F440999

General Info

Members Datasets Scaffolds Average Seq Length
425 209 850 294

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10013293|Ga0265331_100132932
Length 309
Sequence MLNCPRIILFDGDRYMKRIFLFILTNLAVVFVINITLRLLGVDRILNQGGGINFNALLVMSLVIGFSGSIISLLMSKWSAKQMVGAQVIENPIDPIERWLVETVRRQADAAGIGMPEVAIYDAPDVNAFATGWNRNAALVAVSTGLLHNMSKDEIEAVLAHEMSHVSNGDMVTLALIQGVVNTFVIFFAKLFGILVDRVLLKNDERNGPGIGAFVAEIVAQLVLGVLASVIVMWFSRQREFRADAGGANLAGRNKMIAALERLKINHEQAALPEKMAAFGISGGKGMMRLFMTHPPLEERIEALRAGSR

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10013293 3300031250 Bacteria 4432
2 Ga0065707_10084816 3300005295 Bacteria 6745
3 Ga0065707_10105880 3300005295 Bacteria 2624
4 Ga0070690_100000488 3300005330 Bacteria 19873
5 Ga0070670_100020122 3300005331 Bacteria 5733
6 Ga0070670_100246791 3300005331 Bacteria 1555
7 Ga0068869_100003307 3300005334 Bacteria 9846
8 Ga0068869_100123236 3300005334 Bacteria 1985
9 Ga0070680_100186421 3300005336 Bacteria 1748
10 Ga0070689_100000391 3300005340 Bacteria 25693
11 Ga0070661_100034801 3300005344 Bacteria 3655
12 Ga0070692_10057600 3300005345 Bacteria 2038
13 Ga0070668_100002002 3300005347 Bacteria 14889
14 Ga0070668_100191345 3300005347 Bacteria 1676
15 Ga0070669_100043337 3300005353 Bacteria 3277
16 Ga0070675_100000583 3300005354 Bacteria 25031
17 Ga0070675_100125081 3300005354 Bacteria 2187
18 Ga0070671_100040939 3300005355 Bacteria 3850
19 Ga0070671_100186351 3300005355 Bacteria 1758
20 Ga0070673_100054268 3300005364 Bacteria 3152
21 Ga0070659_100171376 3300005366 Bacteria 1778
22 Ga0070667_100043613 3300005367 Bacteria 3765
23 Ga0070714_100047989 3300005435 Bacteria 3630
24 Ga0070705_100033854 3300005440 Bacteria 2851
25 Ga0070700_100002569 3300005441 Bacteria 9279
26 Ga0070694_100010426 3300005444 Bacteria 5734
27 Ga0070694_100097322 3300005444 Bacteria 2076
28 Ga0070678_100011967 3300005456 Bacteria 5373
29 Ga0070662_100006861 3300005457 Bacteria 7369
30 Ga0070681_10182209 3300005458 Bacteria 2022
31 Ga0070681_10232965 3300005458 Bacteria 1756
32 Ga0068867_100128921 3300005459 Bacteria 1963
33 Ga0068867_100387985 3300005459 Bacteria 1175
34 Ga0070685_10007998 3300005466 Bacteria 5421
35 Ga0070684_100002191 3300005535 Bacteria 14406
36 Ga0070672_100380702 3300005543 Bacteria 1207
37 Ga0070686_100036938 3300005544 Bacteria 3027
38 Ga0070695_100045915 3300005545 Bacteria 2786
39 Ga0070696_100050667 3300005546 Bacteria 2886
40 Ga0070665_100012574 3300005548 Bacteria 8523
41 Ga0070704_100058552 3300005549 Bacteria 2745
42 Ga0070704_100124715 3300005549 Bacteria 1985
43 Ga0068855_100006732 3300005563 Bacteria 13943
44 Ga0070664_100000613 3300005564 Bacteria 27268
45 Ga0068857_100142171 3300005577 Bacteria 2169
46 Ga0068857_100338417 3300005577 Bacteria 1392
47 Ga0068856_100006499 3300005614 Bacteria 11464
48 Ga0068856_100378630 3300005614 Bacteria 1434
49 Ga0070702_100002455 3300005615 Bacteria 8008
50 Ga0070702_100047184 3300005615 Bacteria 2445
51 Ga0068859_100029114 3300005617 Bacteria 5542
52 Ga0068859_100871482 3300005617 Bacteria 986
53 Ga0068864_100000969 3300005618 Bacteria 24049
54 Ga0068866_10071902 3300005718 Bacteria 1831
55 Ga0068861_100000011 3300005719 Bacteria 82099
56 Ga0068861_100137377 3300005719 Bacteria 1991
57 Ga0068861_100491902 3300005719 Bacteria 1107
58 Ga0068863_100009807 3300005841 Bacteria 9332
59 Ga0068858_100033123 3300005842 Bacteria 4798
60 Ga0068860_100028147 3300005843 Bacteria 5409
61 Ga0068862_100000740 3300005844 Bacteria 32753
62 Ga0068862_100009220 3300005844 Bacteria 8173
63 Ga0068862_100029623 3300005844 Bacteria 4613
64 Ga0097621_100015383 3300006237 Bacteria 5755
65 Ga0068871_100022783 3300006358 Bacteria 4834
66 Ga0075428_100000063 3300006844 Bacteria 86012
67 Ga0075428_100006047 3300006844 Bacteria 13446
68 Ga0075428_100085666 3300006844 Bacteria 3436
69 Ga0075428_100159617 3300006844 Bacteria 2447
70 Ga0075428_100169504 3300006844 Bacteria 2367
71 Ga0075428_100266417 3300006844 Bacteria 1844
72 Ga0075430_100001304 3300006846 Bacteria 20102
73 Ga0075430_100054334 3300006846 Bacteria 3370
74 Ga0075430_100128085 3300006846 Bacteria 2116
75 Ga0075431_100000298 3300006847 Bacteria 39052
76 Ga0075431_100005034 3300006847 Bacteria 13005
77 Ga0075431_100143709 3300006847 Bacteria 2459
78 Ga0075431_100362366 3300006847 Bacteria 1456
79 Ga0075433_10399946 3300006852 Bacteria 1212
80 Ga0075429_100018745 3300006880 Bacteria 5993
81 Ga0075429_100025885 3300006880 Bacteria 5093
82 Ga0075429_100082524 3300006880 Bacteria 2802
83 Ga0097620_100029113 3300006931 Bacteria 5542
84 Ga0097620_100871213 3300006931 Bacteria 986
85 Ga0075435_100121364 3300007076 Bacteria 2181
86 Ga0105250_10000008 3300009092 Bacteria 343965
87 Ga0105240_10088176 3300009093 Bacteria 3797
88 Ga0111539_10000428 3300009094 Bacteria 52857
89 Ga0111539_10003897 3300009094 Bacteria 19620
90 Ga0111539_10005125 3300009094 Bacteria 16993
91 Ga0111539_10005783 3300009094 Bacteria 15983
92 Ga0111539_10043493 3300009094 Bacteria 5384
93 Ga0111539_10051155 3300009094 Bacteria 4922
94 Ga0111539_10262049 3300009094 Bacteria 2012
95 Ga0111539_10304788 3300009094 Bacteria 1854
96 Ga0111539_10324911 3300009094 Bacteria 1791
97 Ga0111539_10412048 3300009094 Bacteria 1574
98 Ga0111539_10591747 3300009094 Bacteria 1292
99 Ga0114129_10005614 3300009147 Bacteria 17743
100 Ga0114129_10010165 3300009147 Bacteria 13417
101 Ga0114129_10881123 3300009147 Bacteria 1136
102 Ga0105242_10051139 3300009176 Bacteria 3366
103 Ga0105242_10381489 3300009176 Bacteria 1310
104 Ga0105248_10002019 3300009177 Bacteria 22514
105 Ga0105248_10112899 3300009177 Bacteria 3064
106 Ga0105238_10009904 3300009551 Bacteria 9555
107 Ga0105249_10030871 3300009553 Bacteria 4844
108 Ga0105249_10338946 3300009553 Bacteria 1519
109 Ga0157370_10001426 3300013104 Bacteria 29655
110 Ga0157378_10114730 3300013297 Bacteria 2475
111 Ga0157378_10142900 3300013297 Bacteria 2224
112 Ga0163162_10392386 3300013306 Bacteria 1521
113 Ga0157375_10025297 3300013308 Bacteria 5513
114 Ga0163163_10003103 3300014325 Bacteria 14076
115 Ga0163163_10027183 3300014325 Bacteria 5478
116 Ga0157380_10250339 3300014326 Bacteria 1603
117 Ga0157377_10014758 3300014745 Bacteria 3982
118 Ga0157379_10000143 3300014968 Bacteria 51687
119 Ga0157376_10089997 3300014969 Bacteria 2655
120 Ga0163161_10046778 3300017792 Unclassified 3122
121 Ga0163161_10141794 3300017792 Bacteria 1820
122 Ga0207696_1000106 3300025711 Bacteria 159964
123 Ga0207642_10047376 3300025899 Bacteria 1921
124 Ga0207688_10011911 3300025901 Bacteria 4733
125 Ga0207680_10049544 3300025903 Bacteria 2500
126 Ga0207707_10157515 3300025912 Bacteria 1986
127 Ga0207649_10006528 3300025920 Bacteria 6337
128 Ga0207681_10004316 3300025923 Bacteria 8779
129 Ga0207681_10250565 3300025923 Bacteria 1382
130 Ga0207694_10073428 3300025924 Bacteria 2676
131 Ga0207650_10018233 3300025925 Bacteria 4923
132 Ga0207650_10063562 3300025925 Bacteria 2760
133 Ga0207659_10020698 3300025926 Bacteria 4353
134 Ga0207706_10015768 3300025933 Bacteria 6830
135 Ga0207706_10151190 3300025933 Bacteria 2042
136 Ga0207686_10026303 3300025934 Bacteria 3393
137 Ga0207670_10001390 3300025936 Bacteria 12731
138 Ga0207670_10412046 3300025936 Bacteria 1082
139 Ga0207669_10098834 3300025937 Bacteria 1923
140 Ga0207704_10028163 3300025938 Bacteria 3112
141 Ga0207691_10012139 3300025940 Bacteria 8259
142 Ga0207689_10007438 3300025942 Bacteria 9601
143 Ga0207689_10008851 3300025942 Bacteria 8739
144 Ga0207679_10001585 3300025945 Bacteria 14207
145 Ga0207667_10006605 3300025949 Bacteria 14022
146 Ga0207651_10030959 3300025960 Bacteria 3414
147 Ga0207712_10014956 3300025961 Bacteria 4999
148 Ga0207712_10278817 3300025961 Bacteria 1363
149 Ga0207668_10026047 3300025972 Bacteria 3793
150 Ga0207677_10234882 3300026023 Bacteria 1479
151 Ga0207703_10013641 3300026035 Bacteria 6334
152 Ga0207708_10005428 3300026075 Bacteria 9398
153 Ga0207702_10171246 3300026078 Bacteria 1991
154 Ga0207641_10040887 3300026088 Bacteria 3884
155 Ga0207648_10329246 3300026089 Bacteria 1374
156 Ga0207676_10026102 3300026095 Bacteria 4341
157 Ga0207674_10163654 3300026116 Bacteria 2179
158 Ga0207675_100001048 3300026118 Bacteria 27391
159 Ga0207675_100136423 3300026118 Bacteria 2328
160 Ga0207675_100228899 3300026118 Bacteria 1793
161 Ga0207683_10028618 3300026121 Bacteria 4820
162 Ga0207428_10002785 3300027907 Bacteria 17359
163 Ga0207428_10019588 3300027907 Bacteria 5766
164 Ga0207428_10027361 3300027907 Bacteria 4748
165 Ga0207428_10057240 3300027907 Bacteria 3095
166 Ga0268266_10010858 3300028379 Bacteria 7933
167 Ga0268265_10000512 3300028380 Bacteria 39796
168 Ga0268265_10022075 3300028380 Bacteria 4468
169 Ga0268265_10043581 3300028380 Bacteria 3337
170 Ga0268264_10021477 3300028381 Bacteria 5271
171 Ga0265336_10000522 3300028666 Bacteria 22192
172 Ga0265324_10000006 3300029957 Bacteria 267048
173 Ga0265324_10021762 3300029957 Bacteria 2297
174 Ga0265330_10002266 3300031235 Bacteria 10583
175 Ga0265325_10000639 3300031241 Bacteria 25487
176 Ga0265340_10097675 3300031247 Bacteria 1367
177 Ga0265331_10005427 3300031250 Bacteria 7697
178 Ga0265331_10094701 3300031250 Bacteria 1378
179 Ga0265327_10013239 3300031251 Bacteria 5491
180 Ga0265316_10134178 3300031344 Bacteria 1863
181 Ga0307408_100019215 3300031548 Bacteria 4598
182 Ga0307408_100053545 3300031548 Bacteria 2914
183 Ga0307408_100188368 3300031548 Bacteria 1660
184 Ga0307408_100301978 3300031548 Bacteria 1341
185 Ga0307408_100354612 3300031548 Bacteria 1246
186 Ga0316575_10147847 3300031665 Bacteria 968
187 Ga0265314_10016288 3300031711 Bacteria 5878
188 Ga0265314_10061942 3300031711 Bacteria 2545
189 Ga0316576_10072886 3300031727 Bacteria 2536
190 Ga0316576_10082697 3300031727 Bacteria 2384
191 Ga0316576_10100555 3300031727 Bacteria 2161
192 Ga0307405_10064162 3300031731 Bacteria 2333
193 Ga0307405_10108626 3300031731 Bacteria 1875
194 Ga0307405_10424102 3300031731 Bacteria 1048
195 Ga0316577_10149197 3300031733 Bacteria 1318
196 Ga0307413_10050701 3300031824 Bacteria 2496
197 Ga0307413_10225813 3300031824 Bacteria 1371
198 Ga0307413_10418653 3300031824 Bacteria 1054
199 Ga0307406_10300367 3300031901 Bacteria 1233
200 Ga0307412_10384766 3300031911 Bacteria 1137
201 Ga0307416_100043964 3300032002 Bacteria 3503
202 Ga0307416_100290868 3300032002 Bacteria 1617
203 Ga0307416_100297011 3300032002 Bacteria 1603
204 Ga0307416_100314707 3300032002 Bacteria 1564
205 Ga0307414_10138142 3300032004 Bacteria 1903
206 Ga0307411_10032459 3300032005 Bacteria 3226
207 Ga0307411_10344877 3300032005 Bacteria 1212
208 Ga0316583_10000355 3300032133 Bacteria 13144
209 Ga0316583_10007766 3300032133 Bacteria 3868
210 Ga0316593_10004973 3300032168 Bacteria 3465
211 Ga0316593_10019611 3300032168 Bacteria 2091
212 Ga0316596_1068825 3300033541 Bacteria 947
213 Ga0316574_0000540 3300035398 Bacteria 15560
214 Ga0316574_0010113 3300035398 Bacteria 5314
215 Ga0316574_0022622 3300035398 Bacteria 3746
216 Ga0316574_0023005 3300035398 Bacteria 3717
217 Ga0316574_0044162 3300035398 Bacteria 2757
218 Ga0316574_0048602 3300035398 Bacteria 2635
219 Ga0316574_0089786 3300035398 Bacteria 1958
220 Ga0316574_0112300 3300035398 Bacteria 1747
221 Ga0316574_0129295 3300035398 Bacteria 1625
222 Ga0373937_0019784 3300036401 Bacteria 6029
223 Ga0373937_0284004 3300036401 Bacteria 1563
224 Ga0316582_0004524 3300036647 Bacteria 7042
225 Ga0316582_0008612 3300036647 Bacteria 5489
226 Ga0316582_0028084 3300036647 Bacteria 3406
227 Ga0316582_0348214 3300036647 Bacteria 1019
228 Ga0316584_0457405 3300036712 Unclassified 902
229 Ga0373925_0418562 3300037068 Bacteria 1094
230 Ga0395900_0068062 3300037418 Bacteria 3659
231 Ga0395901_0143179 3300038443 Bacteria 2513
232 Ga0400483_289306 3300039062 Bacteria 4070
233 Ga0451853_2510643 3300041512 Bacteria 5968
234 Ga0450920_011202 3300042122 Bacteria 1669
235 Ga0450894_004317 3300042131 Bacteria 1849
236 Ga0450895_000625 3300042132 Bacteria 2134
237 Ga0450908_002061 3300042184 Bacteria 3928
238 Ga0450918_006249 3300042531 Bacteria 2128
239 Ga0451577_0154903 3300042876 Bacteria 2062
240 Ga0451577_0174431 3300042876 Bacteria 1938
241 Ga0453684_0000237 3300044712 Bacteria 236999
242 Ga0453684_0000361 3300044712 Bacteria 188097
243 Ga0453684_0021130 3300044712 Bacteria 9752
244 Ga0451576_0000034 3300045051 Bacteria 390778
245 Ga0451576_0017565 3300045051 Bacteria 7862
246 Ga0451576_0244403 3300045051 Bacteria 1875
247 Ga0495654_0145798 3300046530 Bacteria 1051
248 Ga0495598_0088568 3300046537 Bacteria 1005
249 Ga0495621_0004024 3300046539 Bacteria 4091
250 Ga0495647_0000557 3300046681 Bacteria 10979
251 Ga0495658_0027171 3300046683 Bacteria 3076
252 Ga0496100_0022076 3300048903 Bacteria 3846
253 Ga0496106_0044887 3300048909 Bacteria 3319
254 Ga0496109_0359598 3300048912 Bacteria 1375
255 Ga0496112_0082969 3300048915 Bacteria 3169
256 Ga0496114_0009480 3300048917 Bacteria 7729
257 Ga0496114_0099136 3300048917 Bacteria 2485
258 Ga0496115_0240191 3300048918 Bacteria 1493
259 Ga0496124_0011671 3300048927 Bacteria 8768
260 Ga0501031_0010176 3300049568 Bacteria 6127
261 Ga0501032_0087212 3300049569 Bacteria 2073
262 Ga0501033_0001924 3300049570 Bacteria 18083
263 Ga0501033_0006159 3300049570 Bacteria 9407
264 Ga0501033_0008063 3300049570 Bacteria 8157
265 Ga0501033_0016083 3300049570 Bacteria 5665
266 Ga0501033_0040908 3300049570 Bacteria 3460
267 Ga0501034_0004453 3300049571 Bacteria 15575
268 Ga0501034_0011763 3300049571 Bacteria 9056
269 Ga0501036_0003102 3300049572 Bacteria 13257
270 Ga0501036_0003802 3300049572 Bacteria 12106
271 Ga0501036_0011700 3300049572 Bacteria 7271
272 Ga0501036_0018236 3300049572 Bacteria 5877
273 Ga0501036_0063106 3300049572 Bacteria 3137
274 Ga0501037_0002167 3300049573 Bacteria 14202
275 Ga0501037_0002865 3300049573 Bacteria 12508
276 Ga0501037_0003194 3300049573 Bacteria 11887
277 Ga0501037_0007523 3300049573 Bacteria 7976
278 Ga0501037_0015932 3300049573 Bacteria 5534
279 Ga0501037_0030823 3300049573 Bacteria 3961
280 Ga0501038_0001728 3300049574 Bacteria 20312
281 Ga0501038_0002039 3300049574 Bacteria 18686
282 Ga0501038_0005042 3300049574 Bacteria 12269
283 Ga0501038_0005965 3300049574 Bacteria 11268
284 Ga0501038_0016196 3300049574 Bacteria 6762
285 Ga0501038_0036158 3300049574 Bacteria 4335
286 Ga0501038_0041149 3300049574 Bacteria 4030
287 Ga0501038_0051514 3300049574 Bacteria 3552
288 Ga0501038_0057739 3300049574 Bacteria 3331
289 Ga0501038_0070604 3300049574 Bacteria 2965
290 Ga0501039_0001672 3300049575 Bacteria 16339
291 Ga0501039_0009546 3300049575 Bacteria 7396
292 Ga0501039_0020704 3300049575 Bacteria 5040
293 Ga0501039_0045247 3300049575 Bacteria 3400
294 Ga0501039_0245864 3300049575 Bacteria 1407
295 Ga0501040_0000195 3300049576 Bacteria 35267
296 Ga0501040_0001364 3300049576 Bacteria 15418
297 Ga0501040_0023288 3300049576 Bacteria 4152
298 Ga0501040_0050523 3300049576 Bacteria 2844
299 Ga0501041_0001670 3300049577 Bacteria 12422
300 Ga0501041_0002415 3300049577 Bacteria 10584
301 Ga0501041_0006043 3300049577 Bacteria 7085
302 Ga0501041_0009541 3300049577 Bacteria 5722
303 Ga0501041_0068230 3300049577 Bacteria 2180
304 Ga0501042_0002140 3300049578 Bacteria 11998
305 Ga0501042_0005317 3300049578 Bacteria 8277
306 Ga0501042_0029601 3300049578 Bacteria 3862
307 Ga0501042_0033677 3300049578 Bacteria 3632
308 Ga0501042_0502595 3300049578 Bacteria 880
309 Ga0501043_0001773 3300049579 Bacteria 18557
310 Ga0501043_0012526 3300049579 Bacteria 6632
311 Ga0501043_0034350 3300049579 Bacteria 3988
312 Ga0501043_0047895 3300049579 Bacteria 3361
313 Ga0501046_0003607 3300049580 Bacteria 14177
314 Ga0501046_0010899 3300049580 Bacteria 7790
315 Ga0501046_0043138 3300049580 Bacteria 3592
316 Ga0501046_0135705 3300049580 Bacteria 1864
317 Ga0501047_0043133 3300049581 Bacteria 4357
318 Ga0501047_0112541 3300049581 Bacteria 2604
319 Ga0501048_0016087 3300049582 Bacteria 5516
320 Ga0501048_0037533 3300049582 Bacteria 3479
321 Ga0501048_0082495 3300049582 Bacteria 2268
322 Ga0501048_0116417 3300049582 Bacteria 1888
323 Ga0501067_0006319 3300049583 Bacteria 6570
324 Ga0501068_0000606 3300049584 Bacteria 18242
325 Ga0501068_0031728 3300049584 Bacteria 3139
326 Ga0501068_0078324 3300049584 Bacteria 2025
327 Ga0501070_0010061 3300049586 Bacteria 8000
328 Ga0501070_0015017 3300049586 Bacteria 6516
329 Ga0501071_0000363 3300049587 Bacteria 22256
330 Ga0501071_0004591 3300049587 Bacteria 8760
331 Ga0501071_0122098 3300049587 Bacteria 1931
332 Ga0501072_0000460 3300049588 Bacteria 29424
333 Ga0501072_0031584 3300049588 Bacteria 4147
334 Ga0501072_0068946 3300049588 Bacteria 2792
335 Ga0501072_0083548 3300049588 Bacteria 2531
336 Ga0501073_0235705 3300049589 Bacteria 1264
337 Ga0501073_0288854 3300049589 Bacteria 1131
338 Ga0501074_0012370 3300049590 Bacteria 6203
339 Ga0501074_0014151 3300049590 Bacteria 5801
340 Ga0501074_0081960 3300049590 Bacteria 2314
341 Ga0501074_0320793 3300049590 Bacteria 1100
342 Ga0501075_0002629 3300049591 Bacteria 11997
343 Ga0501075_0006023 3300049591 Bacteria 8313
344 Ga0501075_0013286 3300049591 Bacteria 5875
345 Ga0501076_0001124 3300049592 Bacteria 17657
346 Ga0501076_0013259 3300049592 Bacteria 6180
347 Ga0501076_0029693 3300049592 Bacteria 4253
348 Ga0501077_0002255 3300049593 Bacteria 11628
349 Ga0501077_0011480 3300049593 Bacteria 5534
350 Ga0501077_0240334 3300049593 Bacteria 1151
351 Ga0501079_0000020 3300049741 Bacteria 63869
352 Ga0501079_0047744 3300049741 Bacteria 3303
353 Ga0501079_0177496 3300049741 Bacteria 1661
354 Ga0501080_0002643 3300049742 Bacteria 15670
355 Ga0501080_0004484 3300049742 Bacteria 12434
356 Ga0501080_0007741 3300049742 Bacteria 9712
357 Ga0501080_0023830 3300049742 Bacteria 5672
358 Ga0501080_0034901 3300049742 Bacteria 4697
359 Ga0501080_0069258 3300049742 Bacteria 3281
360 Ga0501080_0237652 3300049742 Bacteria 1664
361 Ga0501081_0000049 3300049743 Bacteria 44681
362 Ga0501081_0006046 3300049743 Bacteria 7839
363 Ga0501081_0008599 3300049743 Bacteria 6634
364 Ga0501083_0025919 3300049744 Bacteria 4057
365 Ga0501083_0061859 3300049744 Bacteria 2499
366 Ga0501083_0194815 3300049744 Bacteria 1322
367 Ga0501035_0002132 3300049822 Bacteria 19681
368 Ga0501035_0013055 3300049822 Bacteria 7665
369 Ga0501035_0020340 3300049822 Bacteria 6094
370 Ga0501035_0030597 3300049822 Bacteria 4906
371 Ga0501035_0100201 3300049822 Bacteria 2543
372 Ga0501035_0120427 3300049822 Bacteria 2295
373 Ga0501044_0000059 3300049823 Bacteria 134132
374 Ga0501044_0000353 3300049823 Bacteria 57639
375 Ga0501044_0001089 3300049823 Bacteria 32402
376 Ga0501044_0003115 3300049823 Bacteria 18795
377 Ga0501044_0034209 3300049823 Bacteria 5332
378 Ga0501044_0051308 3300049823 Bacteria 4254
379 Ga0501044_0136464 3300049823 Bacteria 2444
380 Ga0501045_0000996 3300049824 Bacteria 18590
381 Ga0501045_0002627 3300049824 Bacteria 12237
382 Ga0501045_0009435 3300049824 Bacteria 6826
383 Ga0501045_0345788 3300049824 Bacteria 1107
384 nmdc:mga05p37_207930_c1 3300050507 Bacteria 2367
385 nmdc:mga05p37_287170_c1 3300050507 Bacteria 1959
386 nmdc:mga05p37_41284_c1 3300050507 Bacteria 5664
387 nmdc:mga09592_231517_c1 3300050508 Bacteria 1601
388 nmdc:mga09592_26311_c1 3300050508 Bacteria 4819
389 nmdc:mga0qj67_206951_c1 3300050509 Bacteria 1594
390 nmdc:mga0qj67_3814_c1 3300050509 Bacteria 10890
391 nmdc:mga06r32_181_c1 3300050510 Bacteria 49505
392 nmdc:mga06r32_206085_c1 3300050510 Bacteria 1955
393 nmdc:mga06r32_356018_c1 3300050510 Bacteria 1448
394 nmdc:mga06r32_5193_c1 3300050510 Bacteria 11700
395 nmdc:mga06r32_666607_c1 3300050510 Bacteria 1007
396 nmdc:mga08y16_1185_c1 3300050511 Bacteria 25720
397 nmdc:mga08y16_256909_c1 3300050511 Unclassified 1805
398 nmdc:mga08y16_35277_c1 3300050511 Bacteria 5253
399 nmdc:mga08y16_376582_c1 3300050511 Bacteria 1455
400 nmdc:mga08y16_4195_c1 3300050511 Bacteria 15046
401 nmdc:mga08y16_446268_c1 3300050511 Unclassified 1320
402 nmdc:mga08y16_8243_c1 3300050511 Bacteria 10901
403 nmdc:mga0a205_384722_c1 3300050515 Bacteria 1268
404 Ga0495601_0022343 3300053077 Bacteria 3882
405 Ga0500650_0108569 3300053098 Bacteria 1296
406 Ga0500556_0001263 3300053104 Bacteria 11594
407 Ga0500617_105269 3300053124 Bacteria 1187
408 Ga0500658_0159221 3300053134 Bacteria 1021
409 Ga0500568_0009443 3300053139 Bacteria 4633
410 Ga0500588_0009386 3300053146 Bacteria 2325
411 Ga0500616_0117519 3300053153 Bacteria 1275
412 Ga0500622_0003100 3300053156 Bacteria 11443
413 Ga0501084_0004105 3300054114 Bacteria 11861
414 Ga0501084_0032241 3300054114 Bacteria 4383
415 Ga0501084_0048446 3300054114 Bacteria 3557
416 Ga0501082_0000761 3300060353 Bacteria 28260
417 Ga0501082_0011718 3300060353 Bacteria 7539
418 Ga0501082_0031291 3300060353 Bacteria 4587
419 Ga0501082_0041280 3300060353 Bacteria 3978
420 Ga0501082_0047667 3300060353 Bacteria 3693
421 Ga0501082_0150393 3300060353 Bacteria 2022
422 Ga0530510_0000239 3300061734 Bacteria 34451
423 Ga0530510_0007907 3300061734 Bacteria 7418
424 Ga0530510_0019008 3300061734 Bacteria 4874
425 Ga0530510_0132264 3300061734 Bacteria 1836
426 Ga0265331_10013293
427 Ga0065707_10084816
428 Ga0065707_10105880
429 Ga0070690_100000488
430 Ga0070670_100020122
431 Ga0070670_100246791
432 Ga0068869_100003307
433 Ga0068869_100123236
434 Ga0070680_100186421
435 Ga0070689_100000391
436 Ga0070661_100034801
437 Ga0070692_10057600
438 Ga0070668_100002002
439 Ga0070668_100191345
440 Ga0070669_100043337
441 Ga0070675_100000583
442 Ga0070675_100125081
443 Ga0070671_100040939
444 Ga0070671_100186351
445 Ga0070673_100054268
446 Ga0070659_100171376
447 Ga0070667_100043613
448 Ga0070714_100047989
449 Ga0070705_100033854
450 Ga0070700_100002569
451 Ga0070694_100010426
452 Ga0070694_100097322
453 Ga0070678_100011967
454 Ga0070662_100006861
455 Ga0070681_10182209
456 Ga0070681_10232965
457 Ga0068867_100128921
458 Ga0068867_100387985
459 Ga0070685_10007998
460 Ga0070684_100002191
461 Ga0070672_100380702
462 Ga0070686_100036938
463 Ga0070695_100045915
464 Ga0070696_100050667
465 Ga0070665_100012574
466 Ga0070704_100058552
467 Ga0070704_100124715
468 Ga0068855_100006732
469 Ga0070664_100000613
470 Ga0068857_100142171
471 Ga0068857_100338417
472 Ga0068856_100006499
473 Ga0068856_100378630
474 Ga0070702_100002455
475 Ga0070702_100047184
476 Ga0068859_100029114
477 Ga0068859_100871482
478 Ga0068864_100000969
479 Ga0068866_10071902
480 Ga0068861_100000011
481 Ga0068861_100137377
482 Ga0068861_100491902
483 Ga0068863_100009807
484 Ga0068858_100033123
485 Ga0068860_100028147
486 Ga0068862_100000740
487 Ga0068862_100009220
488 Ga0068862_100029623
489 Ga0097621_100015383
490 Ga0068871_100022783
491 Ga0075428_100000063
492 Ga0075428_100006047
493 Ga0075428_100085666
494 Ga0075428_100159617
495 Ga0075428_100169504
496 Ga0075428_100266417
497 Ga0075430_100001304
498 Ga0075430_100054334
499 Ga0075430_100128085
500 Ga0075431_100000298
501 Ga0075431_100005034
502 Ga0075431_100143709
503 Ga0075431_100362366
504 Ga0075433_10399946
505 Ga0075429_100018745
506 Ga0075429_100025885
507 Ga0075429_100082524
508 Ga0097620_100029113
509 Ga0097620_100871213
510 Ga0075435_100121364
511 Ga0105250_10000008
512 Ga0105240_10088176
513 Ga0111539_10000428
514 Ga0111539_10003897
515 Ga0111539_10005125
516 Ga0111539_10005783
517 Ga0111539_10043493
518 Ga0111539_10051155
519 Ga0111539_10262049
520 Ga0111539_10304788
521 Ga0111539_10324911
522 Ga0111539_10412048
523 Ga0111539_10591747
524 Ga0114129_10005614
525 Ga0114129_10010165
526 Ga0114129_10881123
527 Ga0105242_10051139
528 Ga0105242_10381489
529 Ga0105248_10002019
530 Ga0105248_10112899
531 Ga0105238_10009904
532 Ga0105249_10030871
533 Ga0105249_10338946
534 Ga0157370_10001426
535 Ga0157378_10114730
536 Ga0157378_10142900
537 Ga0163162_10392386
538 Ga0157375_10025297
539 Ga0163163_10003103
540 Ga0163163_10027183
541 Ga0157380_10250339
542 Ga0157377_10014758
543 Ga0157379_10000143
544 Ga0157376_10089997
545 Ga0163161_10046778
546 Ga0163161_10141794
547 Ga0207696_1000106
548 Ga0207642_10047376
549 Ga0207688_10011911
550 Ga0207680_10049544
551 Ga0207707_10157515
552 Ga0207649_10006528
553 Ga0207681_10004316
554 Ga0207681_10250565
555 Ga0207694_10073428
556 Ga0207650_10018233
557 Ga0207650_10063562
558 Ga0207659_10020698
559 Ga0207706_10015768
560 Ga0207706_10151190
561 Ga0207686_10026303
562 Ga0207670_10001390
563 Ga0207670_10412046
564 Ga0207669_10098834
565 Ga0207704_10028163
566 Ga0207691_10012139
567 Ga0207689_10007438
568 Ga0207689_10008851
569 Ga0207679_10001585
570 Ga0207667_10006605
571 Ga0207651_10030959
572 Ga0207712_10014956
573 Ga0207712_10278817
574 Ga0207668_10026047
575 Ga0207677_10234882
576 Ga0207703_10013641
577 Ga0207708_10005428
578 Ga0207702_10171246
579 Ga0207641_10040887
580 Ga0207648_10329246
581 Ga0207676_10026102
582 Ga0207674_10163654
583 Ga0207675_100001048
584 Ga0207675_100136423
585 Ga0207675_100228899
586 Ga0207683_10028618
587 Ga0207428_10002785
588 Ga0207428_10019588
589 Ga0207428_10027361
590 Ga0207428_10057240
591 Ga0268266_10010858
592 Ga0268265_10000512
593 Ga0268265_10022075
594 Ga0268265_10043581
595 Ga0268264_10021477
596 Ga0265336_10000522
597 Ga0265324_10000006
598 Ga0265324_10021762
599 Ga0265330_10002266
600 Ga0265325_10000639
601 Ga0265340_10097675
602 Ga0265331_10005427
603 Ga0265331_10094701
604 Ga0265327_10013239
605 Ga0265316_10134178
606 Ga0307408_100019215
607 Ga0307408_100053545
608 Ga0307408_100188368
609 Ga0307408_100301978
610 Ga0307408_100354612
611 Ga0316575_10147847
612 Ga0265314_10016288
613 Ga0265314_10061942
614 Ga0316576_10072886
615 Ga0316576_10082697
616 Ga0316576_10100555
617 Ga0307405_10064162
618 Ga0307405_10108626
619 Ga0307405_10424102
620 Ga0316577_10149197
621 Ga0307413_10050701
622 Ga0307413_10225813
623 Ga0307413_10418653
624 Ga0307406_10300367
625 Ga0307412_10384766
626 Ga0307416_100043964
627 Ga0307416_100290868
628 Ga0307416_100297011
629 Ga0307416_100314707
630 Ga0307414_10138142
631 Ga0307411_10032459
632 Ga0307411_10344877
633 Ga0316583_10000355
634 Ga0316583_10007766
635 Ga0316593_10004973
636 Ga0316593_10019611
637 Ga0316596_1068825
638 Ga0316574_0000540
639 Ga0316574_0010113
640 Ga0316574_0022622
641 Ga0316574_0023005
642 Ga0316574_0044162
643 Ga0316574_0048602
644 Ga0316574_0089786
645 Ga0316574_0112300
646 Ga0316574_0129295
647 Ga0373937_0019784
648 Ga0373937_0284004
649 Ga0316582_0004524
650 Ga0316582_0008612
651 Ga0316582_0028084
652 Ga0316582_0348214
653 Ga0316584_0457405
654 Ga0373925_0418562
655 Ga0395900_0068062
656 Ga0395901_0143179
657 Ga0400483_289306
658 Ga0451853_2510643
659 Ga0450920_011202
660 Ga0450894_004317
661 Ga0450895_000625
662 Ga0450908_002061
663 Ga0450918_006249
664 Ga0451577_0154903
665 Ga0451577_0174431
666 Ga0453684_0000237
667 Ga0453684_0000361
668 Ga0453684_0021130
669 Ga0451576_0000034
670 Ga0451576_0017565
671 Ga0451576_0244403
672 Ga0495654_0145798
673 Ga0495598_0088568
674 Ga0495621_0004024
675 Ga0495647_0000557
676 Ga0495658_0027171
677 Ga0496100_0022076
678 Ga0496106_0044887
679 Ga0496109_0359598
680 Ga0496112_0082969
681 Ga0496114_0009480
682 Ga0496114_0099136
683 Ga0496115_0240191
684 Ga0496124_0011671
685 Ga0501031_0010176
686 Ga0501032_0087212
687 Ga0501033_0001924
688 Ga0501033_0006159
689 Ga0501033_0008063
690 Ga0501033_0016083
691 Ga0501033_0040908
692 Ga0501034_0004453
693 Ga0501034_0011763
694 Ga0501036_0003102
695 Ga0501036_0003802
696 Ga0501036_0011700
697 Ga0501036_0018236
698 Ga0501036_0063106
699 Ga0501037_0002167
700 Ga0501037_0002865
701 Ga0501037_0003194
702 Ga0501037_0007523
703 Ga0501037_0015932
704 Ga0501037_0030823
705 Ga0501038_0001728
706 Ga0501038_0002039
707 Ga0501038_0005042
708 Ga0501038_0005965
709 Ga0501038_0016196
710 Ga0501038_0036158
711 Ga0501038_0041149
712 Ga0501038_0051514
713 Ga0501038_0057739
714 Ga0501038_0070604
715 Ga0501039_0001672
716 Ga0501039_0009546
717 Ga0501039_0020704
718 Ga0501039_0045247
719 Ga0501039_0245864
720 Ga0501040_0000195
721 Ga0501040_0001364
722 Ga0501040_0023288
723 Ga0501040_0050523
724 Ga0501041_0001670
725 Ga0501041_0002415
726 Ga0501041_0006043
727 Ga0501041_0009541
728 Ga0501041_0068230
729 Ga0501042_0002140
730 Ga0501042_0005317
731 Ga0501042_0029601
732 Ga0501042_0033677
733 Ga0501042_0502595
734 Ga0501043_0001773
735 Ga0501043_0012526
736 Ga0501043_0034350
737 Ga0501043_0047895
738 Ga0501046_0003607
739 Ga0501046_0010899
740 Ga0501046_0043138
741 Ga0501046_0135705
742 Ga0501047_0043133
743 Ga0501047_0112541
744 Ga0501048_0016087
745 Ga0501048_0037533
746 Ga0501048_0082495
747 Ga0501048_0116417
748 Ga0501067_0006319
749 Ga0501068_0000606
750 Ga0501068_0031728
751 Ga0501068_0078324
752 Ga0501070_0010061
753 Ga0501070_0015017
754 Ga0501071_0000363
755 Ga0501071_0004591
756 Ga0501071_0122098
757 Ga0501072_0000460
758 Ga0501072_0031584
759 Ga0501072_0068946
760 Ga0501072_0083548
761 Ga0501073_0235705
762 Ga0501073_0288854
763 Ga0501074_0012370
764 Ga0501074_0014151
765 Ga0501074_0081960
766 Ga0501074_0320793
767 Ga0501075_0002629
768 Ga0501075_0006023
769 Ga0501075_0013286
770 Ga0501076_0001124
771 Ga0501076_0013259
772 Ga0501076_0029693
773 Ga0501077_0002255
774 Ga0501077_0011480
775 Ga0501077_0240334
776 Ga0501079_0000020
777 Ga0501079_0047744
778 Ga0501079_0177496
779 Ga0501080_0002643
780 Ga0501080_0004484
781 Ga0501080_0007741
782 Ga0501080_0023830
783 Ga0501080_0034901
784 Ga0501080_0069258
785 Ga0501080_0237652
786 Ga0501081_0000049
787 Ga0501081_0006046
788 Ga0501081_0008599
789 Ga0501083_0025919
790 Ga0501083_0061859
791 Ga0501083_0194815
792 Ga0501035_0002132
793 Ga0501035_0013055
794 Ga0501035_0020340
795 Ga0501035_0030597
796 Ga0501035_0100201
797 Ga0501035_0120427
798 Ga0501044_0000059
799 Ga0501044_0000353
800 Ga0501044_0001089
801 Ga0501044_0003115
802 Ga0501044_0034209
803 Ga0501044_0051308
804 Ga0501044_0136464
805 Ga0501045_0000996
806 Ga0501045_0002627
807 Ga0501045_0009435
808 Ga0501045_0345788
809 nmdc:mga05p37_207930_c1
810 nmdc:mga05p37_287170_c1
811 nmdc:mga05p37_41284_c1
812 nmdc:mga09592_231517_c1
813 nmdc:mga09592_26311_c1
814 nmdc:mga0qj67_206951_c1
815 nmdc:mga0qj67_3814_c1
816 nmdc:mga06r32_181_c1
817 nmdc:mga06r32_206085_c1
818 nmdc:mga06r32_356018_c1
819 nmdc:mga06r32_5193_c1
820 nmdc:mga06r32_666607_c1
821 nmdc:mga08y16_1185_c1
822 nmdc:mga08y16_256909_c1
823 nmdc:mga08y16_35277_c1
824 nmdc:mga08y16_376582_c1
825 nmdc:mga08y16_4195_c1
826 nmdc:mga08y16_446268_c1
827 nmdc:mga08y16_8243_c1
828 nmdc:mga0a205_384722_c1
829 Ga0495601_0022343
830 Ga0500650_0108569
831 Ga0500556_0001263
832 Ga0500617_105269
833 Ga0500658_0159221
834 Ga0500568_0009443
835 Ga0500588_0009386
836 Ga0500616_0117519
837 Ga0500622_0003100
838 Ga0501084_0004105
839 Ga0501084_0032241
840 Ga0501084_0048446
841 Ga0501082_0000761
842 Ga0501082_0011718
843 Ga0501082_0031291
844 Ga0501082_0041280
845 Ga0501082_0047667
846 Ga0501082_0150393
847 Ga0530510_0000239
848 Ga0530510_0007907
849 Ga0530510_0019008
850 Ga0530510_0132264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

96

308

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9442 65 154
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8645 65 154
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8356 65 154
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.75 65 154
4il3-assembly2.cif.gz_B crystal structure of s. mikatae ste24p 0.7217 43 287
ID Description Score Start End Superfamily
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 1.002 72 163 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9702 72 163 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9661 72 154 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8892 72 154 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8633 76 161 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A377CHR2-F1-model_v4 M48B family peptidase (EC 3.4.24.-) 0.9782 62 154 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9716 46 176
AF-A0A354Z5B2-F1-model_v4 Protease HtpX 0.9451 84 288 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9434 46 176
AF-A0A2M7C416-F1-model_v4 Protease HtpX 0.9404 53 291 GO:0004222
GO:0005886
GO:0006508
GO:0046872

Map