F440533

General Info

Members Datasets Scaffolds Average Seq Length
423 223 423 148

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10404596|Ga0207649_104045962
Length 176
Sequence MDCEYGAATRKSESGAAASLADAAAGKSSGRATMTTIELFTDGACSGNPGPGGWAAILRSGPHESELSGGEALTTNNRMEMTAVIEGLKALKKNSAVTIHTDSRYVMDGASKWIIGWKKKGWKTADKKPVKNEDLWRALDEEMARHQIRWIWVAGHSGHPENERADALARGAIPGP

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 0.95
Rhizosphere 87.47
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000222 3300002705 Bacteria 39568
2 JGI25154J39366_1001936 3300002738 Bacteria 6173
3 JGI25157J39369_1000056 3300002741 Bacteria 107681
4 JGI25165J46597_1000036 3300003214 Bacteria 286380
5 JGI25153J46596_10000638 3300003215 Bacteria 21413
6 rootH1_10039875 3300003316 Bacteria 5671
7 rootH2_10006278 3300003320 Bacteria 3048
8 Ga0055539_1002458 3300003752 Bacteria 2823
9 Ga0055539_1015898 3300003752 Bacteria 914
10 Ga0070658_10002507 3300005327 Bacteria 15338
11 Ga0070658_10056877 3300005327 Bacteria 3180
12 Ga0070658_10062081 3300005327 Bacteria 3045
13 Ga0070658_10241567 3300005327 Bacteria 1531
14 Ga0070658_10635911 3300005327 Unclassified 926
15 Ga0070658_11362924 3300005327 Bacteria 616
16 Ga0070683_100095395 3300005329 Bacteria 2797
17 Ga0070690_100019828 3300005330 Bacteria 4090
18 Ga0070670_100803000 3300005331 Unclassified 850
19 Ga0068869_100572912 3300005334 Bacteria 951
20 Ga0068869_100653677 3300005334 Bacteria 893
21 Ga0070666_10042849 3300005335 Bacteria 3029
22 Ga0070666_10059192 3300005335 Bacteria 2591
23 Ga0070680_100026152 3300005336 Bacteria 4667
24 Ga0070680_100306648 3300005336 Bacteria 1346
25 Ga0070660_100006467 3300005339 Bacteria 8125
26 Ga0070660_100006576 3300005339 Bacteria 8062
27 Ga0070660_100252513 3300005339 Bacteria 1438
28 Ga0070660_101063153 3300005339 Bacteria 685
29 Ga0070691_10486915 3300005341 Bacteria 711
30 Ga0070661_100000741 3300005344 Bacteria 23706
31 Ga0070661_100094609 3300005344 Bacteria 2215
32 Ga0070661_101256190 3300005344 Bacteria 620
33 Ga0070668_100601234 3300005347 Bacteria 962
34 Ga0070674_100761641 3300005356 Bacteria 833
35 Ga0070673_100867418 3300005364 Bacteria 836
36 Ga0070688_100407162 3300005365 Bacteria 1008
37 Ga0070659_100040672 3300005366 Bacteria 3633
38 Ga0070667_100281714 3300005367 Bacteria 1493
39 Ga0070667_100868975 3300005367 Bacteria 839
40 Ga0070700_100053641 3300005441 Bacteria 2517
41 Ga0070663_100309921 3300005455 Bacteria 1266
42 Ga0070678_100036663 3300005456 Bacteria 3434
43 Ga0070678_100612760 3300005456 Bacteria 973
44 Ga0070662_100287911 3300005457 Bacteria 1331
45 Ga0070679_100113247 3300005530 Bacteria 2698
46 Ga0070679_100261451 3300005530 Bacteria 1686
47 Ga0070679_100285106 3300005530 Bacteria 1604
48 Ga0070684_100248742 3300005535 Bacteria 1625
49 Ga0068853_100229881 3300005539 Bacteria 1696
50 Ga0068853_100744156 3300005539 Bacteria 937
51 Ga0068853_101002742 3300005539 Bacteria 804
52 Ga0070686_100312451 3300005544 Bacteria 1169
53 Ga0070695_100006772 3300005545 Bacteria 6783
54 Ga0070665_100000381 3300005548 Bacteria 65638
55 Ga0070665_100073535 3300005548 Bacteria 3424
56 Ga0070665_100303207 3300005548 Bacteria 1600
57 Ga0068855_100004492 3300005563 Bacteria 17050
58 Ga0068855_100191358 3300005563 Bacteria 2307
59 Ga0068855_100219316 3300005563 Bacteria 2134
60 Ga0068855_101871116 3300005563 Bacteria 608
61 Ga0068857_100003268 3300005577 Bacteria 13471
62 Ga0068857_100072280 3300005577 Bacteria 3074
63 Ga0068857_100156844 3300005577 Bacteria 2064
64 Ga0068857_100223619 3300005577 Bacteria 1720
65 Ga0068857_100288593 3300005577 Bacteria 1510
66 Ga0068857_100870202 3300005577 Bacteria 863
67 Ga0068857_100988063 3300005577 Bacteria 810
68 Ga0068854_101522034 3300005578 Bacteria 608
69 Ga0068856_100007974 3300005614 Bacteria 10343
70 Ga0068856_100049908 3300005614 Bacteria 4124
71 Ga0068856_100063433 3300005614 Bacteria 3651
72 Ga0068852_100268488 3300005616 Bacteria 1641
73 Ga0068864_100086570 3300005618 Bacteria 2757
74 Ga0068866_10021161 3300005718 Bacteria 2992
75 Ga0068861_100014752 3300005719 Bacteria 5490
76 Ga0068861_100202819 3300005719 Bacteria 1666
77 Ga0068861_100377527 3300005719 Bacteria 1251
78 Ga0068863_100028623 3300005841 Bacteria 5319
79 Ga0068863_102046012 3300005841 Bacteria 583
80 Ga0068860_101069036 3300005843 Bacteria 826
81 Ga0068862_100338831 3300005844 Bacteria 1392
82 Ga0081455_10003020 3300005937 Bacteria 19620
83 Ga0081540_1023816 3300005983 Bacteria 3568
84 Ga0075365_10002139 3300006038 Bacteria 9479
85 Ga0070712_100492979 3300006175 Bacteria 1026
86 Ga0075367_10077405 3300006178 Bacteria 2008
87 Ga0075366_10017186 3300006195 Bacteria 4161
88 Ga0075366_10031057 3300006195 Bacteria 3143
89 Ga0097621_100530362 3300006237 Bacteria 1070
90 Ga0075370_10064287 3300006353 Bacteria 2092
91 Ga0075370_10166638 3300006353 Bacteria 1294
92 Ga0068871_100000805 3300006358 Bacteria 21096
93 Ga0068871_101046268 3300006358 Bacteria 762
94 Ga0075433_10466129 3300006852 Bacteria 1113
95 Ga0068865_100004736 3300006881 Bacteria 8219
96 Ga0075435_100970619 3300007076 Bacteria 742
97 Ga0105240_10067115 3300009093 Bacteria 4447
98 Ga0105240_10070676 3300009093 Bacteria 4318
99 Ga0105240_10159923 3300009093 Bacteria 2676
100 Ga0105240_10243264 3300009093 Bacteria 2085
101 Ga0105240_10252235 3300009093 Bacteria 2040
102 Ga0105240_10282982 3300009093 Bacteria 1904
103 Ga0105240_10308211 3300009093 Bacteria 1809
104 Ga0105240_11264050 3300009093 Bacteria 780
105 Ga0105245_10135024 3300009098 Bacteria 2318
106 Ga0105245_11089052 3300009098 Bacteria 845
107 Ga0105247_10111633 3300009101 Bacteria 1760
108 Ga0114129_11100253 3300009147 Bacteria 995
109 Ga0105243_10101455 3300009148 Bacteria 2389
110 Ga0105243_10491742 3300009148 Bacteria 1160
111 Ga0105243_10896473 3300009148 Bacteria 882
112 Ga0105243_11119026 3300009148 Bacteria 797
113 Ga0105243_11278906 3300009148 Bacteria 750
114 Ga0105241_10113267 3300009174 Bacteria 2174
115 Ga0105241_10121871 3300009174 Bacteria 2101
116 Ga0105241_11038433 3300009174 Bacteria 769
117 Ga0105242_10117082 3300009176 Bacteria 2281
118 Ga0105242_10309221 3300009176 Bacteria 1445
119 Ga0105242_10768492 3300009176 Bacteria 950
120 Ga0105242_11865550 3300009176 Bacteria 641
121 Ga0105237_10242234 3300009545 Bacteria 1805
122 Ga0105237_10267422 3300009545 Bacteria 1713
123 Ga0105237_10561217 3300009545 Bacteria 1148
124 Ga0105237_10658839 3300009545 Bacteria 1053
125 Ga0105237_10822789 3300009545 Bacteria 935
126 Ga0105238_10008779 3300009551 Bacteria 10111
127 Ga0105238_10037180 3300009551 Bacteria 4950
128 Ga0105238_10099495 3300009551 Bacteria 2891
129 Ga0105238_10103963 3300009551 Bacteria 2821
130 Ga0105238_10156483 3300009551 Bacteria 2254
131 Ga0105238_10187539 3300009551 Bacteria 2044
132 Ga0105238_10210886 3300009551 Bacteria 1918
133 Ga0105238_10333198 3300009551 Bacteria 1505
134 Ga0105249_10222999 3300009553 Bacteria 1856
135 Ga0105249_10294725 3300009553 Bacteria 1625
136 Ga0105249_11817670 3300009553 Bacteria 682
137 Ga0105239_10136123 3300010375 Bacteria 2735
138 Ga0105239_10649233 3300010375 Bacteria 1205
139 Ga0105239_10651718 3300010375 Bacteria 1203
140 Ga0105239_10922125 3300010375 Bacteria 1003
141 Ga0105239_11676199 3300010375 Bacteria 736
142 Ga0105239_12362899 3300010375 Bacteria 619
143 Ga0105246_10068275 3300011119 Bacteria 2493
144 Ga0105246_10356723 3300011119 Bacteria 1200
145 Ga0157373_10159021 3300013100 Bacteria 1589
146 Ga0157371_10042460 3300013102 Bacteria 3241
147 Ga0157370_10004733 3300013104 Bacteria 15514
148 Ga0157370_10132921 3300013104 Bacteria 2321
149 Ga0157370_10201526 3300013104 Bacteria 1846
150 Ga0157370_10344482 3300013104 Bacteria 1374
151 Ga0157374_10061712 3300013296 Bacteria 3512
152 Ga0157378_10013704 3300013297 Bacteria 7091
153 Ga0157378_10099867 3300013297 Bacteria 2648
154 Ga0163162_10237609 3300013306 Bacteria 1953
155 Ga0163162_11250242 3300013306 Bacteria 843
156 Ga0157372_10056784 3300013307 Bacteria 4374
157 Ga0157372_11286267 3300013307 Bacteria 844
158 Ga0157375_10082607 3300013308 Bacteria 3255
159 Ga0157375_12873676 3300013308 Bacteria 576
160 Ga0163163_10667503 3300014325 Bacteria 1103
161 Ga0163163_11127500 3300014325 Bacteria 847
162 Ga0157379_10718459 3300014968 Bacteria 939
163 Ga0157379_10926504 3300014968 Bacteria 828
164 Ga0157376_10092811 3300014969 Bacteria 2618
165 Ga0157376_11305000 3300014969 Bacteria 756
166 Ga0182007_10075812 3300015262 Bacteria 1102
167 Ga0207427_100499 3300025231 Bacteria 20877
168 Ga0207427_103565 3300025231 Bacteria 3176
169 Ga0209258_102942 3300025242 Bacteria 3980
170 Ga0209646_1000124 3300025246 Bacteria 138207
171 Ga0209026_1000085 3300025250 Bacteria 185778
172 Ga0209677_100203 3300025253 Bacteria 47561
173 Ga0209677_100768 3300025253 Bacteria 16243
174 Ga0209759_1000068 3300025256 Bacteria 183479
175 Ga0209759_1032990 3300025256 Bacteria 988
176 Ga0209233_1000015 3300025261 Bacteria 980563
177 Ga0209758_1000013 3300025297 Bacteria 873003
178 Ga0209758_1148443 3300025297 Bacteria 598
179 Ga0207692_10223859 3300025898 Bacteria 1116
180 Ga0207642_10188255 3300025899 Bacteria 1130
181 Ga0207642_10218807 3300025899 Bacteria 1063
182 Ga0207642_10746642 3300025899 Bacteria 619
183 Ga0207705_10000474 3300025909 Bacteria 34416
184 Ga0207705_10057540 3300025909 Bacteria 2804
185 Ga0207705_10118204 3300025909 Bacteria 1964
186 Ga0207705_10224936 3300025909 Bacteria 1426
187 Ga0207705_10270907 3300025909 Bacteria 1298
188 Ga0207654_10042972 3300025911 Bacteria 2560
189 Ga0207654_10290260 3300025911 Bacteria 1109
190 Ga0207707_10009023 3300025912 Bacteria 8665
191 Ga0207695_10010508 3300025913 Bacteria 11323
192 Ga0207695_10026992 3300025913 Bacteria 6397
193 Ga0207695_10049604 3300025913 Bacteria 4423
194 Ga0207695_10285461 3300025913 Bacteria 1544
195 Ga0207695_10367761 3300025913 Bacteria 1324
196 Ga0207671_10515715 3300025914 Bacteria 953
197 Ga0207693_10525529 3300025915 Bacteria 923
198 Ga0207663_10942978 3300025916 Bacteria 691
199 Ga0207660_10002089 3300025917 Bacteria 13240
200 Ga0207657_10000541 3300025919 Bacteria 40337
201 Ga0207657_10014611 3300025919 Bacteria 7651
202 Ga0207657_10037025 3300025919 Bacteria 4362
203 Ga0207657_11075647 3300025919 Bacteria 615
204 Ga0207649_10000080 3300025920 Bacteria 82307
205 Ga0207649_10404596 3300025920 Bacteria 1022
206 Ga0207652_10000973 3300025921 Bacteria 26573
207 Ga0207652_10298442 3300025921 Bacteria 1454
208 Ga0207652_10331554 3300025921 Bacteria 1374
209 Ga0207652_10354937 3300025921 Bacteria 1323
210 Ga0207694_10011511 3300025924 Bacteria 6676
211 Ga0207694_10014844 3300025924 Bacteria 5874
212 Ga0207694_10099433 3300025924 Bacteria 2304
213 Ga0207687_10568409 3300025927 Bacteria 953
214 Ga0207700_10359987 3300025928 Bacteria 1268
215 Ga0207700_11043432 3300025928 Bacteria 731
216 Ga0207644_11402332 3300025931 Bacteria 587
217 Ga0207690_10039931 3300025932 Bacteria 3065
218 Ga0207690_10356117 3300025932 Bacteria 1158
219 Ga0207706_11621452 3300025933 Bacteria 523
220 Ga0207686_10015274 3300025934 Bacteria 4290
221 Ga0207686_10216221 3300025934 Bacteria 1381
222 Ga0207709_10991051 3300025935 Bacteria 686
223 Ga0207709_11632735 3300025935 Bacteria 535
224 Ga0207704_10129565 3300025938 Bacteria 1744
225 Ga0207691_10716514 3300025940 Bacteria 843
226 Ga0207711_10437659 3300025941 Bacteria 1217
227 Ga0207711_10600985 3300025941 Bacteria 1026
228 Ga0207689_10066707 3300025942 Bacteria 2958
229 Ga0207689_10648496 3300025942 Bacteria 889
230 Ga0207661_10058666 3300025944 Bacteria 3098
231 Ga0207661_10256214 3300025944 Bacteria 1557
232 Ga0207679_10401493 3300025945 Bacteria 1206
233 Ga0207667_10029897 3300025949 Bacteria 5902
234 Ga0207667_10049792 3300025949 Bacteria 4422
235 Ga0207667_10064776 3300025949 Bacteria 3814
236 Ga0207667_10310950 3300025949 Bacteria 1609
237 Ga0207667_10379836 3300025949 Bacteria 1440
238 Ga0207667_10426065 3300025949 Bacteria 1350
239 Ga0207667_10807736 3300025949 Bacteria 934
240 Ga0207668_10339246 3300025972 Bacteria 1253
241 Ga0207640_10015177 3300025981 Bacteria 4453
242 Ga0207640_10237386 3300025981 Bacteria 1406
243 Ga0207640_10450730 3300025981 Bacteria 1060
244 Ga0207703_10075896 3300026035 Bacteria 2787
245 Ga0207703_10652815 3300026035 Bacteria 998
246 Ga0207703_11032946 3300026035 Bacteria 789
247 Ga0207639_10548431 3300026041 Bacteria 1061
248 Ga0207639_10581200 3300026041 Bacteria 1031
249 Ga0207639_10668811 3300026041 Bacteria 962
250 Ga0207678_10179579 3300026067 Bacteria 1807
251 Ga0207708_10873360 3300026075 Bacteria 777
252 Ga0207702_10000235 3300026078 Bacteria 64091
253 Ga0207641_12226908 3300026088 Bacteria 548
254 Ga0207648_10456454 3300026089 Bacteria 1164
255 Ga0207648_10567743 3300026089 Bacteria 1043
256 Ga0207676_10317866 3300026095 Bacteria 1428
257 Ga0207674_10093073 3300026116 Bacteria 3003
258 Ga0207674_10104187 3300026116 Bacteria 2816
259 Ga0207674_10521469 3300026116 Bacteria 1148
260 Ga0207674_10961018 3300026116 Bacteria 823
261 Ga0207674_11256434 3300026116 Bacteria 710
262 Ga0207675_100064205 3300026118 Bacteria 3432
263 Ga0207683_10009569 3300026121 Bacteria 8263
264 Ga0207683_10998186 3300026121 Bacteria 777
265 Ga0207698_10943619 3300026142 Bacteria 871
266 Ga0268266_10033242 3300028379 Bacteria 4385
267 Ga0268266_10091907 3300028379 Bacteria 2662
268 Ga0268264_10423297 3300028381 Bacteria 1285
269 Ga0265336_10000813 3300028666 Bacteria 16445
270 Ga0307517_10148566 3300028786 Bacteria 1617
271 Ga0265338_10032597 3300028800 Bacteria 5075
272 Ga0265324_10001876 3300029957 Bacteria 11312
273 Ga0307511_10247951 3300030521 Bacteria 859
274 Ga0265320_10206925 3300031240 Bacteria 875
275 Ga0265329_10052504 3300031242 Bacteria 1297
276 Ga0265339_10088546 3300031249 Bacteria 1626
277 Ga0265339_10461551 3300031249 Bacteria 589
278 Ga0265331_10000003 3300031250 Bacteria 499358
279 Ga0265331_10001245 3300031250 Bacteria 19114
280 Ga0265331_10036411 3300031250 Bacteria 2416
281 Ga0265327_10000187 3300031251 Bacteria 131135
282 Ga0265316_10000393 3300031344 Bacteria 49924
283 Ga0265313_10120574 3300031595 Bacteria 1144
284 Ga0265314_10011954 3300031711 Bacteria 7120
285 Ga0265314_10021623 3300031711 Bacteria 4941
286 Ga0265314_10038218 3300031711 Bacteria 3470
287 Ga0265314_10074130 3300031711 Bacteria 2268
288 Ga0265314_10115590 3300031711 Bacteria 1697
289 Ga0265314_10529916 3300031711 Bacteria 616
290 Ga0307516_10014476 3300031730 Bacteria 8341
291 Ga0373937_0373018 3300036401 Bacteria 1353
292 Ga0395900_0036616 3300037418 Bacteria 5059
293 Ga0395900_0167482 3300037418 Bacteria 2239
294 Ga0395898_0453355 3300037466 Bacteria 1221
295 Ga0395901_0015920 3300038443 Bacteria 7661
296 Ga0395901_0031861 3300038443 Bacteria 5436
297 Ga0436361_0501198 3300039447 Bacteria 3476
298 Ga0436361_1052949 3300039447 Bacteria 1005
299 Ga0451789_0760355 3300041443 Bacteria 630
300 Ga0451791_0001192 3300041451 Bacteria 534
301 Ga0451800_0794675 3300041459 Bacteria 611
302 Ga0451837_0956472 3300041494 Bacteria 535
303 Ga0451841_1055949 3300041498 Bacteria 943
304 Ga0451577_0402650 3300042876 Bacteria 1242
305 Ga0466961_0583454 3300044693 Bacteria 673
306 Ga0453684_0001126 3300044712 Bacteria 83760
307 Ga0466971_0564299 3300044719 Unclassified 566
308 Ga0466957_0025721 3300044842 Bacteria 3490
309 Ga0466957_0059968 3300044842 Bacteria 2333
310 Ga0451576_0206894 3300045051 Bacteria 2049
311 Ga0451576_0279393 3300045051 Bacteria 1746
312 Ga0466958_0000187 3300045836 Bacteria 22479
313 Ga0495651_0364365 3300046462 Bacteria 952
314 Ga0495650_0163442 3300046471 Bacteria 792
315 Ga0495639_0089617 3300046475 Bacteria 1441
316 Ga0495583_0000224 3300046506 Bacteria 95810
317 Ga0495606_0004414 3300046507 Bacteria 14072
318 Ga0495606_0435066 3300046507 Bacteria 675
319 Ga0495654_0101419 3300046530 Bacteria 1325
320 Ga0495668_0012115 3300046616 Bacteria 5129
321 Ga0495625_0101484 3300046660 Bacteria 1976
322 Ga0495625_0671943 3300046660 Bacteria 615
323 Ga0495649_0045088 3300046694 Bacteria 2405
324 Ga0495649_0366900 3300046694 Bacteria 726
325 Ga0495676_0314678 3300047321 Bacteria 1053
326 Ga0495602_0275373 3300048088 Bacteria 1242
327 Ga0496115_0221317 3300048918 Bacteria 1562
328 Ga0496121_0010270 3300048924 Bacteria 10593
329 Ga0501032_0019432 3300049569 Bacteria 4753
330 Ga0501033_0006232 3300049570 Bacteria 9348
331 Ga0501033_0030506 3300049570 Bacteria 4051
332 Ga0501033_0038864 3300049570 Bacteria 3555
333 Ga0501033_0113198 3300049570 Bacteria 1973
334 Ga0501033_0346853 3300049570 Bacteria 1040
335 Ga0501033_0967030 3300049570 Bacteria 570
336 Ga0501034_0006522 3300049571 Bacteria 12545
337 Ga0501034_0067731 3300049571 Unclassified 3582
338 Ga0501034_0986260 3300049571 Bacteria 727
339 Ga0501036_0054596 3300049572 Bacteria 3384
340 Ga0501036_0098206 3300049572 Bacteria 2476
341 Ga0501036_0133486 3300049572 Bacteria 2095
342 Ga0501037_0049579 3300049573 Bacteria 3074
343 Ga0501037_0103343 3300049573 Bacteria 2055
344 Ga0501037_0192646 3300049573 Bacteria 1443
345 Ga0501037_0246172 3300049573 Bacteria 1252
346 Ga0501038_0019089 3300049574 Bacteria 6182
347 Ga0501038_0201601 3300049574 Bacteria 1597
348 Ga0501039_0004461 3300049575 Bacteria 10563
349 Ga0501041_0045511 3300049577 Bacteria 2668
350 Ga0501043_0013627 3300049579 Bacteria 6361
351 Ga0501043_0341286 3300049579 Bacteria 1139
352 Ga0501046_0003181 3300049580 Bacteria 15155
353 Ga0501046_0007420 3300049580 Bacteria 9638
354 Ga0501046_0096751 3300049580 Bacteria 2268
355 Ga0501046_0134062 3300049580 Bacteria 1877
356 Ga0501047_0002631 3300049581 Bacteria 17092
357 Ga0501047_0032993 3300049581 Bacteria 4999
358 Ga0501047_0035101 3300049581 Bacteria 4843
359 Ga0501047_0042416 3300049581 Bacteria 4397
360 Ga0501047_0729761 3300049581 Bacteria 807
361 Ga0501047_1058149 3300049581 Bacteria 625
362 Ga0501048_0002118 3300049582 Bacteria 15125
363 Ga0501048_0685099 3300049582 Bacteria 736
364 Ga0501067_0007327 3300049583 Bacteria 6128
365 Ga0501068_0965014 3300049584 Bacteria 562
366 Ga0501069_0003162 3300049585 Bacteria 8438
367 Ga0501070_0013137 3300049586 Bacteria 6979
368 Ga0501070_0068098 3300049586 Bacteria 2947
369 Ga0501070_0197838 3300049586 Bacteria 1651
370 Ga0501070_0248876 3300049586 Bacteria 1454
371 Ga0501072_0287865 3300049588 Bacteria 1306
372 Ga0501073_0086332 3300049589 Bacteria 2182
373 Ga0501073_0203917 3300049589 Bacteria 1367
374 Ga0501074_0004923 3300049590 Bacteria 9572
375 Ga0501075_0025590 3300049591 Bacteria 4336
376 Ga0501075_1253254 3300049591 Bacteria 562
377 Ga0501076_0077309 3300049592 Bacteria 2670
378 Ga0501077_0096245 3300049593 Bacteria 1876
379 Ga0501079_0005793 3300049741 Bacteria 9234
380 Ga0501079_0024811 3300049741 Bacteria 4600
381 Ga0501080_0016332 3300049742 Bacteria 6855
382 Ga0501080_0017035 3300049742 Bacteria 6710
383 Ga0501080_0074405 3300049742 Bacteria 3159
384 Ga0501080_0495103 3300049742 Bacteria 1093
385 Ga0501080_0897338 3300049742 Bacteria 773
386 Ga0501080_1573252 3300049742 Bacteria 557
387 Ga0501083_0000872 3300049744 Bacteria 19937
388 Ga0501083_0362729 3300049744 Bacteria 942
389 Ga0501035_0020162 3300049822 Bacteria 6123
390 Ga0501035_0629742 3300049822 Bacteria 871
391 Ga0501035_0692823 3300049822 Bacteria 822
392 Ga0501044_0007426 3300049823 Bacteria 12057
393 Ga0501044_0020413 3300049823 Bacteria 7074
394 Ga0501044_0061678 3300049823 Bacteria 3835
395 Ga0501044_0073349 3300049823 Bacteria 3479
396 Ga0501044_0120231 3300049823 Bacteria 2628
397 Ga0501044_0139154 3300049823 Bacteria 2416
398 Ga0501044_0228641 3300049823 Bacteria 1808
399 Ga0501044_1060160 3300049823 Bacteria 681
400 nmdc:mga0yw44_10616_c1 3300050492 Bacteria 4714
401 nmdc:mga0k408_63733_c1 3300050493 Bacteria 2144
402 nmdc:mga06z11_69404_c1 3300050494 Bacteria 1860
403 nmdc:mga07m45_3748_c1 3300050496 Bacteria 7355
404 nmdc:mga07m45_7440_c1 3300050496 Bacteria 5597
405 nmdc:mga07m45_809160_c1 3300050496 Bacteria 537
406 nmdc:mga08y16_84793_c1 3300050511 Bacteria 3302
407 nmdc:mga0a205_468898_c1 3300050515 Bacteria 1118
408 Ga0500635_0000057 3300053080 Bacteria 73077
409 Ga0500643_000003 3300053087 Bacteria 876659
410 Ga0500595_005398 3300053119 Bacteria 5586
411 Ga0500607_196748 3300053121 Bacteria 872
412 Ga0500652_158589 3300053131 Bacteria 936
413 Ga0500559_0090081 3300053136 Bacteria 1403
414 Ga0500568_0223079 3300053139 Bacteria 688
415 Ga0500577_0323122 3300053142 Bacteria 674
416 Ga0500637_0006041 3300053178 Bacteria 5924
417 Ga0501084_0024257 3300054114 Bacteria 5057
418 Ga0501084_0494997 3300054114 Bacteria 1033
419 Ga0500661_002750 3300055283 Bacteria 3320
420 Ga0501082_0004121 3300060353 Bacteria 12700
421 Ga0501082_0520923 3300060353 Bacteria 1039
422 Ga0501082_1225254 3300060353 Bacteria 656
423 Ga0466962_0027249 3300061719 Bacteria 2743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10061712 Ga0157374_100617124 115
2 3300005331 Ga0070670_100803000 Ga0070670_1008030002 133
3 3300005718 Ga0068866_10021161 Ga0068866_100211613 133
4 3300006881 Ga0068865_100004736 Ga0068865_1000047363 133
5 3300009176 Ga0105242_10117082 Ga0105242_101170824 133
6 3300013297 Ga0157378_10099867 Ga0157378_100998674 133
7 3300013308 Ga0157375_10082607 Ga0157375_100826073 133
8 3300014968 Ga0157379_10718459 Ga0157379_107184592 133
9 3300014969 Ga0157376_10092811 Ga0157376_100928112 133
10 3300025899 Ga0207642_10188255 Ga0207642_101882552 133
11 3300025934 Ga0207686_10015274 Ga0207686_100152743 133
12 3300025941 Ga0207711_10437659 Ga0207711_104376592 133
13 3300026035 Ga0207703_10652815 Ga0207703_106528152 133
14 3300026121 Ga0207683_10009569 Ga0207683_100095697 133
15 3300005841 Ga0068863_102046012 Ga0068863_1020460122 136
16 3300010375 Ga0105239_11676199 Ga0105239_116761992 136
17 3300005367 Ga0070667_100281714 Ga0070667_1002817142 137
18 3300005456 Ga0070678_100036663 Ga0070678_1000366633 137
19 3300005618 Ga0068864_100086570 Ga0068864_1000865702 137
20 3300009551 Ga0105238_10099495 Ga0105238_100994952 137
21 3300011119 Ga0105246_10068275 Ga0105246_100682754 137
22 3300025911 Ga0207654_10042972 Ga0207654_100429722 137
23 3300025924 Ga0207694_10099433 Ga0207694_100994334 137
24 3300025938 Ga0207704_10129565 Ga0207704_101295652 137
25 3300026095 Ga0207676_10317866 Ga0207676_103178662 137
26 3300049580 Ga0501046_0096751 Ga0501046_0096751_1710_2138 138
27 3300049591 Ga0501075_1253254 Ga0501075_1253254_95_523 138
28 3300005327 Ga0070658_10002507 Ga0070658_1000250712 140
29 3300005334 Ga0068869_100653677 Ga0068869_1006536772 140
30 3300005335 Ga0070666_10042849 Ga0070666_100428493 140
31 3300005336 Ga0070680_100026152 Ga0070680_1000261523 140
32 3300005339 Ga0070660_101063153 Ga0070660_1010631531 140
33 3300005344 Ga0070661_100094609 Ga0070661_1000946092 140
34 3300005365 Ga0070688_100407162 Ga0070688_1004071622 140
35 3300005367 Ga0070667_100868975 Ga0070667_1008689751 140
36 3300005457 Ga0070662_100287911 Ga0070662_1002879112 140
37 3300005530 Ga0070679_100113247 Ga0070679_1001132472 140
38 3300005548 Ga0070665_100000381 Ga0070665_10000038151 140
39 3300005548 Ga0070665_100073535 Ga0070665_1000735352 140
40 3300005548 Ga0070665_100303207 Ga0070665_1003032072 140
41 3300005719 Ga0068861_100202819 Ga0068861_1002028192 140
42 3300005841 Ga0068863_100028623 Ga0068863_1000286233 140
43 3300005843 Ga0068860_101069036 Ga0068860_1010690362 140
44 3300005844 Ga0068862_100338831 Ga0068862_1003388312 140
45 3300006237 Ga0097621_100530362 Ga0097621_1005303622 140
46 3300006358 Ga0068871_101046268 Ga0068871_1010462682 140
47 3300009093 Ga0105240_10070676 Ga0105240_100706764 140
48 3300009093 Ga0105240_10308211 Ga0105240_103082112 140
49 3300009101 Ga0105247_10111633 Ga0105247_101116332 140
50 3300009148 Ga0105243_11119026 Ga0105243_111190262 140
51 3300009174 Ga0105241_10121871 Ga0105241_101218711 140
52 3300009551 Ga0105238_10156483 Ga0105238_101564832 140
53 3300009551 Ga0105238_10333198 Ga0105238_103331982 140
54 3300009553 Ga0105249_10222999 Ga0105249_102229993 140
55 3300009553 Ga0105249_10294725 Ga0105249_102947252 140
56 3300010375 Ga0105239_10651718 Ga0105239_106517183 140
57 3300010375 Ga0105239_10922125 Ga0105239_109221252 140
58 3300014968 Ga0157379_10926504 Ga0157379_109265042 140
59 3300025935 Ga0207709_11632735 Ga0207709_116327351 140
60 3300031711 Ga0265314_10074130 Ga0265314_100741303 140
61 3300003215 JGI25153J46596_10000638 JGI25153J46596_1000063813 141
62 3300005327 Ga0070658_10635911 Ga0070658_106359112 141
63 3300005327 Ga0070658_11362924 Ga0070658_113629241 141
64 3300005335 Ga0070666_10059192 Ga0070666_100591921 141
65 3300005339 Ga0070660_100006467 Ga0070660_1000064675 141
66 3300005456 Ga0070678_100612760 Ga0070678_1006127602 141
67 3300005530 Ga0070679_100285106 Ga0070679_1002851061 141
68 3300005539 Ga0068853_100229881 Ga0068853_1002298813 141
69 3300005539 Ga0068853_100744156 Ga0068853_1007441562 141
70 3300005539 Ga0068853_101002742 Ga0068853_1010027422 141
71 3300005578 Ga0068854_101522034 Ga0068854_1015220342 141
72 3300005614 Ga0068856_100049908 Ga0068856_1000499084 141
73 3300009093 Ga0105240_11264050 Ga0105240_112640501 141
74 3300009545 Ga0105237_10822789 Ga0105237_108227892 141
75 3300010375 Ga0105239_10649233 Ga0105239_106492333 141
76 3300013306 Ga0163162_10237609 Ga0163162_102376092 141
77 3300014325 Ga0163163_11127500 Ga0163163_111275002 141
78 3300025297 Ga0209758_1000013 Ga0209758_1000013266 141
79 3300025297 Ga0209758_1148443 Ga0209758_11484432 141
80 3300025898 Ga0207692_10223859 Ga0207692_102238592 141
81 3300025899 Ga0207642_10218807 Ga0207642_102188072 141
82 3300025919 Ga0207657_10037025 Ga0207657_100370253 141
83 3300025921 Ga0207652_10298442 Ga0207652_102984422 141
84 3300025921 Ga0207652_10354937 Ga0207652_103549372 141
85 3300025928 Ga0207700_10359987 Ga0207700_103599872 141
86 3300025928 Ga0207700_11043432 Ga0207700_110434322 141
87 3300025931 Ga0207644_11402332 Ga0207644_114023321 141
88 3300025940 Ga0207691_10716514 Ga0207691_107165142 141
89 3300025949 Ga0207667_10379836 Ga0207667_103798362 141
90 3300025981 Ga0207640_10237386 Ga0207640_102373862 141
91 3300025981 Ga0207640_10450730 Ga0207640_104507301 141
92 3300026035 Ga0207703_10075896 Ga0207703_100758962 141
93 3300026041 Ga0207639_10548431 Ga0207639_105484312 141
94 3300026041 Ga0207639_10668811 Ga0207639_106688112 141
95 3300026121 Ga0207683_10998186 Ga0207683_109981862 141
96 3300028379 Ga0268266_10033242 Ga0268266_100332423 141
97 3300028379 Ga0268266_10091907 Ga0268266_100919073 141
98 3300028786 Ga0307517_10148566 Ga0307517_101485661 141
99 3300037418 Ga0395900_0036616 Ga0395900_0036616_4580_5005 141
100 3300041451 Ga0451791_0001192 Ga0451791_0001192_19_444 141
101 3300044719 Ga0466971_0564299 Ga0466971_0564299_47_472 141
102 3300046530 Ga0495654_0101419 Ga0495654_0101419_16_441 141
103 3300048924 Ga0496121_0010270 Ga0496121_0010270_2232_2657 141
104 3300049573 Ga0501037_0103343 Ga0501037_0103343_1154_1579 141
105 3300049581 Ga0501047_0042416 Ga0501047_0042416_2862_3287 141
106 3300049823 Ga0501044_0007426 Ga0501044_0007426_7334_7759 141
107 3300053139 Ga0500568_0223079 Ga0500568_0223079_163_588 141
108 3300053142 Ga0500577_0323122 Ga0500577_0323122_123_548 141
109 3300005329 Ga0070683_100095395 Ga0070683_1000953953 142
110 3300005364 Ga0070673_100867418 Ga0070673_1008674182 142
111 3300005535 Ga0070684_100248742 Ga0070684_1002487422 142
112 3300005577 Ga0068857_100072280 Ga0068857_1000722802 142
113 3300009093 Ga0105240_10252235 Ga0105240_102522352 142
114 3300009098 Ga0105245_11089052 Ga0105245_110890521 142
115 3300009174 Ga0105241_10113267 Ga0105241_101132673 142
116 3300009545 Ga0105237_10242234 Ga0105237_102422342 142
117 3300009545 Ga0105237_10561217 Ga0105237_105612172 142
118 3300009545 Ga0105237_10658839 Ga0105237_106588391 142
119 3300009551 Ga0105238_10037180 Ga0105238_100371805 142
120 3300009551 Ga0105238_10210886 Ga0105238_102108863 142
121 3300013104 Ga0157370_10201526 Ga0157370_102015262 142
122 3300013308 Ga0157375_12873676 Ga0157375_128736762 142
123 3300025911 Ga0207654_10290260 Ga0207654_102902601 142
124 3300025913 Ga0207695_10049604 Ga0207695_100496043 142
125 3300025914 Ga0207671_10515715 Ga0207671_105157152 142
126 3300025942 Ga0207689_10648496 Ga0207689_106484962 142
127 3300025944 Ga0207661_10058666 Ga0207661_100586664 142
128 3300025949 Ga0207667_10807736 Ga0207667_108077361 142
129 3300026116 Ga0207674_10093073 Ga0207674_100930733 142
130 3300028800 Ga0265338_10032597 Ga0265338_100325973 142
131 3300031242 Ga0265329_10052504 Ga0265329_100525043 142
132 3300031249 Ga0265339_10088546 Ga0265339_100885462 142
133 3300031250 Ga0265331_10036411 Ga0265331_100364113 142
134 3300031595 Ga0265313_10120574 Ga0265313_101205741 142
135 3300031711 Ga0265314_10021623 Ga0265314_100216233 142
136 3300041459 Ga0451800_0794675 Ga0451800_0794675_141_569 142
137 3300044693 Ga0466961_0583454 Ga0466961_0583454_16_444 142
138 3300046471 Ga0495650_0163442 Ga0495650_0163442_167_595 142
139 3300046694 Ga0495649_0366900 Ga0495649_0366900_165_593 142
140 3300049570 Ga0501033_0967030 Ga0501033_0967030_92_520 142
141 3300049581 Ga0501047_1058149 Ga0501047_1058149_119_547 142
142 3300053087 Ga0500643_000003 Ga0500643_000003_615091_615519 142
143 3300053119 Ga0500595_005398 Ga0500595_005398_1712_2140 142
144 3300003214 JGI25165J46597_1000036 JGI25165J46597_100003679 143
145 3300005344 Ga0070661_100000741 Ga0070661_10000074111 143
146 3300005530 Ga0070679_100261451 Ga0070679_1002614511 143
147 3300005563 Ga0068855_100219316 Ga0068855_1002193162 143
148 3300005577 Ga0068857_100156844 Ga0068857_1001568442 143
149 3300005614 Ga0068856_100063433 Ga0068856_1000634332 143
150 3300009093 Ga0105240_10243264 Ga0105240_102432643 143
151 3300009176 Ga0105242_11865550 Ga0105242_118655502 143
152 3300013104 Ga0157370_10132921 Ga0157370_101329212 143
153 3300025231 Ga0207427_103565 Ga0207427_1035652 143
154 3300025261 Ga0209233_1000015 Ga0209233_1000015857 143
155 3300025899 Ga0207642_10746642 Ga0207642_107466422 143
156 3300025909 Ga0207705_10224936 Ga0207705_102249362 143
157 3300025916 Ga0207663_10942978 Ga0207663_109429781 143
158 3300025920 Ga0207649_10000080 Ga0207649_1000008033 143
159 3300025921 Ga0207652_10331554 Ga0207652_103315541 143
160 3300025932 Ga0207690_10356117 Ga0207690_103561172 143
161 3300028381 Ga0268264_10423297 Ga0268264_104232972 143
162 3300031250 Ga0265331_10000003 Ga0265331_10000003194 143
163 3300031250 Ga0265331_10001245 Ga0265331_100012452 143
164 3300031251 Ga0265327_10000187 Ga0265327_100001871 143
165 3300031711 Ga0265314_10038218 Ga0265314_100382184 143
166 3300031711 Ga0265314_10115590 Ga0265314_101155902 143
167 3300031711 Ga0265314_10529916 Ga0265314_105299161 143
168 3300041498 Ga0451841_1055949 Ga0451841_1055949_53_484 143
169 3300049569 Ga0501032_0019432 Ga0501032_0019432_1994_2425 143
170 3300049570 Ga0501033_0030506 Ga0501033_0030506_2391_2822 143
171 3300049571 Ga0501034_0006522 Ga0501034_0006522_8616_9047 143
172 3300049571 Ga0501034_0986260 Ga0501034_0986260_119_550 143
173 3300049572 Ga0501036_0054596 Ga0501036_0054596_1128_1559 143
174 3300049573 Ga0501037_0049579 Ga0501037_0049579_1994_2425 143
175 3300049574 Ga0501038_0019089 Ga0501038_0019089_1994_2425 143
176 3300049575 Ga0501039_0004461 Ga0501039_0004461_6634_7065 143
177 3300049579 Ga0501043_0013627 Ga0501043_0013627_4573_5004 143
178 3300049580 Ga0501046_0003181 Ga0501046_0003181_650_1081 143
179 3300049580 Ga0501046_0007420 Ga0501046_0007420_8208_8639 143
180 3300049581 Ga0501047_0729761 Ga0501047_0729761_286_717 143
181 3300049582 Ga0501048_0002118 Ga0501048_0002118_1826_2257 143
182 3300049583 Ga0501067_0007327 Ga0501067_0007327_1402_1833 143
183 3300049585 Ga0501069_0003162 Ga0501069_0003162_5182_5613 143
184 3300049586 Ga0501070_0013137 Ga0501070_0013137_1252_1683 143
185 3300049586 Ga0501070_0068098 Ga0501070_0068098_2370_2801 143
186 3300049586 Ga0501070_0248876 Ga0501070_0248876_948_1379 143
187 3300049589 Ga0501073_0086332 Ga0501073_0086332_522_953 143
188 3300049590 Ga0501074_0004923 Ga0501074_0004923_7460_7891 143
189 3300049741 Ga0501079_0005793 Ga0501079_0005793_6773_7204 143
190 3300049742 Ga0501080_0074405 Ga0501080_0074405_1499_1930 143
191 3300049742 Ga0501080_1573252 Ga0501080_1573252_36_467 143
192 3300049744 Ga0501083_0000872 Ga0501083_0000872_4573_5004 143
193 3300049823 Ga0501044_0139154 Ga0501044_0139154_880_1311 143
194 3300054114 Ga0501084_0024257 Ga0501084_0024257_330_761 143
195 3300060353 Ga0501082_0004121 Ga0501082_0004121_2391_2822 143
196 3300060353 Ga0501082_1225254 Ga0501082_1225254_98_529 143
197 3300005341 Ga0070691_10486915 Ga0070691_104869151 144
198 3300006175 Ga0070712_100492979 Ga0070712_1004929792 144
199 3300009148 Ga0105243_10101455 Ga0105243_101014554 144
200 3300009176 Ga0105242_10309221 Ga0105242_103092212 144
201 3300010375 Ga0105239_12362899 Ga0105239_123628991 144
202 3300013306 Ga0163162_11250242 Ga0163162_112502422 144
203 3300025915 Ga0207693_10525529 Ga0207693_105255292 144
204 3300049570 Ga0501033_0113198 Ga0501033_0113198_586_1065 144
205 3300049584 Ga0501068_0965014 Ga0501068_0965014_58_492 144
206 3300049742 Ga0501080_0495103 Ga0501080_0495103_90_542 144
207 3300049822 Ga0501035_0629742 Ga0501035_0629742_338_793 144
208 3300049823 Ga0501044_0061678 Ga0501044_0061678_49_483 144
209 3300049823 Ga0501044_0228641 Ga0501044_0228641_824_1279 144
210 3300049823 Ga0501044_1060160 Ga0501044_1060160_20_454 144
211 3300054114 Ga0501084_0494997 Ga0501084_0494997_230_664 144
212 3300005577 Ga0068857_100870202 Ga0068857_1008702022 145
213 3300013104 Ga0157370_10344482 Ga0157370_103444823 145
214 3300014325 Ga0163163_10667503 Ga0163163_106675031 145
215 3300015262 Ga0182007_10075812 Ga0182007_100758122 145
216 3300025913 Ga0207695_10285461 Ga0207695_102854612 145
217 3300025949 Ga0207667_10064776 Ga0207667_100647762 145
218 3300031249 Ga0265339_10461551 Ga0265339_104615511 145
219 3300037418 Ga0395900_0167482 Ga0395900_0167482_843_1316 145
220 3300038443 Ga0395901_0031861 Ga0395901_0031861_3952_4425 145
221 3300044842 Ga0466957_0059968 Ga0466957_0059968_849_1286 145
222 3300049822 Ga0501035_0692823 Ga0501035_0692823_333_788 145
223 3300005336 Ga0070680_100306648 Ga0070680_1003066482 146
224 3300005339 Ga0070660_100006576 Ga0070660_1000065767 146
225 3300005344 Ga0070661_101256190 Ga0070661_1012561901 146
226 3300005455 Ga0070663_100309921 Ga0070663_1003099212 146
227 3300005563 Ga0068855_101871116 Ga0068855_1018711162 146
228 3300005577 Ga0068857_100223619 Ga0068857_1002236193 146
229 3300006038 Ga0075365_10002139 Ga0075365_100021397 146
230 3300009551 Ga0105238_10008779 Ga0105238_100087795 146
231 3300013100 Ga0157373_10159021 Ga0157373_101590212 146
232 3300013102 Ga0157371_10042460 Ga0157371_100424604 146
233 3300013104 Ga0157370_10004733 Ga0157370_1000473312 146
234 3300013307 Ga0157372_10056784 Ga0157372_100567844 146
235 3300025909 Ga0207705_10000474 Ga0207705_1000047431 146
236 3300025912 Ga0207707_10009023 Ga0207707_100090237 146
237 3300025917 Ga0207660_10002089 Ga0207660_100020896 146
238 3300025919 Ga0207657_10000541 Ga0207657_100005415 146
239 3300025921 Ga0207652_10000973 Ga0207652_1000097325 146
240 3300025924 Ga0207694_10014844 Ga0207694_100148445 146
241 3300025949 Ga0207667_10029897 Ga0207667_100298975 146
242 3300026041 Ga0207639_10581200 Ga0207639_105812002 146
243 3300026067 Ga0207678_10179579 Ga0207678_101795792 146
244 3300046660 Ga0495625_0671943 Ga0495625_0671943_40_513 146
245 3300047321 Ga0495676_0314678 Ga0495676_0314678_544_984 146
246 3300049571 Ga0501034_0067731 Ga0501034_0067731_182_625 146
247 3300050492 nmdc:mga0yw44_10616_c1 nmdc:mga0yw44_10616_c1_4060_4500 146
248 3300005983 Ga0081540_1023816 Ga0081540_10238166 147
249 3300006358 Ga0068871_100000805 Ga0068871_1000008054 147
250 3300006852 Ga0075433_10466129 Ga0075433_104661291 147
251 3300007076 Ga0075435_100970619 Ga0075435_1009706192 147
252 3300025941 Ga0207711_10600985 Ga0207711_106009852 147
253 3300026035 Ga0207703_11032946 Ga0207703_110329461 147
254 3300044712 Ga0453684_0001126 Ga0453684_0001126_24284_24727 147
255 3300049570 Ga0501033_0038864 Ga0501033_0038864_190_633 147
256 3300049579 Ga0501043_0341286 Ga0501043_0341286_502_993 147
257 3300049580 Ga0501046_0134062 Ga0501046_0134062_570_1061 147
258 3300049581 Ga0501047_0035101 Ga0501047_0035101_3566_4057 147
259 3300049582 Ga0501048_0685099 Ga0501048_0685099_108_599 147
260 3300049589 Ga0501073_0203917 Ga0501073_0203917_117_608 147
261 3300049742 Ga0501080_0017035 Ga0501080_0017035_307_798 147
262 3300049823 Ga0501044_0120231 Ga0501044_0120231_244_735 147
263 3300009174 Ga0105241_11038433 Ga0105241_110384332 148
264 3300025920 Ga0207649_10404596 Ga0207649_104045962 148
265 3300026116 Ga0207674_11256434 Ga0207674_112564341 148
266 3300031240 Ga0265320_10206925 Ga0265320_102069252 148
267 3300031711 Ga0265314_10011954 Ga0265314_100119547 148
268 3300036401 Ga0373937_0373018 Ga0373937_0373018_584_1036 148
269 3300039447 Ga0436361_0501198 Ga0436361_0501198_2342_2788 148
270 3300039447 Ga0436361_1052949 Ga0436361_1052949_75_542 148
271 3300041443 Ga0451789_0760355 Ga0451789_0760355_27_479 148
272 3300041494 Ga0451837_0956472 Ga0451837_0956472_31_483 148
273 3300048088 Ga0495602_0275373 Ga0495602_0275373_76_528 148
274 3300050511 nmdc:mga08y16_84793_c1 nmdc:mga08y16_84793_c1_229_699 148
275 3300053178 Ga0500637_0006041 Ga0500637_0006041_1053_1499 148
276 3300005719 Ga0068861_100377527 Ga0068861_1003775273 149
277 3300006178 Ga0075367_10077405 Ga0075367_100774052 149
278 3300006195 Ga0075366_10031057 Ga0075366_100310574 149
279 3300006353 Ga0075370_10166638 Ga0075370_101666383 149
280 3300009148 Ga0105243_10896473 Ga0105243_108964731 149
281 3300031344 Ga0265316_10000393 Ga0265316_100003937 149
282 3300045051 Ga0451576_0206894 Ga0451576_0206894_140_589 149
283 3300045836 Ga0466958_0000187 Ga0466958_0000187_9979_10434 149
284 3300049570 Ga0501033_0006232 Ga0501033_0006232_3410_3919 149
285 3300049572 Ga0501036_0098206 Ga0501036_0098206_1241_1750 149
286 3300049573 Ga0501037_0246172 Ga0501037_0246172_332_841 149
287 3300049574 Ga0501038_0201601 Ga0501038_0201601_355_864 149
288 3300049581 Ga0501047_0032993 Ga0501047_0032993_4372_4881 149
289 3300049822 Ga0501035_0020162 Ga0501035_0020162_468_977 149
290 3300049823 Ga0501044_0020413 Ga0501044_0020413_591_1100 149
291 3300050494 nmdc:mga06z11_69404_c1 nmdc:mga06z11_69404_c1_384_839 149
292 3300050496 nmdc:mga07m45_7440_c1 nmdc:mga07m45_7440_c1_4594_5049 149
293 3300050496 nmdc:mga07m45_809160_c1 nmdc:mga07m45_809160_c1_66_521 149
294 3300061719 Ga0466962_0027249 Ga0466962_0027249_955_1410 149
295 3300014969 Ga0157376_11305000 Ga0157376_113050002 150
296 3300049570 Ga0501033_0346853 Ga0501033_0346853_233_709 150
297 3300049581 Ga0501047_0002631 Ga0501047_0002631_14281_14757 150
298 3300049742 Ga0501080_0897338 Ga0501080_0897338_126_602 150
299 3300049823 Ga0501044_0073349 Ga0501044_0073349_187_663 150
300 3300050515 nmdc:mga0a205_468898_c1 nmdc:mga0a205_468898_c1_179_670 150
301 3300042876 Ga0451577_0402650 Ga0451577_0402650_117_578 151
302 3300049573 Ga0501037_0192646 Ga0501037_0192646_73_567 151
303 3300003320 rootH2_10006278 rootH2_100062783 152
304 3300005356 Ga0070674_100761641 Ga0070674_1007616412 152
305 3300009147 Ga0114129_11100253 Ga0114129_111002532 152
306 3300009148 Ga0105243_11278906 Ga0105243_112789062 152
307 3300009545 Ga0105237_10267422 Ga0105237_102674222 152
308 3300037466 Ga0395898_0453355 Ga0395898_0453355_466_933 152
309 3300038443 Ga0395901_0015920 Ga0395901_0015920_6479_6946 152
310 3300045051 Ga0451576_0279393 Ga0451576_0279393_101_565 152
311 3300049572 Ga0501036_0133486 Ga0501036_0133486_546_1010 152
312 3300049577 Ga0501041_0045511 Ga0501041_0045511_1524_1988 152
313 3300049586 Ga0501070_0197838 Ga0501070_0197838_181_645 152
314 3300049588 Ga0501072_0287865 Ga0501072_0287865_75_539 152
315 3300049591 Ga0501075_0025590 Ga0501075_0025590_3193_3657 152
316 3300049592 Ga0501076_0077309 Ga0501076_0077309_2092_2556 152
317 3300049593 Ga0501077_0096245 Ga0501077_0096245_187_651 152
318 3300049741 Ga0501079_0024811 Ga0501079_0024811_3099_3563 152
319 3300049742 Ga0501080_0016332 Ga0501080_0016332_2638_3102 152
320 3300049744 Ga0501083_0362729 Ga0501083_0362729_133_597 152
321 3300060353 Ga0501082_0520923 Ga0501082_0520923_103_567 152
322 3300002705 JGI25156J39149_1000222 JGI25156J39149_100022218 153
323 3300002738 JGI25154J39366_1001936 JGI25154J39366_10019364 153
324 3300002741 JGI25157J39369_1000056 JGI25157J39369_100005636 153
325 3300003316 rootH1_10039875 rootH1_100398753 153
326 3300003752 Ga0055539_1002458 Ga0055539_10024582 153
327 3300003752 Ga0055539_1015898 Ga0055539_10158982 153
328 3300005327 Ga0070658_10056877 Ga0070658_100568772 153
329 3300005327 Ga0070658_10062081 Ga0070658_100620814 153
330 3300005327 Ga0070658_10241567 Ga0070658_102415672 153
331 3300005330 Ga0070690_100019828 Ga0070690_1000198285 153
332 3300005334 Ga0068869_100572912 Ga0068869_1005729122 153
333 3300005339 Ga0070660_100252513 Ga0070660_1002525132 153
334 3300005347 Ga0070668_100601234 Ga0070668_1006012342 153
335 3300005366 Ga0070659_100040672 Ga0070659_1000406722 153
336 3300005441 Ga0070700_100053641 Ga0070700_1000536412 153
337 3300005544 Ga0070686_100312451 Ga0070686_1003124512 153
338 3300005545 Ga0070695_100006772 Ga0070695_1000067722 153
339 3300005563 Ga0068855_100004492 Ga0068855_1000044926 153
340 3300005563 Ga0068855_100191358 Ga0068855_1001913582 153
341 3300005577 Ga0068857_100003268 Ga0068857_1000032686 153
342 3300005577 Ga0068857_100288593 Ga0068857_1002885932 153
343 3300005577 Ga0068857_100988063 Ga0068857_1009880631 153
344 3300005614 Ga0068856_100007974 Ga0068856_1000079745 153
345 3300005616 Ga0068852_100268488 Ga0068852_1002684882 153
346 3300005719 Ga0068861_100014752 Ga0068861_1000147524 153
347 3300005937 Ga0081455_10003020 Ga0081455_100030203 153
348 3300006195 Ga0075366_10017186 Ga0075366_100171863 153
349 3300006353 Ga0075370_10064287 Ga0075370_100642872 153
350 3300009093 Ga0105240_10067115 Ga0105240_100671154 153
351 3300009093 Ga0105240_10159923 Ga0105240_101599233 153
352 3300009093 Ga0105240_10282982 Ga0105240_102829823 153
353 3300009098 Ga0105245_10135024 Ga0105245_101350242 153
354 3300009148 Ga0105243_10491742 Ga0105243_104917422 153
355 3300009176 Ga0105242_10768492 Ga0105242_107684922 153
356 3300009551 Ga0105238_10103963 Ga0105238_101039632 153
357 3300009551 Ga0105238_10187539 Ga0105238_101875393 153
358 3300009553 Ga0105249_11817670 Ga0105249_118176702 153
359 3300010375 Ga0105239_10136123 Ga0105239_101361234 153
360 3300011119 Ga0105246_10356723 Ga0105246_103567232 153
361 3300013297 Ga0157378_10013704 Ga0157378_100137046 153
362 3300013307 Ga0157372_11286267 Ga0157372_112862672 153
363 3300025231 Ga0207427_100499 Ga0207427_10049910 153
364 3300025242 Ga0209258_102942 Ga0209258_1029424 153
365 3300025246 Ga0209646_1000124 Ga0209646_100012473 153
366 3300025250 Ga0209026_1000085 Ga0209026_100008573 153
367 3300025253 Ga0209677_100203 Ga0209677_10020327 153
368 3300025253 Ga0209677_100768 Ga0209677_1007687 153
369 3300025256 Ga0209759_1000068 Ga0209759_100006871 153
370 3300025256 Ga0209759_1032990 Ga0209759_10329902 153
371 3300025909 Ga0207705_10057540 Ga0207705_100575403 153
372 3300025909 Ga0207705_10118204 Ga0207705_101182042 153
373 3300025909 Ga0207705_10270907 Ga0207705_102709071 153
374 3300025913 Ga0207695_10010508 Ga0207695_100105083 153
375 3300025913 Ga0207695_10026992 Ga0207695_100269925 153
376 3300025913 Ga0207695_10367761 Ga0207695_103677612 153
377 3300025919 Ga0207657_10014611 Ga0207657_100146113 153
378 3300025919 Ga0207657_11075647 Ga0207657_110756471 153
379 3300025924 Ga0207694_10011511 Ga0207694_100115113 153
380 3300025927 Ga0207687_10568409 Ga0207687_105684092 153
381 3300025932 Ga0207690_10039931 Ga0207690_100399314 153
382 3300025933 Ga0207706_11621452 Ga0207706_116214521 153
383 3300025934 Ga0207686_10216221 Ga0207686_102162212 153
384 3300025935 Ga0207709_10991051 Ga0207709_109910512 153
385 3300025942 Ga0207689_10066707 Ga0207689_100667072 153
386 3300025944 Ga0207661_10256214 Ga0207661_102562142 153
387 3300025945 Ga0207679_10401493 Ga0207679_104014932 153
388 3300025949 Ga0207667_10049792 Ga0207667_100497921 153
389 3300025949 Ga0207667_10310950 Ga0207667_103109503 153
390 3300025949 Ga0207667_10426065 Ga0207667_104260652 153
391 3300025972 Ga0207668_10339246 Ga0207668_103392461 153
392 3300025981 Ga0207640_10015177 Ga0207640_100151775 153
393 3300026075 Ga0207708_10873360 Ga0207708_108733602 153
394 3300026078 Ga0207702_10000235 Ga0207702_1000023517 153
395 3300026088 Ga0207641_12226908 Ga0207641_122269081 153
396 3300026089 Ga0207648_10456454 Ga0207648_104564542 153
397 3300026089 Ga0207648_10567743 Ga0207648_105677431 153
398 3300026116 Ga0207674_10104187 Ga0207674_101041873 153
399 3300026116 Ga0207674_10521469 Ga0207674_105214691 153
400 3300026116 Ga0207674_10961018 Ga0207674_109610182 153
401 3300026118 Ga0207675_100064205 Ga0207675_1000642055 153
402 3300026142 Ga0207698_10943619 Ga0207698_109436191 153
403 3300028666 Ga0265336_10000813 Ga0265336_1000081312 153
404 3300029957 Ga0265324_10001876 Ga0265324_1000187612 153
405 3300030521 Ga0307511_10247951 Ga0307511_102479512 153
406 3300031730 Ga0307516_10014476 Ga0307516_100144767 153
407 3300044842 Ga0466957_0025721 Ga0466957_0025721_1214_1675 153
408 3300046462 Ga0495651_0364365 Ga0495651_0364365_62_529 153
409 3300046475 Ga0495639_0089617 Ga0495639_0089617_321_788 153
410 3300046506 Ga0495583_0000224 Ga0495583_0000224_25235_25696 153
411 3300046507 Ga0495606_0004414 Ga0495606_0004414_430_891 153
412 3300046507 Ga0495606_0435066 Ga0495606_0435066_151_618 153
413 3300046616 Ga0495668_0012115 Ga0495668_0012115_1429_1890 153
414 3300046660 Ga0495625_0101484 Ga0495625_0101484_265_726 153
415 3300046694 Ga0495649_0045088 Ga0495649_0045088_101_562 153
416 3300048918 Ga0496115_0221317 Ga0496115_0221317_688_1149 153
417 3300050493 nmdc:mga0k408_63733_c1 nmdc:mga0k408_63733_c1_1077_1547 153
418 3300050496 nmdc:mga07m45_3748_c1 nmdc:mga07m45_3748_c1_2244_2717 153
419 3300053080 Ga0500635_0000057 Ga0500635_0000057_41886_42353 153
420 3300053121 Ga0500607_196748 Ga0500607_196748_174_641 153
421 3300053131 Ga0500652_158589 Ga0500652_158589_95_556 153
422 3300053136 Ga0500559_0090081 Ga0500559_0090081_356_823 153
423 3300055283 Ga0500661_002750 Ga0500661_002750_1464_1925 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

34

173

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly7.cif.gz_G crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9833 6 146
2z1j-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) 0.9827 6 146
1wsj-assembly5.cif.gz_E crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9816 6 146
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9813 6 146
2z1h-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t92k/q105k/q113r/q115k/n143k/t145k) 0.9812 6 146
ID Description Score Start End Superfamily
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9734 8 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.964 7 148 3.30.420.10
af_Q86MG7_99_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9206 10 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9003 7 148 3.30.420.10
4ibnA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8943 2 148 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3C2BGT8-F1-model_v4 deleted 1.001 6 77
AF-A0A527HH28-F1-model_v4 deleted 0.9989 6 77
AF-A0A2N3AU90-F1-model_v4 Ribonuclease HI 0.9981 6 88 GO:0003676
GO:0004523
AF-B6Y9Z3-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9956 46 122 GO:0003676
GO:0004523
GO:0043137
AF-Q8XZ91-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9953 6 151 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137

Feature Viewer

pLDDT pTM Quality
93.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map