F440793

General Info

Members Datasets Scaffolds Average Seq Length
424 282 848 128

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10806219|Ga0307413_108062191
Length 130
Sequence VAIRIVRLGSPRAQGEGPRIGAVRRPPRGVPKAEYASRDFYDLWLPELSPSAPLVSWILGEPITPARWARFAKRYRTEMAKPPAARVIPMLAALSAQADFSMGCYCEDEAHCHRSVLRELLREAGATLGP

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
148 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
149 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
150 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
151 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
152 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
153 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
187 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
188 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
195 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
250 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
251 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
254 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
255 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
256 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
257 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
261 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
265 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
266 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
267 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
268 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
281 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
282 2643221695 Lysobacter sp. Root494 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.24
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 4.01
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10806219 3300031824 Bacteria 789
2 MRS1b_contig_2292353 2162886011 Bacteria 866
3 MBSR1b_contig_12132459 2162886012 Bacteria 845
4 JGI24750J21931_1045454 3300002070 Bacteria 675
5 JGI24749J21850_1010394 3300002076 Unclassified 1305
6 JGI25151J46595_10000106 3300003187 Bacteria 113352
7 rootL2_10062912 3300003322 Bacteria 3079
8 rootH1_10155952 3300003323 Bacteria 1558
9 Ga0055529_1000027 3300003763 Bacteria 292744
10 Ga0065714_10096963 3300005288 Bacteria 1744
11 Ga0065712_10000916 3300005290 Bacteria 25216
12 Ga0065715_10000278 3300005293 Bacteria 24361
13 Ga0065707_10013551 3300005295 Bacteria 2022
14 Ga0070658_10247474 3300005327 Bacteria 1512
15 Ga0070658_10440280 3300005327 Bacteria 1122
16 Ga0070676_10172812 3300005328 Bacteria 1399
17 Ga0070670_100003450 3300005331 Bacteria 13121
18 Ga0070677_10468179 3300005333 Bacteria 677
19 Ga0070666_10262522 3300005335 Bacteria 1224
20 Ga0070680_100237373 3300005336 Unclassified 1540
21 Ga0068868_100416343 3300005338 Bacteria 1163
22 Ga0068868_100531134 3300005338 Bacteria 1034
23 Ga0070689_100119338 3300005340 Bacteria 2105
24 Ga0070689_100133642 3300005340 Bacteria 1991
25 Ga0070687_100000994 3300005343 Bacteria 9665
26 Ga0070687_100069765 3300005343 Unclassified 1883
27 Ga0070687_100713177 3300005343 Bacteria 702
28 Ga0070692_10050461 3300005345 Bacteria 2161
29 Ga0070668_100070948 3300005347 Bacteria 2713
30 Ga0070669_100121969 3300005353 Bacteria 1989
31 Ga0070675_100026039 3300005354 Bacteria 4691
32 Ga0070675_100094103 3300005354 Bacteria 2514
33 Ga0070675_100199816 3300005354 Bacteria 1735
34 Ga0070671_100395939 3300005355 Bacteria 1181
35 Ga0070674_100122964 3300005356 Bacteria 1924
36 Ga0070674_100281595 3300005356 Bacteria 1318
37 Ga0070674_100330960 3300005356 Bacteria 1224
38 Ga0070673_100005180 3300005364 Bacteria 8326
39 Ga0070673_100123815 3300005364 Bacteria 2161
40 Ga0070688_100003427 3300005365 Bacteria 8152
41 Ga0070688_100408503 3300005365 Bacteria 1006
42 Ga0070659_100758271 3300005366 Bacteria 842
43 Ga0070667_100164876 3300005367 Bacteria 1954
44 Ga0070703_10600306 3300005406 Unclassified 508
45 Ga0070701_10000130 3300005438 Bacteria 22224
46 Ga0070701_10000729 3300005438 Bacteria 11644
47 Ga0070701_10014784 3300005438 Bacteria 3587
48 Ga0070705_100071500 3300005440 Bacteria 2099
49 Ga0070700_100002634 3300005441 Bacteria 9182
50 Ga0070700_100062605 3300005441 Bacteria 2351
51 Ga0070700_100074405 3300005441 Bacteria 2176
52 Ga0070694_100018201 3300005444 Bacteria 4457
53 Ga0070694_100018517 3300005444 Bacteria 4420
54 Ga0070708_100603442 3300005445 Bacteria 1035
55 Ga0070663_101161274 3300005455 Bacteria 677
56 Ga0070678_100588368 3300005456 Bacteria 992
57 Ga0070662_100695214 3300005457 Bacteria 860
58 Ga0068867_100089173 3300005459 Bacteria 2338
59 Ga0070685_10049490 3300005466 Bacteria 2424
60 Ga0070685_10276654 3300005466 Unclassified 1122
61 Ga0070699_100304429 3300005518 Unclassified 1430
62 Ga0070697_101068178 3300005536 Bacteria 718
63 Ga0068853_100047882 3300005539 Bacteria 3669
64 Ga0070672_100817896 3300005543 Unclassified 820
65 Ga0070672_101531748 3300005543 Unclassified 598
66 Ga0070686_100056660 3300005544 Bacteria 2514
67 Ga0070686_100059404 3300005544 Bacteria 2463
68 Ga0070686_100489998 3300005544 Bacteria 952
69 Ga0070695_100061760 3300005545 Bacteria 2431
70 Ga0070696_100056465 3300005546 Bacteria 2738
71 Ga0070693_100362887 3300005547 Bacteria 995
72 Ga0070665_100008408 3300005548 Bacteria 10440
73 Ga0070704_100122686 3300005549 Bacteria 1999
74 Ga0070704_100453990 3300005549 Bacteria 1104
75 Ga0070704_100466949 3300005549 Bacteria 1090
76 Ga0070704_101857019 3300005549 Bacteria 558
77 Ga0070704_102119228 3300005549 Bacteria 522
78 Ga0068855_100104618 3300005563 Bacteria 3256
79 Ga0070664_101363768 3300005564 Bacteria 670
80 Ga0068854_100942400 3300005578 Bacteria 761
81 Ga0068856_102504517 3300005614 Unclassified 523
82 Ga0070702_100038832 3300005615 Bacteria 2653
83 Ga0070702_100242832 3300005615 Bacteria 1216
84 Ga0068859_100040209 3300005617 Bacteria 4694
85 Ga0068859_100066053 3300005617 Bacteria 3652
86 Ga0068859_100138737 3300005617 Bacteria 2505
87 Ga0068859_100608511 3300005617 Bacteria 1185
88 Ga0068864_100239802 3300005618 Bacteria 1680
89 Ga0068866_10011654 3300005718 Bacteria 3811
90 Ga0068866_10167203 3300005718 Bacteria 1288
91 Ga0068861_101070424 3300005719 Unclassified 773
92 Ga0068870_10059713 3300005840 Bacteria 2045
93 Ga0068863_100133207 3300005841 Bacteria 2373
94 Ga0068863_100395065 3300005841 Bacteria 1352
95 Ga0068858_100257399 3300005842 Bacteria 1658
96 Ga0068858_100681139 3300005842 Bacteria 1000
97 Ga0068858_101197678 3300005842 Bacteria 747
98 Ga0068860_100144216 3300005843 Bacteria 2290
99 Ga0068862_100037180 3300005844 Bacteria 4126
100 Ga0068862_100099443 3300005844 Bacteria 2542
101 Ga0068862_100142204 3300005844 Bacteria 2130
102 Ga0068862_100383476 3300005844 Bacteria 1311
103 Ga0070717_10000803 3300006028 Bacteria 20633
104 Ga0097621_100018522 3300006237 Bacteria 5322
105 Ga0097621_100037716 3300006237 Bacteria 3875
106 Ga0097621_100124047 3300006237 Bacteria 2193
107 Ga0097621_100324409 3300006237 Bacteria 1364
108 Ga0075370_10073192 3300006353 Bacteria 1962
109 Ga0068871_100036592 3300006358 Bacteria 3910
110 Ga0068871_100038924 3300006358 Bacteria 3802
111 Ga0068871_100101693 3300006358 Bacteria 2408
112 Ga0068871_100123625 3300006358 Bacteria 2188
113 Ga0075428_100017585 3300006844 Bacteria 7897
114 Ga0075428_100032594 3300006844 Bacteria 5755
115 Ga0075431_100004692 3300006847 Bacteria 13428
116 Ga0075431_100012979 3300006847 Bacteria 8411
117 Ga0075431_100030229 3300006847 Bacteria 5579
118 Ga0075429_100000146 3300006880 Bacteria 43486
119 Ga0075429_100199268 3300006880 Bacteria 1754
120 Ga0068865_100020337 3300006881 Bacteria 4303
121 Ga0068865_100036896 3300006881 Bacteria 3298
122 Ga0068865_100479972 3300006881 Bacteria 1033
123 Ga0097620_100040206 3300006931 Bacteria 4694
124 Ga0097620_100066052 3300006931 Bacteria 3652
125 Ga0097620_100138735 3300006931 Bacteria 2505
126 Ga0097620_100608514 3300006931 Bacteria 1185
127 Ga0105250_10211536 3300009092 Bacteria 820
128 Ga0111539_10055683 3300009094 Bacteria 4702
129 Ga0111539_11667922 3300009094 Unclassified 739
130 Ga0105245_10104739 3300009098 Bacteria 2623
131 Ga0105243_10079997 3300009148 Bacteria 2665
132 Ga0105242_10551928 3300009176 Bacteria 1105
133 Ga0105242_11833824 3300009176 Bacteria 646
134 Ga0105248_10021510 3300009177 Bacteria 7145
135 Ga0105248_10553699 3300009177 Bacteria 1297
136 Ga0105238_10003314 3300009551 Bacteria 16079
137 Ga0105249_10021294 3300009553 Bacteria 5805
138 Ga0105249_10149666 3300009553 Bacteria 2246
139 Ga0105249_10766724 3300009553 Bacteria 1027
140 Ga0105249_10942893 3300009553 Bacteria 931
141 Ga0105239_10171753 3300010375 Bacteria 2424
142 Ga0105246_10334145 3300011119 Bacteria 1236
143 Ga0105246_10875352 3300011119 Bacteria 803
144 Ga0157374_10035338 3300013296 Bacteria 4572
145 Ga0157374_10416324 3300013296 Bacteria 1342
146 Ga0163162_10834884 3300013306 Bacteria 1037
147 Ga0163162_11001273 3300013306 Unclassified 945
148 Ga0157372_10522732 3300013307 Bacteria 1383
149 Ga0157375_10328368 3300013308 Bacteria 1694
150 Ga0157375_11452372 3300013308 Unclassified 809
151 Ga0163163_10108950 3300014325 Bacteria 2797
152 Ga0157380_10083564 3300014326 Bacteria 2616
153 Ga0157380_10102285 3300014326 Unclassified 2389
154 Ga0157380_13408727 3300014326 Bacteria 509
155 Ga0182008_10017097 3300014497 Bacteria 3764
156 Ga0157377_10130378 3300014745 Bacteria 1535
157 Ga0157377_10187446 3300014745 Bacteria 1305
158 Ga0157377_10208997 3300014745 Bacteria 1243
159 Ga0157377_10894705 3300014745 Bacteria 663
160 Ga0157379_10490443 3300014968 Bacteria 1138
161 Ga0157379_10556695 3300014968 Bacteria 1067
162 Ga0157376_10010734 3300014969 Bacteria 6718
163 Ga0157376_10999172 3300014969 Bacteria 859
164 Ga0157376_12936303 3300014969 Unclassified 516
165 Ga0163161_11182401 3300017792 Unclassified 660
166 Ga0207425_1005094 3300025245 Bacteria 3806
167 Ga0209455_1000033 3300025272 Bacteria 504606
168 Ga0209025_1000036 3300025294 Bacteria 404113
169 Ga0209758_1018912 3300025297 Bacteria 3351
170 Ga0209256_1078550 3300025299 Bacteria 726
171 Ga0207697_10011498 3300025315 Bacteria 3742
172 Ga0207682_10535943 3300025893 Bacteria 554
173 Ga0207692_10160891 3300025898 Bacteria 1294
174 Ga0207642_10039950 3300025899 Bacteria 2043
175 Ga0207642_10478151 3300025899 Unclassified 759
176 Ga0207688_10837382 3300025901 Unclassified 583
177 Ga0207680_10179748 3300025903 Bacteria 1430
178 Ga0207645_10269644 3300025907 Bacteria 1129
179 Ga0207643_10169934 3300025908 Bacteria 1315
180 Ga0207643_10449244 3300025908 Bacteria 820
181 Ga0207705_10582513 3300025909 Bacteria 870
182 Ga0207695_10014828 3300025913 Bacteria 9205
183 Ga0207660_10759839 3300025917 Unclassified 791
184 Ga0207662_10002227 3300025918 Bacteria 9674
185 Ga0207662_10017457 3300025918 Bacteria 4060
186 Ga0207657_11041825 3300025919 Bacteria 627
187 Ga0207681_10024403 3300025923 Bacteria 3881
188 Ga0207681_10826765 3300025923 Bacteria 774
189 Ga0207694_10003656 3300025924 Bacteria 12181
190 Ga0207650_10185303 3300025925 Bacteria 1660
191 Ga0207659_10002741 3300025926 Bacteria 10504
192 Ga0207659_10209372 3300025926 Bacteria 1562
193 Ga0207659_10847624 3300025926 Bacteria 786
194 Ga0207659_11272259 3300025926 Bacteria 632
195 Ga0207687_10059054 3300025927 Bacteria 2701
196 Ga0207687_10126695 3300025927 Bacteria 1918
197 Ga0207687_10317998 3300025927 Bacteria 1259
198 Ga0207690_10304705 3300025932 Bacteria 1247
199 Ga0207686_10010996 3300025934 Bacteria 4940
200 Ga0207686_10017648 3300025934 Bacteria 4024
201 Ga0207670_10155130 3300025936 Bacteria 1703
202 Ga0207670_11187840 3300025936 Bacteria 645
203 Ga0207669_10240980 3300025937 Unclassified 1340
204 Ga0207669_10331710 3300025937 Bacteria 1168
205 Ga0207669_10429052 3300025937 Bacteria 1042
206 Ga0207691_10115173 3300025940 Bacteria 2387
207 Ga0207691_10270245 3300025940 Bacteria 1464
208 Ga0207711_10042004 3300025941 Bacteria 3895
209 Ga0207711_10240593 3300025941 Unclassified 1659
210 Ga0207689_10004549 3300025942 Bacteria 12553
211 Ga0207667_10274582 3300025949 Bacteria 1723
212 Ga0207651_10003189 3300025960 Bacteria 8009
213 Ga0207651_10084357 3300025960 Bacteria 2301
214 Ga0207712_10012301 3300025961 Bacteria 5469
215 Ga0207712_10041181 3300025961 Bacteria 3173
216 Ga0207712_11194101 3300025961 Unclassified 679
217 Ga0207668_10321015 3300025972 Unclassified 1285
218 Ga0207677_10482841 3300026023 Bacteria 1068
219 Ga0207677_10632785 3300026023 Bacteria 942
220 Ga0207703_10414427 3300026035 Bacteria 1252
221 Ga0207639_10000045 3300026041 Bacteria 136152
222 Ga0207708_10003954 3300026075 Bacteria 10911
223 Ga0207708_10089116 3300026075 Bacteria 2377
224 Ga0207708_10126216 3300026075 Bacteria 1997
225 Ga0207702_12179758 3300026078 Unclassified 543
226 Ga0207641_10011705 3300026088 Bacteria 7204
227 Ga0207641_10373228 3300026088 Bacteria 1364
228 Ga0207648_10036413 3300026089 Bacteria 4335
229 Ga0207676_10431743 3300026095 Bacteria 1238
230 Ga0207675_100005947 3300026118 Bacteria 11632
231 Ga0207675_101289332 3300026118 Bacteria 751
232 Ga0207683_10267327 3300026121 Bacteria 1562
233 Ga0207683_10455267 3300026121 Bacteria 1180
234 Ga0207683_10802229 3300026121 Bacteria 874
235 Ga0209983_1033951 3300027665 Bacteria 1092
236 Ga0207428_10436647 3300027907 Bacteria 955
237 Ga0268266_10015531 3300028379 Bacteria 6531
238 Ga0268265_10073809 3300028380 Bacteria 2666
239 Ga0268265_10075355 3300028380 Bacteria 2642
240 Ga0268265_11348930 3300028380 Bacteria 714
241 Ga0268265_11463324 3300028380 Unclassified 686
242 Ga0268265_12490479 3300028380 Unclassified 523
243 Ga0268264_10101413 3300028381 Bacteria 2502
244 Ga0316176_1008699 3300030732 Bacteria 3015
245 Ga0314311_1019551 3300030733 Bacteria 6054
246 Ga0314311_1123208 3300030733 Bacteria 2293
247 Ga0316179_1078399 3300030734 Bacteria 1067
248 Ga0316178_1104372 3300030735 Bacteria 1799
249 Ga0316180_1121245 3300030736 Bacteria 1125
250 Ga0316183_1018399 3300030742 Bacteria 3037
251 Ga0316182_1309802 3300030745 Bacteria 2125
252 Ga0307513_10000818 3300031456 Bacteria 45351
253 Ga0307408_100201920 3300031548 Bacteria 1610
254 Ga0307408_100231517 3300031548 Bacteria 1514
255 Ga0307408_100514203 3300031548 Bacteria 1050
256 Ga0307408_100940498 3300031548 Bacteria 793
257 Ga0307408_101866695 3300031548 Bacteria 575
258 Ga0307405_10979119 3300031731 Bacteria 720
259 Ga0307413_10323305 3300031824 Bacteria 1179
260 Ga0307410_11239582 3300031852 Bacteria 651
261 Ga0307406_10063481 3300031901 Bacteria 2393
262 Ga0307406_10213748 3300031901 Bacteria 1428
263 Ga0307407_10338024 3300031903 Unclassified 1062
264 Ga0307412_10032240 3300031911 Bacteria 3317
265 Ga0307412_10721785 3300031911 Bacteria 857
266 Ga0307409_100072204 3300031995 Bacteria 2747
267 Ga0307409_100569914 3300031995 Bacteria 1114
268 Ga0307409_100788405 3300031995 Bacteria 957
269 Ga0307416_100192443 3300032002 Bacteria 1925
270 Ga0307416_100980110 3300032002 Bacteria 948
271 Ga0307414_10123926 3300032004 Bacteria 1992
272 Ga0307414_10241445 3300032004 Bacteria 1496
273 Ga0307414_11024567 3300032004 Bacteria 760
274 Ga0307414_12296199 3300032004 Bacteria 504
275 Ga0307411_10026592 3300032005 Bacteria 3486
276 Ga0307411_10076048 3300032005 Bacteria 2294
277 Ga0307411_10369810 3300032005 Bacteria 1175
278 Ga0307411_11166564 3300032005 Bacteria 697
279 Ga0307415_100190661 3300032126 Bacteria 1617
280 Ga0307415_100196230 3300032126 Bacteria 1597
281 Ga0373951_0007145 3300035091 Bacteria 2540
282 Ga0373941_0313565 3300035115 Bacteria 629
283 Ga0373955_0782237 3300035172 Bacteria 586
284 Ga0373961_0083798 3300035241 Bacteria 1007
285 Ga0373924_0055815 3300035410 Bacteria 1644
286 Ga0373935_0005977 3300035692 Bacteria 7224
287 Ga0373935_0845182 3300035692 Bacteria 677
288 Ga0373927_0011316 3300035695 Bacteria 5938
289 Ga0373933_0245162 3300035724 Bacteria 1153
290 Ga0373937_0085824 3300036401 Bacteria 2913
291 Ga0373925_0013424 3300037068 Bacteria 5928
292 Ga0395899_0667567 3300037312 Unclassified 655
293 Ga0395900_1175602 3300037418 Unclassified 683
294 Ga0436365_1634409 3300039437 Bacteria 1710
295 Ga0439436_0005385 3300041404 Bacteria 3920
296 Ga0439436_0098532 3300041404 Bacteria 814
297 Ga0439439_0146116 3300041406 Bacteria 669
298 Ga0439447_011494 3300041407 Bacteria 2579
299 Ga0439447_076252 3300041407 Bacteria 776
300 Ga0439453_0006199 3300041408 Bacteria 1852
301 Ga0439465_0001493 3300041413 Bacteria 7588
302 Ga0451793_0010776 3300041452 Bacteria 771
303 Ga0451797_1512413 3300041453 Bacteria 726
304 Ga0451798_0402230 3300041458 Unclassified 1013
305 Ga0451798_0691127 3300041458 Bacteria 609
306 Ga0451835_0447207 3300041492 Bacteria 657
307 Ga0451851_1175157 3300041507 Bacteria 708
308 Ga0451853_1021208 3300041512 Bacteria 1061
309 Ga0439445_0005397 3300042004 Bacteria 2914
310 Ga0439445_0078740 3300042004 Bacteria 919
311 Ga0439432_014963 3300042006 Bacteria 2622
312 Ga0439432_062443 3300042006 Bacteria 1146
313 Ga0439449_0000206 3300042007 Bacteria 20728
314 Ga0439449_0108964 3300042007 Bacteria 1025
315 Ga0439449_0170859 3300042007 Bacteria 812
316 Ga0439457_015324 3300042014 Bacteria 1713
317 Ga0450921_018731 3300042123 Bacteria 645
318 Ga0450923_186130 3300042125 Bacteria 513
319 Ga0451577_0019029 3300042876 Bacteria 6321
320 Ga0451577_0863920 3300042876 Bacteria 816
321 Ga0466969_0117439 3300044656 Bacteria 1240
322 Ga0453683_0001649 3300044673 Bacteria 18724
323 Ga0453683_0132041 3300044673 Bacteria 1574
324 Ga0453683_0722832 3300044673 Bacteria 653
325 Ga0466965_0099210 3300044683 Bacteria 1488
326 Ga0466961_0077423 3300044693 Bacteria 2106
327 Ga0466963_0002888 3300044694 Bacteria 9705
328 Ga0466964_0398317 3300044706 Bacteria 718
329 Ga0453684_0184911 3300044712 Bacteria 2443
330 Ga0453684_0214897 3300044712 Unclassified 2232
331 Ga0453684_0285767 3300044712 Bacteria 1880
332 Ga0466971_0398521 3300044719 Bacteria 670
333 Ga0466970_0043444 3300044765 Bacteria 2391
334 Ga0466957_0058238 3300044842 Bacteria 2366
335 Ga0466960_0057812 3300044901 Bacteria 1893
336 Ga0451576_0005069 3300045051 Bacteria 16700
337 Ga0451576_0010749 3300045051 Bacteria 10477
338 Ga0451576_0017178 3300045051 Bacteria 7959
339 Ga0451576_0485012 3300045051 Bacteria 1298
340 Ga0451576_0638710 3300045051 Bacteria 1118
341 Ga0466967_0092916 3300045976 Bacteria 2744
342 Ga0495627_100018 3300046453 Bacteria 828
343 Ga0495603_0209246 3300046455 Bacteria 1126
344 Ga0495594_0064660 3300046499 Bacteria 2028
345 Ga0495622_0119675 3300046557 Bacteria 1203
346 Ga0495668_0001422 3300046616 Bacteria 23222
347 Ga0495659_0252874 3300046664 Bacteria 735
348 Ga0495658_0405013 3300046683 Bacteria 870
349 Ga0495669_0640066 3300046684 Unclassified 517
350 Ga0495670_0245801 3300046691 Bacteria 953
351 Ga0495636_0001221 3300047318 Bacteria 9710
352 Ga0495636_0007122 3300047318 Bacteria 4400
353 Ga0495636_0112380 3300047318 Bacteria 1199
354 Ga0495685_038173 3300047447 Bacteria 1646
355 Ga0496101_0026984 3300048904 Bacteria 3995
356 Ga0496102_0056303 3300048905 Bacteria 3587
357 Ga0496103_0119412 3300048906 Bacteria 1679
358 Ga0496104_0014429 3300048907 Bacteria 7138
359 Ga0496106_0140095 3300048909 Bacteria 1902
360 Ga0496106_0273661 3300048909 Bacteria 1352
361 Ga0496108_0011263 3300048911 Bacteria 7266
362 Ga0496109_0015431 3300048912 Bacteria 6658
363 Ga0496110_0835861 3300048913 Bacteria 826
364 Ga0496111_0015835 3300048914 Bacteria 5185
365 Ga0496112_0001717 3300048915 Bacteria 17117
366 Ga0496113_0088556 3300048916 Bacteria 2381
367 Ga0496114_0129915 3300048917 Bacteria 2175
368 Ga0496122_0425943 3300048925 Bacteria 666
369 Ga0496123_0220727 3300048926 Bacteria 956
370 Ga0501317_049068 3300049533 Bacteria 666
371 Ga0501031_0665860 3300049568 Bacteria 669
372 Ga0501036_0578714 3300049572 Bacteria 932
373 Ga0501038_1337628 3300049574 Bacteria 516
374 Ga0501040_0074015 3300049576 Bacteria 2354
375 Ga0501041_0137932 3300049577 Bacteria 1520
376 Ga0501046_0825393 3300049580 Bacteria 649
377 Ga0501071_0017033 3300049587 Bacteria 5005
378 Ga0501073_0533132 3300049589 Bacteria 811
379 Ga0501074_0345583 3300049590 Bacteria 1056
380 Ga0501074_0885938 3300049590 Bacteria 628
381 Ga0501075_0011392 3300049591 Bacteria 6294
382 Ga0501075_0045722 3300049591 Bacteria 3287
383 Ga0501076_0171462 3300049592 Bacteria 1768
384 Ga0501076_1116746 3300049592 Bacteria 649
385 Ga0501199_013825 3300049650 Bacteria 892
386 Ga0501202_100873 3300049652 Bacteria 703
387 Ga0501211_000370 3300049658 Bacteria 4222
388 Ga0501217_048658 3300049661 Bacteria 1102
389 Ga0501222_000718 3300049662 Bacteria 4828
390 Ga0501223_088320 3300049663 Bacteria 627
391 Ga0501235_003061 3300049669 Bacteria 3607
392 Ga0501250_022244 3300049680 Bacteria 829
393 Ga0501253_000787 3300049683 Bacteria 2919
394 Ga0501258_001947 3300049687 Bacteria 1763
395 Ga0501260_014358 3300049689 Unclassified 821
396 Ga0501221_000590 3300049704 Bacteria 5789
397 Ga0501225_0169492 3300049705 Bacteria 676
398 Ga0501229_001352 3300049706 Bacteria 2860
399 Ga0501245_052927 3300049708 Bacteria 724
400 Ga0501079_0067720 3300049741 Bacteria 2756
401 Ga0501080_0963414 3300049742 Bacteria 741
402 Ga0501232_016819 3300049757 Bacteria 904
403 Ga0501262_001024 3300049759 Bacteria 3174
404 Ga0501269_021398 3300049766 Bacteria 808
405 Ga0501270_045956 3300049767 Bacteria 776
406 Ga0501272_000197 3300049769 Bacteria 4959
407 Ga0501045_0643573 3300049824 Bacteria 784
408 Ga0501045_0940434 3300049824 Bacteria 634
409 nmdc:mga05p37_588_c1 3300050507 Bacteria 40012
410 nmdc:mga09592_116_c1 3300050508 Bacteria 50381
411 nmdc:mga09592_270339_c1 3300050508 Bacteria 1474
412 nmdc:mga06r32_13833_c1 3300050510 Bacteria 7321
413 nmdc:mga06r32_3824_c1 3300050510 Bacteria 13483
414 nmdc:mga08y16_28995_c1 3300050511 Bacteria 5833
415 nmdc:mga08y16_623117_c1 3300050511 Bacteria 1085
416 nmdc:mga0a205_1259483_c1 3300050515 Bacteria 587
417 Ga0495655_0000623 3300053083 Bacteria 5772
418 Ga0501084_0119238 3300054114 Bacteria 2218
419 Ga0590077_072379 3300059426 Bacteria 788
420 Ga0501082_0050936 3300060353 Bacteria 3570
421 Ga0530510_0609531 3300061734 Bacteria 830
422 2643741600 2643221544 Bacteria 5886209
423 2644259480 2643221646 Bacteria 6433402
424 2644528410 2643221695 Bacteria 3441323
425 Ga0307413_10806219
426 MRS1b_contig_2292353
427 MBSR1b_contig_12132459
428 JGI24750J21931_1045454
429 JGI24749J21850_1010394
430 JGI25151J46595_10000106
431 rootL2_10062912
432 rootH1_10155952
433 Ga0055529_1000027
434 Ga0065714_10096963
435 Ga0065712_10000916
436 Ga0065715_10000278
437 Ga0065707_10013551
438 Ga0070658_10247474
439 Ga0070658_10440280
440 Ga0070676_10172812
441 Ga0070670_100003450
442 Ga0070677_10468179
443 Ga0070666_10262522
444 Ga0070680_100237373
445 Ga0068868_100416343
446 Ga0068868_100531134
447 Ga0070689_100119338
448 Ga0070689_100133642
449 Ga0070687_100000994
450 Ga0070687_100069765
451 Ga0070687_100713177
452 Ga0070692_10050461
453 Ga0070668_100070948
454 Ga0070669_100121969
455 Ga0070675_100026039
456 Ga0070675_100094103
457 Ga0070675_100199816
458 Ga0070671_100395939
459 Ga0070674_100122964
460 Ga0070674_100281595
461 Ga0070674_100330960
462 Ga0070673_100005180
463 Ga0070673_100123815
464 Ga0070688_100003427
465 Ga0070688_100408503
466 Ga0070659_100758271
467 Ga0070667_100164876
468 Ga0070703_10600306
469 Ga0070701_10000130
470 Ga0070701_10000729
471 Ga0070701_10014784
472 Ga0070705_100071500
473 Ga0070700_100002634
474 Ga0070700_100062605
475 Ga0070700_100074405
476 Ga0070694_100018201
477 Ga0070694_100018517
478 Ga0070708_100603442
479 Ga0070663_101161274
480 Ga0070678_100588368
481 Ga0070662_100695214
482 Ga0068867_100089173
483 Ga0070685_10049490
484 Ga0070685_10276654
485 Ga0070699_100304429
486 Ga0070697_101068178
487 Ga0068853_100047882
488 Ga0070672_100817896
489 Ga0070672_101531748
490 Ga0070686_100056660
491 Ga0070686_100059404
492 Ga0070686_100489998
493 Ga0070695_100061760
494 Ga0070696_100056465
495 Ga0070693_100362887
496 Ga0070665_100008408
497 Ga0070704_100122686
498 Ga0070704_100453990
499 Ga0070704_100466949
500 Ga0070704_101857019
501 Ga0070704_102119228
502 Ga0068855_100104618
503 Ga0070664_101363768
504 Ga0068854_100942400
505 Ga0068856_102504517
506 Ga0070702_100038832
507 Ga0070702_100242832
508 Ga0068859_100040209
509 Ga0068859_100066053
510 Ga0068859_100138737
511 Ga0068859_100608511
512 Ga0068864_100239802
513 Ga0068866_10011654
514 Ga0068866_10167203
515 Ga0068861_101070424
516 Ga0068870_10059713
517 Ga0068863_100133207
518 Ga0068863_100395065
519 Ga0068858_100257399
520 Ga0068858_100681139
521 Ga0068858_101197678
522 Ga0068860_100144216
523 Ga0068862_100037180
524 Ga0068862_100099443
525 Ga0068862_100142204
526 Ga0068862_100383476
527 Ga0070717_10000803
528 Ga0097621_100018522
529 Ga0097621_100037716
530 Ga0097621_100124047
531 Ga0097621_100324409
532 Ga0075370_10073192
533 Ga0068871_100036592
534 Ga0068871_100038924
535 Ga0068871_100101693
536 Ga0068871_100123625
537 Ga0075428_100017585
538 Ga0075428_100032594
539 Ga0075431_100004692
540 Ga0075431_100012979
541 Ga0075431_100030229
542 Ga0075429_100000146
543 Ga0075429_100199268
544 Ga0068865_100020337
545 Ga0068865_100036896
546 Ga0068865_100479972
547 Ga0097620_100040206
548 Ga0097620_100066052
549 Ga0097620_100138735
550 Ga0097620_100608514
551 Ga0105250_10211536
552 Ga0111539_10055683
553 Ga0111539_11667922
554 Ga0105245_10104739
555 Ga0105243_10079997
556 Ga0105242_10551928
557 Ga0105242_11833824
558 Ga0105248_10021510
559 Ga0105248_10553699
560 Ga0105238_10003314
561 Ga0105249_10021294
562 Ga0105249_10149666
563 Ga0105249_10766724
564 Ga0105249_10942893
565 Ga0105239_10171753
566 Ga0105246_10334145
567 Ga0105246_10875352
568 Ga0157374_10035338
569 Ga0157374_10416324
570 Ga0163162_10834884
571 Ga0163162_11001273
572 Ga0157372_10522732
573 Ga0157375_10328368
574 Ga0157375_11452372
575 Ga0163163_10108950
576 Ga0157380_10083564
577 Ga0157380_10102285
578 Ga0157380_13408727
579 Ga0182008_10017097
580 Ga0157377_10130378
581 Ga0157377_10187446
582 Ga0157377_10208997
583 Ga0157377_10894705
584 Ga0157379_10490443
585 Ga0157379_10556695
586 Ga0157376_10010734
587 Ga0157376_10999172
588 Ga0157376_12936303
589 Ga0163161_11182401
590 Ga0207425_1005094
591 Ga0209455_1000033
592 Ga0209025_1000036
593 Ga0209758_1018912
594 Ga0209256_1078550
595 Ga0207697_10011498
596 Ga0207682_10535943
597 Ga0207692_10160891
598 Ga0207642_10039950
599 Ga0207642_10478151
600 Ga0207688_10837382
601 Ga0207680_10179748
602 Ga0207645_10269644
603 Ga0207643_10169934
604 Ga0207643_10449244
605 Ga0207705_10582513
606 Ga0207695_10014828
607 Ga0207660_10759839
608 Ga0207662_10002227
609 Ga0207662_10017457
610 Ga0207657_11041825
611 Ga0207681_10024403
612 Ga0207681_10826765
613 Ga0207694_10003656
614 Ga0207650_10185303
615 Ga0207659_10002741
616 Ga0207659_10209372
617 Ga0207659_10847624
618 Ga0207659_11272259
619 Ga0207687_10059054
620 Ga0207687_10126695
621 Ga0207687_10317998
622 Ga0207690_10304705
623 Ga0207686_10010996
624 Ga0207686_10017648
625 Ga0207670_10155130
626 Ga0207670_11187840
627 Ga0207669_10240980
628 Ga0207669_10331710
629 Ga0207669_10429052
630 Ga0207691_10115173
631 Ga0207691_10270245
632 Ga0207711_10042004
633 Ga0207711_10240593
634 Ga0207689_10004549
635 Ga0207667_10274582
636 Ga0207651_10003189
637 Ga0207651_10084357
638 Ga0207712_10012301
639 Ga0207712_10041181
640 Ga0207712_11194101
641 Ga0207668_10321015
642 Ga0207677_10482841
643 Ga0207677_10632785
644 Ga0207703_10414427
645 Ga0207639_10000045
646 Ga0207708_10003954
647 Ga0207708_10089116
648 Ga0207708_10126216
649 Ga0207702_12179758
650 Ga0207641_10011705
651 Ga0207641_10373228
652 Ga0207648_10036413
653 Ga0207676_10431743
654 Ga0207675_100005947
655 Ga0207675_101289332
656 Ga0207683_10267327
657 Ga0207683_10455267
658 Ga0207683_10802229
659 Ga0209983_1033951
660 Ga0207428_10436647
661 Ga0268266_10015531
662 Ga0268265_10073809
663 Ga0268265_10075355
664 Ga0268265_11348930
665 Ga0268265_11463324
666 Ga0268265_12490479
667 Ga0268264_10101413
668 Ga0316176_1008699
669 Ga0314311_1019551
670 Ga0314311_1123208
671 Ga0316179_1078399
672 Ga0316178_1104372
673 Ga0316180_1121245
674 Ga0316183_1018399
675 Ga0316182_1309802
676 Ga0307513_10000818
677 Ga0307408_100201920
678 Ga0307408_100231517
679 Ga0307408_100514203
680 Ga0307408_100940498
681 Ga0307408_101866695
682 Ga0307405_10979119
683 Ga0307413_10323305
684 Ga0307410_11239582
685 Ga0307406_10063481
686 Ga0307406_10213748
687 Ga0307407_10338024
688 Ga0307412_10032240
689 Ga0307412_10721785
690 Ga0307409_100072204
691 Ga0307409_100569914
692 Ga0307409_100788405
693 Ga0307416_100192443
694 Ga0307416_100980110
695 Ga0307414_10123926
696 Ga0307414_10241445
697 Ga0307414_11024567
698 Ga0307414_12296199
699 Ga0307411_10026592
700 Ga0307411_10076048
701 Ga0307411_10369810
702 Ga0307411_11166564
703 Ga0307415_100190661
704 Ga0307415_100196230
705 Ga0373951_0007145
706 Ga0373941_0313565
707 Ga0373955_0782237
708 Ga0373961_0083798
709 Ga0373924_0055815
710 Ga0373935_0005977
711 Ga0373935_0845182
712 Ga0373927_0011316
713 Ga0373933_0245162
714 Ga0373937_0085824
715 Ga0373925_0013424
716 Ga0395899_0667567
717 Ga0395900_1175602
718 Ga0436365_1634409
719 Ga0439436_0005385
720 Ga0439436_0098532
721 Ga0439439_0146116
722 Ga0439447_011494
723 Ga0439447_076252
724 Ga0439453_0006199
725 Ga0439465_0001493
726 Ga0451793_0010776
727 Ga0451797_1512413
728 Ga0451798_0402230
729 Ga0451798_0691127
730 Ga0451835_0447207
731 Ga0451851_1175157
732 Ga0451853_1021208
733 Ga0439445_0005397
734 Ga0439445_0078740
735 Ga0439432_014963
736 Ga0439432_062443
737 Ga0439449_0000206
738 Ga0439449_0108964
739 Ga0439449_0170859
740 Ga0439457_015324
741 Ga0450921_018731
742 Ga0450923_186130
743 Ga0451577_0019029
744 Ga0451577_0863920
745 Ga0466969_0117439
746 Ga0453683_0001649
747 Ga0453683_0132041
748 Ga0453683_0722832
749 Ga0466965_0099210
750 Ga0466961_0077423
751 Ga0466963_0002888
752 Ga0466964_0398317
753 Ga0453684_0184911
754 Ga0453684_0214897
755 Ga0453684_0285767
756 Ga0466971_0398521
757 Ga0466970_0043444
758 Ga0466957_0058238
759 Ga0466960_0057812
760 Ga0451576_0005069
761 Ga0451576_0010749
762 Ga0451576_0017178
763 Ga0451576_0485012
764 Ga0451576_0638710
765 Ga0466967_0092916
766 Ga0495627_100018
767 Ga0495603_0209246
768 Ga0495594_0064660
769 Ga0495622_0119675
770 Ga0495668_0001422
771 Ga0495659_0252874
772 Ga0495658_0405013
773 Ga0495669_0640066
774 Ga0495670_0245801
775 Ga0495636_0001221
776 Ga0495636_0007122
777 Ga0495636_0112380
778 Ga0495685_038173
779 Ga0496101_0026984
780 Ga0496102_0056303
781 Ga0496103_0119412
782 Ga0496104_0014429
783 Ga0496106_0140095
784 Ga0496106_0273661
785 Ga0496108_0011263
786 Ga0496109_0015431
787 Ga0496110_0835861
788 Ga0496111_0015835
789 Ga0496112_0001717
790 Ga0496113_0088556
791 Ga0496114_0129915
792 Ga0496122_0425943
793 Ga0496123_0220727
794 Ga0501317_049068
795 Ga0501031_0665860
796 Ga0501036_0578714
797 Ga0501038_1337628
798 Ga0501040_0074015
799 Ga0501041_0137932
800 Ga0501046_0825393
801 Ga0501071_0017033
802 Ga0501073_0533132
803 Ga0501074_0345583
804 Ga0501074_0885938
805 Ga0501075_0011392
806 Ga0501075_0045722
807 Ga0501076_0171462
808 Ga0501076_1116746
809 Ga0501199_013825
810 Ga0501202_100873
811 Ga0501211_000370
812 Ga0501217_048658
813 Ga0501222_000718
814 Ga0501223_088320
815 Ga0501235_003061
816 Ga0501250_022244
817 Ga0501253_000787
818 Ga0501258_001947
819 Ga0501260_014358
820 Ga0501221_000590
821 Ga0501225_0169492
822 Ga0501229_001352
823 Ga0501245_052927
824 Ga0501079_0067720
825 Ga0501080_0963414
826 Ga0501232_016819
827 Ga0501262_001024
828 Ga0501269_021398
829 Ga0501270_045956
830 Ga0501272_000197
831 Ga0501045_0643573
832 Ga0501045_0940434
833 nmdc:mga05p37_588_c1
834 nmdc:mga09592_116_c1
835 nmdc:mga09592_270339_c1
836 nmdc:mga06r32_13833_c1
837 nmdc:mga06r32_3824_c1
838 nmdc:mga08y16_28995_c1
839 nmdc:mga08y16_623117_c1
840 nmdc:mga0a205_1259483_c1
841 Ga0495655_0000623
842 Ga0501084_0119238
843 Ga0590077_072379
844 Ga0501082_0050936
845 Ga0530510_0609531
846 2643741600
847 2644259480
848 2644528410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

3

125

0.95

PF04343

DUF488

Domain of unknown function DUF488

4

121

0.87

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

2

128

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p6k-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5926 1 128
2e4r-assembly1.cif.gz_B mutant i253m structure of ph0725 from pyrococcus horikoshii ot3 0.5808 1 128
2p6d-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.58 1 128
2el1-assembly1.cif.gz_B structural study of project id ph0725 from pyrococcus horikoshii ot3 (l44m) 0.5792 1 128
2pca-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5757 1 128
ID Description Score Start End Superfamily
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5838 81 128 3.40.1010.10
1wngA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5481 1 128 3.40.1010.10
1wdeA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5475 1 128 3.40.1010.10
af_K7MIR4_1_151_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5432 52 92 1.25.40.10
af_Q9N4E0_171_311_3.40.50.12670 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5377 84 123 3.40.50.12670
ID Description Score Start End GO Terms
AF-A0A157Z7I5-F1-model_v4 DUF488 domain-containing protein 0.9935 1 125
AF-A0A157ZQZ9-F1-model_v4 DUF488 domain-containing protein 0.9927 1 128
AF-A0A7L6AB11-F1-model_v4 DUF488 family protein 0.9924 1 124
AF-A0A519ZC59-F1-model_v4 DUF488 family protein 0.992 21 128
AF-A0A375BAR4-F1-model_v4 deleted 0.9911 1 128

Map