F440349

General Info

Members Datasets Scaffolds Average Seq Length
422 286 844 269

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0091915|Ga0466959_0091915_288_1112
Length 262
Sequence VSVQNAAPDHPERQYLALLADILEHGVERGDRTGVGTRGVFGRQIRFDLAKGFPLLTTKKLHVKSIVYELLWFLRGDTNVRWLQERGVKIWDEWAGPDGELGPVYGSIDQITKLVEGLKANPSSRRHIVTAWNPADVDDMALPPCHCLFQFFVADGRLSCQLYQRSADVFLGVPFNIASYALLTQMVAQVTGLQPGEFVHTFGDAHLYLNHLEQAKLQLTREPLPFPALKLAPKDDLFAFEYEDVAIEGYRAWPHIKAEVAV

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
238 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
239 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
267 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
268 2643221617 Nocardioides sp. Root79 Isolate Unclassified
269 2643221620 Nocardioides sp. Root240 Isolate Unclassified
270 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
271 2643221640 Caulobacter sp. Root342 Isolate Unclassified
272 2643221642 Caulobacter sp. Root343 Isolate Unclassified
273 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
274 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
275 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
276 2851153111 Caulobacter radicis 736 Isolate Unclassified
277 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
278 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
279 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
280 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
281 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
282 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
283 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
284 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
285 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
286 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 0
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 7.58
Nodule 0
Rhizoplane 1.9
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0091915 3300045049 Bacteria 2179
2 ARSoilOldRDRAFT_c000982 3300000044 Bacteria 2769
3 ARCol0yngRDRAFT_1002494 3300000652 Bacteria 1383
4 JGI25153J46596_10037579 3300003215 Bacteria 1537
5 Ga0055526_1005109 3300003771 Bacteria 7652
6 Ga0055536_1000807 3300003781 Bacteria 20725
7 Ga0055530_10001027 3300003791 Bacteria 22214
8 Ga0055530_10004597 3300003791 Bacteria 7033
9 Ga0055531_10000277 3300003794 Bacteria 52866
10 Ga0055543_1015237 3300004625 Bacteria 1484
11 Ga0065165_1000413 3300005262 Bacteria 67911
12 Ga0070683_100160783 3300005329 Bacteria 2131
13 Ga0070683_100184424 3300005329 Bacteria 1981
14 Ga0070690_100000235 3300005330 Bacteria 28411
15 Ga0070670_100282013 3300005331 Bacteria 1451
16 Ga0068869_100000023 3300005334 Bacteria 64701
17 Ga0070680_100003526 3300005336 Bacteria 11681
18 Ga0070680_100022638 3300005336 Bacteria 5007
19 Ga0070682_100004674 3300005337 Bacteria 7606
20 Ga0068868_100000293 3300005338 Bacteria 33613
21 Ga0070689_100000974 3300005340 Bacteria 17888
22 Ga0070687_100000142 3300005343 Bacteria 24995
23 Ga0070692_10007542 3300005345 Bacteria 4797
24 Ga0070692_10031716 3300005345 Bacteria 2651
25 Ga0070668_100045627 3300005347 Bacteria 3363
26 Ga0070669_100025211 3300005353 Bacteria 4270
27 Ga0070675_100039339 3300005354 Bacteria 3859
28 Ga0070671_100350993 3300005355 Bacteria 1259
29 Ga0070674_100128806 3300005356 Bacteria 1884
30 Ga0070659_100007043 3300005366 Bacteria 8143
31 Ga0070659_100168731 3300005366 Bacteria 1792
32 Ga0070701_10000090 3300005438 Bacteria 25259
33 Ga0070705_100000668 3300005440 Bacteria 19620
34 Ga0070700_100001456 3300005441 Bacteria 11776
35 Ga0070694_100000160 3300005444 Bacteria 34651
36 Ga0070662_100218489 3300005457 Bacteria 1520
37 Ga0070681_10196914 3300005458 Bacteria 1933
38 Ga0068867_100001762 3300005459 Bacteria 15048
39 Ga0068867_100171019 3300005459 Bacteria 1721
40 Ga0070679_100400770 3300005530 Bacteria 1318
41 Ga0070684_100471917 3300005535 Bacteria 1161
42 Ga0068853_100017194 3300005539 Bacteria 5968
43 Ga0068853_100116873 3300005539 Bacteria 2375
44 Ga0068853_100192207 3300005539 Bacteria 1855
45 Ga0068853_100221637 3300005539 Bacteria 1728
46 Ga0070686_100000090 3300005544 Bacteria 63246
47 Ga0070695_100000130 3300005545 Bacteria 34256
48 Ga0070696_100000397 3300005546 Bacteria 26933
49 Ga0070693_100000496 3300005547 Bacteria 17573
50 Ga0070704_100000637 3300005549 Bacteria 16929
51 Ga0068855_100006339 3300005563 Bacteria 14415
52 Ga0070664_100079588 3300005564 Bacteria 2821
53 Ga0068857_100043802 3300005577 Bacteria 3969
54 Ga0068857_100069953 3300005577 Bacteria 3125
55 Ga0068854_100098445 3300005578 Bacteria 2188
56 Ga0068856_100017993 3300005614 Bacteria 6851
57 Ga0070702_100000356 3300005615 Bacteria 15961
58 Ga0070702_100088565 3300005615 Bacteria 1872
59 Ga0068852_100001272 3300005616 Bacteria 16837
60 Ga0068859_100001418 3300005617 Bacteria 24320
61 Ga0068859_100012557 3300005617 Bacteria 8522
62 Ga0068866_10000337 3300005718 Bacteria 22136
63 Ga0068861_100000043 3300005719 Bacteria 57807
64 Ga0068861_100008598 3300005719 Bacteria 7023
65 Ga0068863_100151676 3300005841 Bacteria 2218
66 Ga0068858_100002717 3300005842 Bacteria 17826
67 Ga0068860_100007750 3300005843 Bacteria 10727
68 Ga0068862_100000099 3300005844 Bacteria 103870
69 Ga0068862_100000320 3300005844 Bacteria 52171
70 Ga0068862_100033453 3300005844 Bacteria 4346
71 Ga0068862_100073360 3300005844 Bacteria 2958
72 Ga0068862_100439951 3300005844 Bacteria 1227
73 Ga0081539_10001023 3300005985 Bacteria 51478
74 Ga0081539_10001076 3300005985 Bacteria 49708
75 Ga0081539_10005739 3300005985 Bacteria 12412
76 Ga0081539_10012288 3300005985 Bacteria 6626
77 Ga0081539_10031963 3300005985 Bacteria 3232
78 Ga0081539_10043329 3300005985 Bacteria 2610
79 Ga0075365_10079948 3300006038 Bacteria 2213
80 Ga0075432_10030063 3300006058 Bacteria 1877
81 Ga0068871_100000040 3300006358 Bacteria 69044
82 Ga0075428_100005321 3300006844 Bacteria 14306
83 Ga0075430_100116315 3300006846 Bacteria 2228
84 Ga0075431_100013902 3300006847 Bacteria 8128
85 Ga0075434_100000006 3300006871 Bacteria 96966
86 Ga0075429_100009744 3300006880 Bacteria 8326
87 Ga0075429_100018270 3300006880 Bacteria 6071
88 Ga0068865_100000245 3300006881 Bacteria 30264
89 Ga0097620_100001418 3300006931 Bacteria 24320
90 Ga0097620_100012557 3300006931 Bacteria 8522
91 Ga0075435_100074465 3300007076 Bacteria 2778
92 Ga0099794_10016361 3300007265 Bacteria 3287
93 Ga0111539_10006936 3300009094 Bacteria 14543
94 Ga0105245_10000224 3300009098 Bacteria 53847
95 Ga0105245_10002081 3300009098 Bacteria 18166
96 Ga0105245_10032679 3300009098 Bacteria 4607
97 Ga0114129_10018298 3300009147 Bacteria 9980
98 Ga0114129_11192266 3300009147 Bacteria 949
99 Ga0105243_10000035 3300009148 Bacteria 177598
100 Ga0105243_10010953 3300009148 Bacteria 6857
101 Ga0105242_10000300 3300009176 Bacteria 39346
102 Ga0105248_10734391 3300009177 Bacteria 1114
103 Ga0105237_10217749 3300009545 Bacteria 1909
104 Ga0105249_10044862 3300009553 Bacteria 4020
105 Ga0105249_10069161 3300009553 Bacteria 3258
106 Ga0105239_10007354 3300010375 Bacteria 12649
107 Ga0105239_10954642 3300010375 Bacteria 985
108 Ga0105246_10181687 3300011119 Bacteria 1620
109 Ga0157373_10002515 3300013100 Bacteria 13961
110 Ga0157373_10007531 3300013100 Bacteria 8094
111 Ga0157373_10065847 3300013100 Bacteria 2564
112 Ga0157370_10222688 3300013104 Bacteria 1747
113 Ga0157370_10303403 3300013104 Bacteria 1474
114 Ga0157370_10382984 3300013104 Bacteria 1295
115 Ga0157378_10002478 3300013297 Bacteria 16430
116 Ga0157378_10191725 3300013297 Bacteria 1928
117 Ga0163162_10107615 3300013306 Bacteria 2884
118 Ga0157372_10016928 3300013307 Bacteria 7826
119 Ga0157375_10025894 3300013308 Bacteria 5458
120 Ga0157375_10366807 3300013308 Bacteria 1606
121 Ga0157376_10020252 3300014969 Bacteria 5142
122 Ga0183365_10001 3300015684 Bacteria 2090444
123 Ga0213872_10000049 3300021361 Bacteria 109094
124 Ga0213872_10000079 3300021361 Bacteria 89092
125 Ga0213872_10006348 3300021361 Bacteria 5950
126 Ga0213876_10096835 3300021384 Bacteria 1563
127 Ga0209673_1013926 3300025273 Bacteria 3144
128 Ga0209676_1000099 3300025292 Bacteria 230048
129 Ga0209564_1000003 3300025295 Bacteria 1585848
130 Ga0209564_1003748 3300025295 Bacteria 9926
131 Ga0209564_1015939 3300025295 Bacteria 3030
132 Ga0209758_1004816 3300025297 Bacteria 10893
133 Ga0209050_1000029 3300025298 Bacteria 465801
134 Ga0209050_1001822 3300025298 Bacteria 20749
135 Ga0209256_1040036 3300025299 Bacteria 1200
136 Ga0209051_1026939 3300025303 Bacteria 2303
137 Ga0209257_1000152 3300025304 Bacteria 189432
138 Ga0209257_1000203 3300025304 Bacteria 146148
139 Ga0207642_10002929 3300025899 Bacteria 5340
140 Ga0207688_10005498 3300025901 Bacteria 6893
141 Ga0207688_10251831 3300025901 Bacteria 1070
142 Ga0207645_10011068 3300025907 Bacteria 6173
143 Ga0207643_10017965 3300025908 Bacteria 3873
144 Ga0207654_10040257 3300025911 Bacteria 2632
145 Ga0207707_10265538 3300025912 Bacteria 1488
146 Ga0207671_10074689 3300025914 Bacteria 2534
147 Ga0207671_10168975 3300025914 Bacteria 1697
148 Ga0207660_10010313 3300025917 Bacteria 6060
149 Ga0207660_10045393 3300025917 Bacteria 3095
150 Ga0207660_10090431 3300025917 Bacteria 2268
151 Ga0207662_10000091 3300025918 Bacteria 42710
152 Ga0207657_10045018 3300025919 Bacteria 3876
153 Ga0207657_10065543 3300025919 Bacteria 3096
154 Ga0207659_10119657 3300025926 Bacteria 2016
155 Ga0207687_10005537 3300025927 Bacteria 8350
156 Ga0207687_10154650 3300025927 Bacteria 1753
157 Ga0207687_10413609 3300025927 Bacteria 1112
158 Ga0207664_10000252 3300025929 Bacteria 40345
159 Ga0207690_10055620 3300025932 Bacteria 2666
160 Ga0207690_10299421 3300025932 Bacteria 1258
161 Ga0207706_10254097 3300025933 Bacteria 1535
162 Ga0207686_10000914 3300025934 Bacteria 17687
163 Ga0207686_10256635 3300025934 Bacteria 1280
164 Ga0207709_10001149 3300025935 Bacteria 19293
165 Ga0207670_10005058 3300025936 Bacteria 7191
166 Ga0207669_10411180 3300025937 Bacteria 1062
167 Ga0207704_10001399 3300025938 Bacteria 10777
168 Ga0207704_10480319 3300025938 Bacteria 998
169 Ga0207691_10418829 3300025940 Bacteria 1141
170 Ga0207711_10069039 3300025941 Bacteria 3062
171 Ga0207711_10089020 3300025941 Bacteria 2711
172 Ga0207711_10096690 3300025941 Bacteria 2607
173 Ga0207689_10000024 3300025942 Bacteria 107574
174 Ga0207689_10146568 3300025942 Bacteria 1945
175 Ga0207661_10388175 3300025944 Bacteria 1264
176 Ga0207679_10417605 3300025945 Bacteria 1183
177 Ga0207667_10040129 3300025949 Bacteria 4984
178 Ga0207712_10000026 3300025961 Bacteria 271237
179 Ga0207712_10055554 3300025961 Bacteria 2786
180 Ga0207668_10004794 3300025972 Bacteria 7961
181 Ga0207668_10120473 3300025972 Bacteria 1986
182 Ga0207640_10381337 3300025981 Bacteria 1142
183 Ga0207677_10000435 3300026023 Bacteria 28214
184 Ga0207703_10001473 3300026035 Bacteria 21462
185 Ga0207639_10006932 3300026041 Bacteria 7720
186 Ga0207639_10040952 3300026041 Bacteria 3462
187 Ga0207639_10158587 3300026041 Bacteria 1904
188 Ga0207639_10175525 3300026041 Bacteria 1819
189 Ga0207708_10001349 3300026075 Bacteria 18419
190 Ga0207708_10636444 3300026075 Bacteria 907
191 Ga0207702_10130327 3300026078 Bacteria 2262
192 Ga0207648_10000316 3300026089 Bacteria 52941
193 Ga0207648_10302426 3300026089 Bacteria 1435
194 Ga0207674_10016115 3300026116 Bacteria 8189
195 Ga0207674_10122914 3300026116 Bacteria 2562
196 Ga0207674_10450716 3300026116 Bacteria 1244
197 Ga0207675_100000017 3300026118 Bacteria 124338
198 Ga0207675_100014822 3300026118 Bacteria 7275
199 Ga0207683_10049700 3300026121 Bacteria 3672
200 Ga0207683_10292085 3300026121 Bacteria 1490
201 Ga0207698_10146089 3300026142 Bacteria 2045
202 Ga0209969_1006348 3300027360 Bacteria 1664
203 Ga0209967_1000824 3300027364 Bacteria 3972
204 Ga0210000_1006442 3300027462 Bacteria 1710
205 Ga0209995_1002103 3300027471 Bacteria 3131
206 Ga0209968_1007392 3300027526 Bacteria 1662
207 Ga0209999_1002249 3300027543 Bacteria 3391
208 Ga0209974_10009386 3300027876 Bacteria 3320
209 Ga0207428_10000511 3300027907 Bacteria 46384
210 Ga0268265_10001501 3300028380 Bacteria 19460
211 Ga0268265_10003537 3300028380 Bacteria 11176
212 Ga0268265_10200193 3300028380 Bacteria 1732
213 Ga0268265_10247271 3300028380 Bacteria 1577
214 Ga0268264_10001250 3300028381 Bacteria 24232
215 Ga0268264_10428194 3300028381 Bacteria 1277
216 Ga0307515_10000146 3300028794 Bacteria 170674
217 Ga0307515_10097414 3300028794 Bacteria 3595
218 Ga0265338_10010829 3300028800 Bacteria 10621
219 Ga0265339_10049938 3300031249 Bacteria 2289
220 Ga0265316_10038154 3300031344 Bacteria 3873
221 Ga0307513_10000348 3300031456 Bacteria 67217
222 Ga0307513_10003966 3300031456 Bacteria 19876
223 Ga0307513_10508467 3300031456 Bacteria 921
224 Ga0307408_100012356 3300031548 Bacteria 5653
225 Ga0265313_10076621 3300031595 Bacteria 1528
226 Ga0307508_10000877 3300031616 Bacteria 35003
227 Ga0307508_10189149 3300031616 Bacteria 1660
228 Ga0316575_10003242 3300031665 Bacteria 5587
229 Ga0265314_10087429 3300031711 Bacteria 2038
230 Ga0316578_10141458 3300031728 Bacteria 1449
231 Ga0307516_10056495 3300031730 Bacteria 3827
232 Ga0307405_10077284 3300031731 Bacteria 2163
233 Ga0307413_10006867 3300031824 Bacteria 5238
234 Ga0307413_10058107 3300031824 Bacteria 2369
235 Ga0307413_10060929 3300031824 Bacteria 2326
236 Ga0307413_10108471 3300031824 Bacteria 1853
237 Ga0307410_10028675 3300031852 Bacteria 3535
238 Ga0307410_10039895 3300031852 Bacteria 3086
239 Ga0307410_10417344 3300031852 Bacteria 1088
240 Ga0307406_10040901 3300031901 Bacteria 2885
241 Ga0307406_10124857 3300031901 Bacteria 1796
242 Ga0307406_10151838 3300031901 Bacteria 1653
243 Ga0307406_10292472 3300031901 Bacteria 1247
244 Ga0307407_10048224 3300031903 Bacteria 2423
245 Ga0307407_10256906 3300031903 Bacteria 1200
246 Ga0307407_10318857 3300031903 Bacteria 1090
247 Ga0307409_100026530 3300031995 Bacteria 4087
248 Ga0307409_100030396 3300031995 Bacteria 3880
249 Ga0307409_100105572 3300031995 Bacteria 2349
250 Ga0307409_100136053 3300031995 Bacteria 2109
251 Ga0307409_100201083 3300031995 Bacteria 1782
252 Ga0307409_100207137 3300031995 Bacteria 1759
253 Ga0307409_100358560 3300031995 Bacteria 1378
254 Ga0307416_100039149 3300032002 Bacteria 3667
255 Ga0307416_100066299 3300032002 Bacteria 2972
256 Ga0307416_100100394 3300032002 Bacteria 2517
257 Ga0307416_100500453 3300032002 Bacteria 1279
258 Ga0307414_10113363 3300032004 Bacteria 2069
259 Ga0307411_10070111 3300032005 Bacteria 2371
260 Ga0307411_10456219 3300032005 Bacteria 1070
261 Ga0307415_100049323 3300032126 Bacteria 2846
262 Ga0307415_100085515 3300032126 Bacteria 2266
263 Ga0307415_100124749 3300032126 Bacteria 1938
264 Ga0373944_0007920 3300035089 Bacteria 2861
265 Ga0373936_0023544 3300035113 Bacteria 2400
266 Ga0373945_0000906 3300035116 Bacteria 8768
267 Ga0373960_0037585 3300035121 Bacteria 1384
268 Ga0373942_0031690 3300035207 Bacteria 1400
269 Ga0373931_0046964 3300035691 Bacteria 2284
270 Ga0373935_0028624 3300035692 Bacteria 3443
271 Ga0373927_0076752 3300035695 Bacteria 2163
272 Ga0373937_0087892 3300036401 Bacteria 2877
273 Ga0373937_0749138 3300036401 Bacteria 924
274 Ga0395899_0111836 3300037312 Bacteria 1963
275 Ga0395905_0026111 3300037471 Bacteria 5508
276 Ga0395905_0070853 3300037471 Bacteria 3267
277 Ga0395901_0141996 3300038443 Bacteria 2524
278 Ga0400483_111606 3300039062 Bacteria 12518
279 Ga0400483_216617 3300039062 Bacteria 3646
280 Ga0436365_1221009 3300039437 Bacteria 1064
281 Ga0436365_1739787 3300039437 Bacteria 2124
282 Ga0436361_0243861 3300039447 Bacteria 3007
283 Ga0436361_0708487 3300039447 Bacteria 11844
284 Ga0439463_015678 3300042016 Bacteria 1874
285 Ga0450889_007717 3300042144 Bacteria 1088
286 Ga0466969_0003072 3300044656 Bacteria 8895
287 Ga0466965_0024663 3300044683 Bacteria 2910
288 Ga0466966_0000459 3300044684 Bacteria 26139
289 Ga0466971_0016437 3300044719 Bacteria 3266
290 Ga0466957_0020850 3300044842 Bacteria 3856
291 Ga0466960_0299421 3300044901 Bacteria 906
292 Ga0466959_0000108 3300045049 Bacteria 53075
293 Ga0466958_0000826 3300045836 Bacteria 13690
294 Ga0495603_0045213 3300046455 Bacteria 2626
295 Ga0495638_0013515 3300046460 Bacteria 5553
296 Ga0495580_0008453 3300046472 Bacteria 8188
297 Ga0495582_0014893 3300046473 Bacteria 4273
298 Ga0495639_0042303 3300046475 Bacteria 2054
299 Ga0495594_0018455 3300046499 Bacteria 3694
300 Ga0495666_0045358 3300046526 Bacteria 2121
301 Ga0495665_0056300 3300046531 Bacteria 2076
302 Ga0495586_0014623 3300046535 Bacteria 4170
303 Ga0495586_0140745 3300046535 Bacteria 1354
304 Ga0495598_0049476 3300046537 Bacteria 1260
305 Ga0495656_0140650 3300046615 Bacteria 1157
306 Ga0495625_0073648 3300046660 Bacteria 2393
307 Ga0495659_0003846 3300046664 Bacteria 4770
308 Ga0495588_0006502 3300046674 Bacteria 5269
309 Ga0495647_0000149 3300046681 Bacteria 17854
310 Ga0495658_0004682 3300046683 Bacteria 6729
311 Ga0495669_0000020 3300046684 Bacteria 122868
312 Ga0495669_0000449 3300046684 Bacteria 19393
313 Ga0495670_0035882 3300046691 Bacteria 2470
314 Ga0495676_0024337 3300047321 Bacteria 5244
315 Ga0496101_0147171 3300048904 Bacteria 1799
316 Ga0496102_0266025 3300048905 Bacteria 1617
317 Ga0496104_0094927 3300048907 Bacteria 2853
318 Ga0496105_0425841 3300048908 Bacteria 1050
319 Ga0496107_0152211 3300048910 Bacteria 1711
320 Ga0496111_0480970 3300048914 Bacteria 915
321 Ga0496114_0030552 3300048917 Bacteria 4433
322 Ga0496115_0000534 3300048918 Bacteria 29632
323 Ga0501032_0001944 3300049569 Bacteria 16256
324 Ga0501032_0037074 3300049569 Bacteria 3326
325 Ga0501033_0110261 3300049570 Bacteria 2003
326 Ga0501034_0037844 3300049571 Bacteria 4886
327 Ga0501034_0055006 3300049571 Bacteria 4005
328 Ga0501034_0224247 3300049571 Bacteria 1831
329 Ga0501038_0022623 3300049574 Bacteria 5629
330 Ga0501038_0066153 3300049574 Bacteria 3079
331 Ga0501038_0439055 3300049574 Bacteria 1005
332 Ga0501039_0156221 3300049575 Bacteria 1792
333 Ga0501039_0255157 3300049575 Bacteria 1379
334 Ga0501043_0020955 3300049579 Bacteria 5126
335 Ga0501047_0000556 3300049581 Bacteria 40169
336 Ga0501047_0072450 3300049581 Bacteria 3316
337 Ga0501048_0206770 3300049582 Bacteria 1392
338 Ga0501067_0000135 3300049583 Bacteria 40524
339 Ga0501067_0016494 3300049583 Bacteria 4081
340 Ga0501068_0000084 3300049584 Bacteria 39235
341 Ga0501070_0040847 3300049586 Bacteria 3866
342 Ga0501070_0057083 3300049586 Bacteria 3236
343 Ga0501071_0000138 3300049587 Bacteria 29742
344 Ga0501072_0000024 3300049588 Bacteria 143714
345 Ga0501073_0000643 3300049589 Bacteria 24522
346 Ga0501073_0021776 3300049589 Bacteria 4618
347 Ga0501073_0066335 3300049589 Bacteria 2516
348 Ga0501073_0090539 3300049589 Bacteria 2126
349 Ga0501074_0001580 3300049590 Bacteria 15428
350 Ga0501074_0284071 3300049590 Bacteria 1176
351 Ga0501075_0010147 3300049591 Bacteria 6609
352 Ga0501076_0248781 3300049592 Bacteria 1454
353 Ga0501077_0000013 3300049593 Bacteria 91207
354 Ga0501077_0045563 3300049593 Bacteria 2786
355 Ga0501222_003999 3300049662 Bacteria 1999
356 Ga0501221_001563 3300049704 Bacteria 3799
357 Ga0501229_001529 3300049706 Bacteria 2704
358 Ga0501079_0005281 3300049741 Bacteria 9608
359 Ga0501079_0006041 3300049741 Bacteria 9075
360 Ga0501079_0015366 3300049741 Bacteria 5841
361 Ga0501080_0000175 3300049742 Bacteria 47153
362 Ga0501080_0000305 3300049742 Bacteria 37512
363 Ga0501080_0001233 3300049742 Bacteria 21278
364 Ga0501080_0068996 3300049742 Bacteria 3288
365 Ga0501080_0357826 3300049742 Bacteria 1317
366 Ga0501081_0039702 3300049743 Bacteria 3222
367 Ga0501081_0190957 3300049743 Bacteria 1483
368 Ga0501083_0008284 3300049744 Bacteria 7351
369 Ga0501083_0116546 3300049744 Bacteria 1753
370 Ga0501282_010794 3300049778 Bacteria 981
371 Ga0501035_0054129 3300049822 Bacteria 3586
372 Ga0501035_0514251 3300049822 Bacteria 984
373 Ga0501044_0072275 3300049823 Bacteria 3507
374 Ga0501044_0307777 3300049823 Bacteria 1512
375 Ga0501044_0524792 3300049823 Bacteria 1083
376 nmdc:mga0yw44_49561_c1 3300050492 Bacteria 2535
377 nmdc:mga05p37_3182_c1 3300050507 Bacteria 19099
378 nmdc:mga09592_16166_c1 3300050508 Bacteria 6099
379 nmdc:mga09592_20300_c1 3300050508 Bacteria 5461
380 nmdc:mga06r32_8015_c1 3300050510 Bacteria 9498
381 nmdc:mga08y16_18462_c1 3300050511 Bacteria 7349
382 nmdc:mga0rr50_58270_c1 3300050513 Bacteria 2894
383 nmdc:mga0a205_105662_c1 3300050515 Bacteria 2714
384 Ga0500635_0002619 3300053080 Bacteria 4473
385 Ga0500644_0000005 3300053088 Bacteria 164966
386 Ga0500556_0001456 3300053104 Bacteria 9986
387 Ga0500594_0046745 3300053118 Bacteria 1205
388 Ga0500608_000043 3300053122 Bacteria 56214
389 Ga0500608_000344 3300053122 Bacteria 17973
390 Ga0500559_0000285 3300053136 Bacteria 39102
391 Ga0500600_0090709 3300053149 Bacteria 1632
392 Ga0500622_0016094 3300053156 Bacteria 3999
393 Ga0500622_0023495 3300053156 Bacteria 3265
394 Ga0501084_0000534 3300054114 Bacteria 28993
395 Ga0501084_0452671 3300054114 Bacteria 1085
396 Ga0501082_0000345 3300060353 Bacteria 40973
397 Ga0501082_0087198 3300060353 Bacteria 2693
398 Ga0501082_0223027 3300060353 Bacteria 1640
399 Ga0466962_0045131 3300061719 Bacteria 2106
400 Ga0466962_0235502 3300061719 Bacteria 898
401 Ga0530510_0003130 3300061734 Bacteria 11357
402 2587916110 2585428106 Bacteria 5179711
403 2643853395 2643221567 Bacteria 4163945
404 2644102196 2643221617 Bacteria 5139111
405 2644115419 2643221620 Bacteria 5134593
406 2644137355 2643221624 Bacteria 4384879
407 2644224362 2643221640 Bacteria 5258820
408 2644234701 2643221642 Bacteria 5357871
409 2739790513 2739367756 Bacteria 4553612
410 2819713866 2818991466 Bacteria 4748179
411 2849575351 2849573788 Bacteria 5421256
412 2851155419 2851153111 Bacteria 5542585
413 2857507321 2857504554 Bacteria 5369913
414 2884962861 2884960567 Bacteria 5437054
415 2898331245 2898329390 Bacteria 5168154
416 2906801441 2906799679 Bacteria 4031749
417 2928030983 2928027323 Bacteria 4382488
418 2928528422 2928526807 Bacteria 4760224
419 2928532623 2928531327 Bacteria 5101314
420 2984556135 2984555340 Bacteria 4247089
421 2984565757 2984564862 Bacteria 4339992
422 2993356768 2993356040 Bacteria 4247105
423 Ga0466959_0091915
424 ARSoilOldRDRAFT_c000982
425 ARCol0yngRDRAFT_1002494
426 JGI25153J46596_10037579
427 Ga0055526_1005109
428 Ga0055536_1000807
429 Ga0055530_10001027
430 Ga0055530_10004597
431 Ga0055531_10000277
432 Ga0055543_1015237
433 Ga0065165_1000413
434 Ga0070683_100160783
435 Ga0070683_100184424
436 Ga0070690_100000235
437 Ga0070670_100282013
438 Ga0068869_100000023
439 Ga0070680_100003526
440 Ga0070680_100022638
441 Ga0070682_100004674
442 Ga0068868_100000293
443 Ga0070689_100000974
444 Ga0070687_100000142
445 Ga0070692_10007542
446 Ga0070692_10031716
447 Ga0070668_100045627
448 Ga0070669_100025211
449 Ga0070675_100039339
450 Ga0070671_100350993
451 Ga0070674_100128806
452 Ga0070659_100007043
453 Ga0070659_100168731
454 Ga0070701_10000090
455 Ga0070705_100000668
456 Ga0070700_100001456
457 Ga0070694_100000160
458 Ga0070662_100218489
459 Ga0070681_10196914
460 Ga0068867_100001762
461 Ga0068867_100171019
462 Ga0070679_100400770
463 Ga0070684_100471917
464 Ga0068853_100017194
465 Ga0068853_100116873
466 Ga0068853_100192207
467 Ga0068853_100221637
468 Ga0070686_100000090
469 Ga0070695_100000130
470 Ga0070696_100000397
471 Ga0070693_100000496
472 Ga0070704_100000637
473 Ga0068855_100006339
474 Ga0070664_100079588
475 Ga0068857_100043802
476 Ga0068857_100069953
477 Ga0068854_100098445
478 Ga0068856_100017993
479 Ga0070702_100000356
480 Ga0070702_100088565
481 Ga0068852_100001272
482 Ga0068859_100001418
483 Ga0068859_100012557
484 Ga0068866_10000337
485 Ga0068861_100000043
486 Ga0068861_100008598
487 Ga0068863_100151676
488 Ga0068858_100002717
489 Ga0068860_100007750
490 Ga0068862_100000099
491 Ga0068862_100000320
492 Ga0068862_100033453
493 Ga0068862_100073360
494 Ga0068862_100439951
495 Ga0081539_10001023
496 Ga0081539_10001076
497 Ga0081539_10005739
498 Ga0081539_10012288
499 Ga0081539_10031963
500 Ga0081539_10043329
501 Ga0075365_10079948
502 Ga0075432_10030063
503 Ga0068871_100000040
504 Ga0075428_100005321
505 Ga0075430_100116315
506 Ga0075431_100013902
507 Ga0075434_100000006
508 Ga0075429_100009744
509 Ga0075429_100018270
510 Ga0068865_100000245
511 Ga0097620_100001418
512 Ga0097620_100012557
513 Ga0075435_100074465
514 Ga0099794_10016361
515 Ga0111539_10006936
516 Ga0105245_10000224
517 Ga0105245_10002081
518 Ga0105245_10032679
519 Ga0114129_10018298
520 Ga0114129_11192266
521 Ga0105243_10000035
522 Ga0105243_10010953
523 Ga0105242_10000300
524 Ga0105248_10734391
525 Ga0105237_10217749
526 Ga0105249_10044862
527 Ga0105249_10069161
528 Ga0105239_10007354
529 Ga0105239_10954642
530 Ga0105246_10181687
531 Ga0157373_10002515
532 Ga0157373_10007531
533 Ga0157373_10065847
534 Ga0157370_10222688
535 Ga0157370_10303403
536 Ga0157370_10382984
537 Ga0157378_10002478
538 Ga0157378_10191725
539 Ga0163162_10107615
540 Ga0157372_10016928
541 Ga0157375_10025894
542 Ga0157375_10366807
543 Ga0157376_10020252
544 Ga0183365_10001
545 Ga0213872_10000049
546 Ga0213872_10000079
547 Ga0213872_10006348
548 Ga0213876_10096835
549 Ga0209673_1013926
550 Ga0209676_1000099
551 Ga0209564_1000003
552 Ga0209564_1003748
553 Ga0209564_1015939
554 Ga0209758_1004816
555 Ga0209050_1000029
556 Ga0209050_1001822
557 Ga0209256_1040036
558 Ga0209051_1026939
559 Ga0209257_1000152
560 Ga0209257_1000203
561 Ga0207642_10002929
562 Ga0207688_10005498
563 Ga0207688_10251831
564 Ga0207645_10011068
565 Ga0207643_10017965
566 Ga0207654_10040257
567 Ga0207707_10265538
568 Ga0207671_10074689
569 Ga0207671_10168975
570 Ga0207660_10010313
571 Ga0207660_10045393
572 Ga0207660_10090431
573 Ga0207662_10000091
574 Ga0207657_10045018
575 Ga0207657_10065543
576 Ga0207659_10119657
577 Ga0207687_10005537
578 Ga0207687_10154650
579 Ga0207687_10413609
580 Ga0207664_10000252
581 Ga0207690_10055620
582 Ga0207690_10299421
583 Ga0207706_10254097
584 Ga0207686_10000914
585 Ga0207686_10256635
586 Ga0207709_10001149
587 Ga0207670_10005058
588 Ga0207669_10411180
589 Ga0207704_10001399
590 Ga0207704_10480319
591 Ga0207691_10418829
592 Ga0207711_10069039
593 Ga0207711_10089020
594 Ga0207711_10096690
595 Ga0207689_10000024
596 Ga0207689_10146568
597 Ga0207661_10388175
598 Ga0207679_10417605
599 Ga0207667_10040129
600 Ga0207712_10000026
601 Ga0207712_10055554
602 Ga0207668_10004794
603 Ga0207668_10120473
604 Ga0207640_10381337
605 Ga0207677_10000435
606 Ga0207703_10001473
607 Ga0207639_10006932
608 Ga0207639_10040952
609 Ga0207639_10158587
610 Ga0207639_10175525
611 Ga0207708_10001349
612 Ga0207708_10636444
613 Ga0207702_10130327
614 Ga0207648_10000316
615 Ga0207648_10302426
616 Ga0207674_10016115
617 Ga0207674_10122914
618 Ga0207674_10450716
619 Ga0207675_100000017
620 Ga0207675_100014822
621 Ga0207683_10049700
622 Ga0207683_10292085
623 Ga0207698_10146089
624 Ga0209969_1006348
625 Ga0209967_1000824
626 Ga0210000_1006442
627 Ga0209995_1002103
628 Ga0209968_1007392
629 Ga0209999_1002249
630 Ga0209974_10009386
631 Ga0207428_10000511
632 Ga0268265_10001501
633 Ga0268265_10003537
634 Ga0268265_10200193
635 Ga0268265_10247271
636 Ga0268264_10001250
637 Ga0268264_10428194
638 Ga0307515_10000146
639 Ga0307515_10097414
640 Ga0265338_10010829
641 Ga0265339_10049938
642 Ga0265316_10038154
643 Ga0307513_10000348
644 Ga0307513_10003966
645 Ga0307513_10508467
646 Ga0307408_100012356
647 Ga0265313_10076621
648 Ga0307508_10000877
649 Ga0307508_10189149
650 Ga0316575_10003242
651 Ga0265314_10087429
652 Ga0316578_10141458
653 Ga0307516_10056495
654 Ga0307405_10077284
655 Ga0307413_10006867
656 Ga0307413_10058107
657 Ga0307413_10060929
658 Ga0307413_10108471
659 Ga0307410_10028675
660 Ga0307410_10039895
661 Ga0307410_10417344
662 Ga0307406_10040901
663 Ga0307406_10124857
664 Ga0307406_10151838
665 Ga0307406_10292472
666 Ga0307407_10048224
667 Ga0307407_10256906
668 Ga0307407_10318857
669 Ga0307409_100026530
670 Ga0307409_100030396
671 Ga0307409_100105572
672 Ga0307409_100136053
673 Ga0307409_100201083
674 Ga0307409_100207137
675 Ga0307409_100358560
676 Ga0307416_100039149
677 Ga0307416_100066299
678 Ga0307416_100100394
679 Ga0307416_100500453
680 Ga0307414_10113363
681 Ga0307411_10070111
682 Ga0307411_10456219
683 Ga0307415_100049323
684 Ga0307415_100085515
685 Ga0307415_100124749
686 Ga0373944_0007920
687 Ga0373936_0023544
688 Ga0373945_0000906
689 Ga0373960_0037585
690 Ga0373942_0031690
691 Ga0373931_0046964
692 Ga0373935_0028624
693 Ga0373927_0076752
694 Ga0373937_0087892
695 Ga0373937_0749138
696 Ga0395899_0111836
697 Ga0395905_0026111
698 Ga0395905_0070853
699 Ga0395901_0141996
700 Ga0400483_111606
701 Ga0400483_216617
702 Ga0436365_1221009
703 Ga0436365_1739787
704 Ga0436361_0243861
705 Ga0436361_0708487
706 Ga0439463_015678
707 Ga0450889_007717
708 Ga0466969_0003072
709 Ga0466965_0024663
710 Ga0466966_0000459
711 Ga0466971_0016437
712 Ga0466957_0020850
713 Ga0466960_0299421
714 Ga0466959_0000108
715 Ga0466958_0000826
716 Ga0495603_0045213
717 Ga0495638_0013515
718 Ga0495580_0008453
719 Ga0495582_0014893
720 Ga0495639_0042303
721 Ga0495594_0018455
722 Ga0495666_0045358
723 Ga0495665_0056300
724 Ga0495586_0014623
725 Ga0495586_0140745
726 Ga0495598_0049476
727 Ga0495656_0140650
728 Ga0495625_0073648
729 Ga0495659_0003846
730 Ga0495588_0006502
731 Ga0495647_0000149
732 Ga0495658_0004682
733 Ga0495669_0000020
734 Ga0495669_0000449
735 Ga0495670_0035882
736 Ga0495676_0024337
737 Ga0496101_0147171
738 Ga0496102_0266025
739 Ga0496104_0094927
740 Ga0496105_0425841
741 Ga0496107_0152211
742 Ga0496111_0480970
743 Ga0496114_0030552
744 Ga0496115_0000534
745 Ga0501032_0001944
746 Ga0501032_0037074
747 Ga0501033_0110261
748 Ga0501034_0037844
749 Ga0501034_0055006
750 Ga0501034_0224247
751 Ga0501038_0022623
752 Ga0501038_0066153
753 Ga0501038_0439055
754 Ga0501039_0156221
755 Ga0501039_0255157
756 Ga0501043_0020955
757 Ga0501047_0000556
758 Ga0501047_0072450
759 Ga0501048_0206770
760 Ga0501067_0000135
761 Ga0501067_0016494
762 Ga0501068_0000084
763 Ga0501070_0040847
764 Ga0501070_0057083
765 Ga0501071_0000138
766 Ga0501072_0000024
767 Ga0501073_0000643
768 Ga0501073_0021776
769 Ga0501073_0066335
770 Ga0501073_0090539
771 Ga0501074_0001580
772 Ga0501074_0284071
773 Ga0501075_0010147
774 Ga0501076_0248781
775 Ga0501077_0000013
776 Ga0501077_0045563
777 Ga0501222_003999
778 Ga0501221_001563
779 Ga0501229_001529
780 Ga0501079_0005281
781 Ga0501079_0006041
782 Ga0501079_0015366
783 Ga0501080_0000175
784 Ga0501080_0000305
785 Ga0501080_0001233
786 Ga0501080_0068996
787 Ga0501080_0357826
788 Ga0501081_0039702
789 Ga0501081_0190957
790 Ga0501083_0008284
791 Ga0501083_0116546
792 Ga0501282_010794
793 Ga0501035_0054129
794 Ga0501035_0514251
795 Ga0501044_0072275
796 Ga0501044_0307777
797 Ga0501044_0524792
798 nmdc:mga0yw44_49561_c1
799 nmdc:mga05p37_3182_c1
800 nmdc:mga09592_16166_c1
801 nmdc:mga09592_20300_c1
802 nmdc:mga06r32_8015_c1
803 nmdc:mga08y16_18462_c1
804 nmdc:mga0rr50_58270_c1
805 nmdc:mga0a205_105662_c1
806 Ga0500635_0002619
807 Ga0500644_0000005
808 Ga0500556_0001456
809 Ga0500594_0046745
810 Ga0500608_000043
811 Ga0500608_000344
812 Ga0500559_0000285
813 Ga0500600_0090709
814 Ga0500622_0016094
815 Ga0500622_0023495
816 Ga0501084_0000534
817 Ga0501084_0452671
818 Ga0501082_0000345
819 Ga0501082_0087198
820 Ga0501082_0223027
821 Ga0466962_0045131
822 Ga0466962_0235502
823 Ga0530510_0003130
824 2587916110
825 2643853395
826 2644102196
827 2644115419
828 2644137355
829 2644224362
830 2644234701
831 2739790513
832 2819713866
833 2849575351
834 2851155419
835 2857507321
836 2884962861
837 2898331245
838 2906801441
839 2928030983
840 2928528422
841 2928532623
842 2984556135
843 2984565757
844 2993356768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

13

262

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6auj-assembly1.cif.gz_A-2 crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.9865 1 249
6auj-assembly2.cif.gz_C crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.9832 1 249
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9826 3 262
1nce-assembly1.cif.gz_B crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 0.9816 3 264
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9815 3 264
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9753 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9662 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9591 2 264 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9545 2 259 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.954 2 262 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9976 119 249
AF-A0A1G0F8E3-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9973 66 204 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9967 99 229 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2E8YSB0-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9962 145 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A661Z4R5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9943 112 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map