gz_B crystal structure of moae 0.9598 87 221
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.9527 90 226
2wp4-assembly1.cif.gz_A crystal structure of rv3119 from mycobacterium tuberculosis 0.9524 88 213
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9467 81 215
ID Description Score Start End Superfamily
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9848 88 215 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9814 89 220 3.90.1170.40
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9715 87 220 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9602 84 220 3.90.1170.40
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9516 89 222 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A1V9YC53-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9927 88 220 GO:0006777
GO:0030366
GO:1990140
AF-A0A7L0PS37-F1-model_v4 MOC2B synthase 0.991 117 215 GO:0006777
AF-A0A7J0DS49-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9903 100 220 GO:0006777
GO:0030366
GO:1990140
AF-A0A6A6KV23-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9902 108 220 GO:0006777
GO:0030366
GO:1990140
AF-A0A267GU85-F1-model_v4 Molybdopterin synthase catalytic subunit 0.9895 88 220 GO:0006777
GO:0030366
GO:1990140

Map